Malaria protein EXP-1
Details
- Name
- Malaria protein EXP-1
- Kind
- protein
- Synonyms
- Exported antigen AG 5.1
- Gene Name
- EXP-1
- UniProtKB Entry
- P04926Swiss-Prot
- Organism
- Plasmodium falciparum
- NCBI Taxonomy ID
- 5833
- Amino acid sequence
>lcl|BSEQ0018909|Malaria protein EXP-1 MKILSVFFLVLFFIIFNKESLAEKTNKETGSGVSSKKKNKKGSGEPLIDVHDLISDMIKK EEELVEVNKRKSKYKLATSVLAGLLGVVSTVLLGGVGLVLYNTEKGRHPFKIGSSDPADN ANPDADSESNGEPNADPQVTAQDVTPEQPQGDDNNLVSGPEH
- Number of residues
- 162
- Molecular Weight
- 17449.565
- Theoretical pI
- Not Available
- GO Classification
- Componentsintegral component of membrane / symbiont-containing vacuole membrane
- General Function
- Not Available
- Specific Function
- Not Available
- Pfam Domain Function
- CRA (PF06589)
- Signal Regions
- 1-22
- Transmembrane Regions
- 80-101
- Cellular Location
- Parasitophorous vacuole membrane
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P04926 UniProtKB Entry Name EXP1_PLAFA - General References
- Simmons D, Woollett G, Bergin-Cartwright M, Kay D, Scaife J: A malaria protein exported into a new compartment within the host erythrocyte. EMBO J. 1987 Feb;6(2):485-91. [Article]
- Hope IA, Mackay M, Hyde JE, Goman M, Scaife J: The gene for an exported antigen of the malaria parasite Plasmodium falciparum cloned and expressed in Escherichia coli. Nucleic Acids Res. 1985 Jan 25;13(2):369-79. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Artesunate approved, investigational yes target inhibitor Details