30S ribosomal protein S8
Details
- Name
- 30S ribosomal protein S8
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- rpsH
- UniProtKB Entry
- P0A7W7Swiss-Prot
- Organism
- Escherichia coli (strain K12)
- NCBI Taxonomy ID
- 83333
- Amino acid sequence
>lcl|BSEQ0019611|30S ribosomal protein S8 MSMQDPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELE LTLKYFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAG LGGEIICYVA
- Number of residues
- 130
- Molecular Weight
- 14126.435
- Theoretical pI
- Not Available
- GO Classification
- FunctionsrRNA binding / structural constituent of ribosomeProcessesregulation of mRNA stability / regulation of translation / translationComponentscytosol / cytosolic small ribosomal subunit
- General Function
- One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit.
- Specific Function
- rRNA binding
- Pfam Domain Function
- Ribosomal_S8 (PF00410)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0019612|30S ribosomal protein S8 (rpsH) ATGAGCATGCAAGATCCGATCGCGGATATGCTGACCCGTATCCGTAACGGTCAGGCCGCG AACAAAGCTGCGGTCACCATGCCTTCCTCCAAGCTGAAAGTGGCAATCGCCAACGTGCTG AAGGAAGAAGGTTTTATTGAAGATTTTAAAGTTGAAGGCGACACCAAGCCTGAACTGGAA CTTACTCTGAAGTATTTCCAGGGCAAAGCTGTTGTAGAAAGCATTCAGCGTGTCAGCCGC CCAGGTCTGCGCATCTATAAACGTAAAGATGAGCTGCCGAAAGTTATGGCGGGTCTGGGT ATCGCAGTTGTTTCTACCTCTAAAGGTGTTATGACTGATCGTGCAGCGCGCCAGGCTGGT CTTGGTGGCGAAATTATCTGCTACGTAGCCTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A7W7 UniProtKB Entry Name RS8_ECOLI PDB ID(s) 1EG0, 1M5G, 1S03, 2YKR, 3J9Y, 3J9Z, 3JA1, 4A2I, 4ADV, 4U1U, 4U1V, 4U20, 4U24, 4U25, 4U26, 4U27, 4V47, 4V48, 4V4H, 4V4Q, 4V4V, 4V4W, 4V50, 4V52, 4V53, 4V54, 4V55, 4V56, 4V57, 4V5B, 4V5H, 4V5Y, 4V64, 4V65, 4V66, 4V69, 4V6C, 4V6D, 4V6E, 4V6K, 4V6L, 4V6M, 4V6N, 4V6O, 4V6P, 4V6Q, 4V6R, 4V6S, 4V6T, 4V6V, 4V6Y, 4V6Z, 4V70, 4V71, 4V72, 4V73, 4V74, 4V75, 4V76, 4V77, 4V78, 4V79, 4V7A, 4V7B, 4V7C, 4V7D, 4V7I, 4V7S, 4V7T, 4V7U, 4V7V, 4V85, 4V89, 4V9C, 4V9D, 4V9O, 4V9P, 4WF1, 4WOI, 4WWW, 4YBB, 5AFI KEGG ID ecj:JW3268 NCBI Gene ID 947802 - General References
- Cerretti DP, Dean D, Davis GR, Bedwell DM, Nomura M: The spc ribosomal protein operon of Escherichia coli: sequence and cotranscription of the ribosomal protein genes and a protein export gene. Nucleic Acids Res. 1983 May 11;11(9):2599-616. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Allen G, Wittmann-Liebold B: The amino acid sequence of the ribosomal protein S8 of Escherichia coli. Hoppe Seylers Z Physiol Chem. 1978 Nov;359(11):1509-25. [Article]
- Olins PO, Nomura M: Translational regulation by ribosomal protein S8 in Escherichia coli: structural homology between rRNA binding site and feedback target on mRNA. Nucleic Acids Res. 1981 Apr 10;9(7):1757-64. [Article]
- Wower I, Kowaleski MP, Sears LE, Zimmermann RA: Mutagenesis of ribosomal protein S8 from Escherichia coli: defects in regulation of the spc operon. J Bacteriol. 1992 Feb;174(4):1213-21. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Tetracycline approved, vet_approved, withdrawn yes target inhibitor Details Chlortetracycline approved, investigational, vet_approved yes target inhibitor Details Omadacycline approved, investigational yes target inhibitor Details