30S ribosomal protein S14
Details
- Name
- 30S ribosomal protein S14
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- rpsN
- UniProtKB Entry
- P0AG59Swiss-Prot
- Organism
- Escherichia coli (strain K12)
- NCBI Taxonomy ID
- 83333
- Amino acid sequence
>lcl|BSEQ0017192|30S ribosomal protein S14 MAKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQ RNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
- Number of residues
- 101
- Molecular Weight
- 11580.36
- Theoretical pI
- 11.75
- GO Classification
- FunctionsrRNA binding / structural constituent of ribosomeProcessestranslationComponentscytosolic small ribosomal subunit
- General Function
- Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site.
- Specific Function
- rRNA binding
- Pfam Domain Function
- Ribosomal_S14 (PF00253)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0017193|30S ribosomal protein S14 (rpsN) ATGGCTAAGCAATCAATGAAAGCACGCGAAGTAAAACGCGTAGCTTTAGCTGATAAATAC TTCGCGAAACGCGCTGAACTGAAAGCGATCATCTCTGATGTGAACGCTTCCGACGAAGAT CGTTGGAACGCTGTTCTCAAGCTGCAGACTCTGCCGCGTGATTCCAGCCCGTCTCGTCAG CGTAACCGCTGCCGTCAAACAGGTCGTCCGCATGGTTTCCTGCGGAAGTTCGGGTTGAGC CGTATTAAGGTCCGTGAAGCCGCTATGCGCGGTGAAATCCCGGGTCTGAAAAAGGCTAGC TGGTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0AG59 UniProtKB Entry Name RS14_ECOLI GenBank Protein ID 809690 GenBank Gene ID X01563 PDB ID(s) 1M5G, 2YKR, 3J9Y, 3J9Z, 3JA1, 4A2I, 4ADV, 4U1U, 4U1V, 4U20, 4U24, 4U25, 4U26, 4U27, 4V47, 4V48, 4V4H, 4V4Q, 4V4V, 4V4W, 4V50, 4V52, 4V53, 4V54, 4V55, 4V56, 4V57, 4V5B, 4V5H, 4V5Y, 4V64, 4V65, 4V66, 4V69, 4V6C, 4V6D, 4V6E, 4V6K, 4V6L, 4V6M, 4V6N, 4V6O, 4V6P, 4V6Q, 4V6R, 4V6S, 4V6T, 4V6V, 4V6Y, 4V6Z, 4V70, 4V71, 4V72, 4V73, 4V74, 4V75, 4V76, 4V77, 4V78, 4V79, 4V7A, 4V7B, 4V7C, 4V7D, 4V7I, 4V7S, 4V7T, 4V7U, 4V7V, 4V85, 4V89, 4V9C, 4V9D, 4V9O, 4V9P, 4WF1, 4WOI, 4WWW, 4YBB, 5AFI KEGG ID ecj:JW3269 NCBI Gene ID 947801 - General References
- Cerretti DP, Dean D, Davis GR, Bedwell DM, Nomura M: The spc ribosomal protein operon of Escherichia coli: sequence and cotranscription of the ribosomal protein genes and a protein export gene. Nucleic Acids Res. 1983 May 11;11(9):2599-616. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Tigecycline approved yes target binder Details Tetracycline approved, vet_approved, withdrawn yes target inhibitor Details Chlortetracycline approved, investigational, vet_approved yes target inhibitor Details Plazomicin approved, investigational unknown target inhibitor Details Omadacycline approved, investigational yes target inhibitor Details