Location via proxy:   [ UP ]  
[Report a bug]   [Manage cookies]                
U.S. flag

An official website of the United States government

Current GenBank Release Notes

GBREL.TXT          Genetic Sequence Data Bank
                         June 15 2024

               NCBI-GenBank Flat File Release 261.0

                    Distribution Release Notes

  251094334 sequences,  3387240663231 bases, for traditional GenBank records
 4263077655 sequences, 28650117876455 bases, for set-based (WGS/TSA/TLS) records

  This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:

   GenBank
   National Center for Biotechnology Information
   National Library of Medicine, 38A, 8N805
   8600 Rockville Pike
   Bethesda, MD  20894
   USA

 GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:

	http://www.ncbi.nih.gov/Genbank/TPA.html
	http://www.ncbi.nlm.nih.gov/RefSeq

==========================================================================
TABLE OF CONTENTS
==========================================================================

1. INTRODUCTION

1.1 Release 261.0
1.2 Cutoff Date
1.3 Important Changes in Release 261.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document

2. ORGANIZATION OF DATA FILES

2.1 Overview
2.2 Files
     2.2.1 File Descriptions
     2.2.5 File Sizes
     2.2.6 Per-Division Statistics 
     2.2.7 Selected Per-Organism Statistics 
     2.2.8 Growth of GenBank

3. FILE FORMATS

3.1 File Header Information
3.4 Sequence Entry Files
     3.4.1 File Organization
     3.4.2  Entry Organization
     3.4.3 Sample Sequence Data File
     3.4.4 LOCUS Format
     3.4.5 DEFINITION Format
          3.4.5.1 DEFINITION Format for NLM Entries
     3.4.6 ACCESSION Format
     3.4.7 VERSION Format
     3.4.8 KEYWORDS Format
     3.4.9 SEGMENT Format
     3.4.10 SOURCE Format
     3.4.11 REFERENCE Format
     3.4.12 FEATURES Format
          3.4.12.1 Feature Key Names
          3.4.12.2 Feature Location
          3.4.12.3  Feature Qualifiers
          3.4.12.4 Cross-Reference Information
          3.4.12.5 Feature Table Examples
     3.4.13 ORIGIN Format
     3.4.14 SEQUENCE Format
     3.4.15 CONTIG Format

4. ALTERNATE RELEASES

5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries

6. GENBANK ADMINISTRATION 

6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer

==========================================================================

1. INTRODUCTION

1.1 Release 261.0

  The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database.  NCBI handles
all GenBank direct submissions and authors are advised to use the address
below.  Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.

*****************************************************************************

The address for direct submissions to GenBank is:

       GenBank Submissions
       National Center for Biotechnology Information
       Bldg 38A, Rm. 8N-803
       8600 Rockville Pike
       Bethesda, MD 20894

       Email:  gb-sub@ncbi.nlm.nih.gov

Updates and changes to existing GenBank records:

       https://www.ncbi.nlm.nih.gov/genbank/update/
       Email: update@ncbi.nlm.nih.gov

URLs for GenBank's web-based submission tools:

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

See Section 1.5 for additional details about submitting data to GenBank.

*****************************************************************************

  GenBank Release 261.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :

	ftp://ftp.ncbi.nih.gov/ncbi-asn1
	ftp://ftp.ncbi.nih.gov/genbank

  GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:

        ftp://ftp.ncbi.nih.gov/genbank/wgs
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	
        ftp://ftp.ncbi.nih.gov/genbank/tsa
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	
        ftp://ftp.ncbi.nih.gov/genbank/tls
        ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls

See the README files in those areas for more information.

  Mirrors of NCBI's GenBank FTP site are sometimes available from alternate
sites. For example:

	ftp://lucid.bic.nus.edu.sg/biomirrors/genbank/

  Some users who experience slow FTP transfers of large files might realize
an improvement in transfer rates from a mirror site when the volume of traffic
at the NCBI is high.

1.2 Cutoff Date

  This full release, 261.0, incorporates data processed by the INSDC databases
as of Saturday December 16 at 11:22PM EST. For more recent data, users are
advised to:

  o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:

	ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
	ftp://ftp.ncbi.nih.gov/genbank/daily-nc   (flatfile format)

  o Use the interactive Network-Entrez or Web-Entrez applications to query
    the 'Entrez: Nucleotide' database (see Section 6.4 of this document).

1.3 Important Changes in Release 261.0

1.3.1 Organizational changes

  The number of sequence data files for GenBank 261.0 has been reduced by
about 50 percent, from 10,388 (Release 260.0) to 5,024 (Release 261.0).

  Sequencing efforts such as the Darwin Tree of Life project have yielded
a growing number of single, traditional (non-WGS) chromosomal sequence
records that are gigabase in scale. Given our 500 megabyte target for the
size of uncompressed sequence files, this has resulted in a growing
number of files containing just one or two sequence records (which
naturally can exceed the 500MB target, given the many gigabase-scale records
that now exist). For GenBank 260.0 there were 2,753 such files.

  To address this problem, the target size was tripled to 1.5 gigabytes,
resulting in approximately half the total number of sequence files, of
which just 1,363 contain only one or two records.

  Given this reduction, the usual per-division description of sequence file
increases is not possible. We will resume providing that information as of
GenBank Release 262.0 .

1.3.2 The /country qualifier has transitioned to /geo_loc_name

  As of this June 2024 GenBank Release 262.0, the name of the "country"
qualifier has been changed to "geo_loc_name", to reflect the fact that
it is used for geographic features (for example: islands, oceans and seas)
in addition to country names. For further information, please see:

https://ncbiinsights.ncbi.nlm.nih.gov/2023/12/14/update-genbank-qualifier/

1.4 Upcoming Changes

1.4.1 New allowed values for the /geo_loc_name and /collection_date qualifiers

  The INSDC will begin to mandate inclusion of /geo_loc_name (formerly /country)
and /collection_date for sequence submissions, in alignment with its goal of
increasing the number of sequences for which the origin of a sample can be
precisely located in time and space. This requirement is expected to take
effect by the end of December 2024, and further details can be found at:

https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/

  Because there are valid circumstances in which location and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:

    missing
    not applicable
    not collected
    not provided
    restricted access
    missing: control sample
    missing: sample group
    missing: synthetic construct
    missing: lab stock
    missing: third party data
    missing: data agreement established pre-2023
    missing: endangered species
    missing: human-identifiable

  The timeframe for introducing these new values is still uncertain, but the
earliest possible date for their appearance was June 15 2023.

1.5 Request for Direct Submission of Sequence Data

  A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.

  GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:

	https://www.ncbi.nlm.nih.gov/genbank/submit/

  To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.

	Submission Portal    https://submit.ncbi.nlm.nih.gov/
	BankIt               https://www.ncbi.nlm.nih.gov/WebSub/

  Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).

  BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.

  Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant:

	table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/

  table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:

	https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/

  Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.

	Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/

  Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).

  AUTHORIN.  Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.

  SEQUIN.  As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI.  See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/

  If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .

1.6 Organization of This Document

   The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files.  The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.

2. ORGANIZATION OF DATA FILES

2.1 Overview

  GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.

2.2 Files

  This GenBank flat file release consists of 5028 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.

2.2.1 File Descriptions

Files included in this release are:

1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct413.seq - Bacterial sequence entries, part 413.
351. gbbct414.seq - Bacterial sequence entries, part 414.
352. gbbct415.seq - Bacterial sequence entries, part 415.
353. gbbct416.seq - Bacterial sequence entries, part 416.
354. gbbct417.seq - Bacterial sequence entries, part 417.
355. gbbct418.seq - Bacterial sequence entries, part 418.
356. gbbct419.seq - Bacterial sequence entries, part 419.
357. gbbct42.seq - Bacterial sequence entries, part 42.
358. gbbct420.seq - Bacterial sequence entries, part 420.
359. gbbct421.seq - Bacterial sequence entries, part 421.
360. gbbct422.seq - Bacterial sequence entries, part 422.
361. gbbct423.seq - Bacterial sequence entries, part 423.
362. gbbct424.seq - Bacterial sequence entries, part 424.
363. gbbct425.seq - Bacterial sequence entries, part 425.
364. gbbct426.seq - Bacterial sequence entries, part 426.
365. gbbct427.seq - Bacterial sequence entries, part 427.
366. gbbct428.seq - Bacterial sequence entries, part 428.
367. gbbct429.seq - Bacterial sequence entries, part 429.
368. gbbct43.seq - Bacterial sequence entries, part 43.
369. gbbct430.seq - Bacterial sequence entries, part 430.
370. gbbct431.seq - Bacterial sequence entries, part 431.
371. gbbct432.seq - Bacterial sequence entries, part 432.
372. gbbct433.seq - Bacterial sequence entries, part 433.
373. gbbct434.seq - Bacterial sequence entries, part 434.
374. gbbct435.seq - Bacterial sequence entries, part 435.
375. gbbct436.seq - Bacterial sequence entries, part 436.
376. gbbct437.seq - Bacterial sequence entries, part 437.
377. gbbct438.seq - Bacterial sequence entries, part 438.
378. gbbct439.seq - Bacterial sequence entries, part 439.
379. gbbct44.seq - Bacterial sequence entries, part 44.
380. gbbct440.seq - Bacterial sequence entries, part 440.
381. gbbct441.seq - Bacterial sequence entries, part 441.
382. gbbct442.seq - Bacterial sequence entries, part 442.
383. gbbct443.seq - Bacterial sequence entries, part 443.
384. gbbct444.seq - Bacterial sequence entries, part 444.
385. gbbct445.seq - Bacterial sequence entries, part 445.
386. gbbct446.seq - Bacterial sequence entries, part 446.
387. gbbct447.seq - Bacterial sequence entries, part 447.
388. gbbct448.seq - Bacterial sequence entries, part 448.
389. gbbct449.seq - Bacterial sequence entries, part 449.
390. gbbct45.seq - Bacterial sequence entries, part 45.
391. gbbct450.seq - Bacterial sequence entries, part 450.
392. gbbct451.seq - Bacterial sequence entries, part 451.
393. gbbct452.seq - Bacterial sequence entries, part 452.
394. gbbct453.seq - Bacterial sequence entries, part 453.
395. gbbct454.seq - Bacterial sequence entries, part 454.
396. gbbct455.seq - Bacterial sequence entries, part 455.
397. gbbct456.seq - Bacterial sequence entries, part 456.
398. gbbct457.seq - Bacterial sequence entries, part 457.
399. gbbct458.seq - Bacterial sequence entries, part 458.
400. gbbct459.seq - Bacterial sequence entries, part 459.
401. gbbct46.seq - Bacterial sequence entries, part 46.
402. gbbct460.seq - Bacterial sequence entries, part 460.
403. gbbct461.seq - Bacterial sequence entries, part 461.
404. gbbct462.seq - Bacterial sequence entries, part 462.
405. gbbct463.seq - Bacterial sequence entries, part 463.
406. gbbct464.seq - Bacterial sequence entries, part 464.
407. gbbct465.seq - Bacterial sequence entries, part 465.
408. gbbct466.seq - Bacterial sequence entries, part 466.
409. gbbct467.seq - Bacterial sequence entries, part 467.
410. gbbct468.seq - Bacterial sequence entries, part 468.
411. gbbct469.seq - Bacterial sequence entries, part 469.
412. gbbct47.seq - Bacterial sequence entries, part 47.
413. gbbct470.seq - Bacterial sequence entries, part 470.
414. gbbct471.seq - Bacterial sequence entries, part 471.
415. gbbct472.seq - Bacterial sequence entries, part 472.
416. gbbct473.seq - Bacterial sequence entries, part 473.
417. gbbct474.seq - Bacterial sequence entries, part 474.
418. gbbct475.seq - Bacterial sequence entries, part 475.
419. gbbct476.seq - Bacterial sequence entries, part 476.
420. gbbct477.seq - Bacterial sequence entries, part 477.
421. gbbct478.seq - Bacterial sequence entries, part 478.
422. gbbct479.seq - Bacterial sequence entries, part 479.
423. gbbct48.seq - Bacterial sequence entries, part 48.
424. gbbct480.seq - Bacterial sequence entries, part 480.
425. gbbct481.seq - Bacterial sequence entries, part 481.
426. gbbct482.seq - Bacterial sequence entries, part 482.
427. gbbct483.seq - Bacterial sequence entries, part 483.
428. gbbct484.seq - Bacterial sequence entries, part 484.
429. gbbct485.seq - Bacterial sequence entries, part 485.
430. gbbct486.seq - Bacterial sequence entries, part 486.
431. gbbct487.seq - Bacterial sequence entries, part 487.
432. gbbct488.seq - Bacterial sequence entries, part 488.
433. gbbct489.seq - Bacterial sequence entries, part 489.
434. gbbct49.seq - Bacterial sequence entries, part 49.
435. gbbct5.seq - Bacterial sequence entries, part 5.
436. gbbct50.seq - Bacterial sequence entries, part 50.
437. gbbct51.seq - Bacterial sequence entries, part 51.
438. gbbct52.seq - Bacterial sequence entries, part 52.
439. gbbct53.seq - Bacterial sequence entries, part 53.
440. gbbct54.seq - Bacterial sequence entries, part 54.
441. gbbct55.seq - Bacterial sequence entries, part 55.
442. gbbct56.seq - Bacterial sequence entries, part 56.
443. gbbct57.seq - Bacterial sequence entries, part 57.
444. gbbct58.seq - Bacterial sequence entries, part 58.
445. gbbct59.seq - Bacterial sequence entries, part 59.
446. gbbct6.seq - Bacterial sequence entries, part 6.
447. gbbct60.seq - Bacterial sequence entries, part 60.
448. gbbct61.seq - Bacterial sequence entries, part 61.
449. gbbct62.seq - Bacterial sequence entries, part 62.
450. gbbct63.seq - Bacterial sequence entries, part 63.
451. gbbct64.seq - Bacterial sequence entries, part 64.
452. gbbct65.seq - Bacterial sequence entries, part 65.
453. gbbct66.seq - Bacterial sequence entries, part 66.
454. gbbct67.seq - Bacterial sequence entries, part 67.
455. gbbct68.seq - Bacterial sequence entries, part 68.
456. gbbct69.seq - Bacterial sequence entries, part 69.
457. gbbct7.seq - Bacterial sequence entries, part 7.
458. gbbct70.seq - Bacterial sequence entries, part 70.
459. gbbct71.seq - Bacterial sequence entries, part 71.
460. gbbct72.seq - Bacterial sequence entries, part 72.
461. gbbct73.seq - Bacterial sequence entries, part 73.
462. gbbct74.seq - Bacterial sequence entries, part 74.
463. gbbct75.seq - Bacterial sequence entries, part 75.
464. gbbct76.seq - Bacterial sequence entries, part 76.
465. gbbct77.seq - Bacterial sequence entries, part 77.
466. gbbct78.seq - Bacterial sequence entries, part 78.
467. gbbct79.seq - Bacterial sequence entries, part 79.
468. gbbct8.seq - Bacterial sequence entries, part 8.
469. gbbct80.seq - Bacterial sequence entries, part 80.
470. gbbct81.seq - Bacterial sequence entries, part 81.
471. gbbct82.seq - Bacterial sequence entries, part 82.
472. gbbct83.seq - Bacterial sequence entries, part 83.
473. gbbct84.seq - Bacterial sequence entries, part 84.
474. gbbct85.seq - Bacterial sequence entries, part 85.
475. gbbct86.seq - Bacterial sequence entries, part 86.
476. gbbct87.seq - Bacterial sequence entries, part 87.
477. gbbct88.seq - Bacterial sequence entries, part 88.
478. gbbct89.seq - Bacterial sequence entries, part 89.
479. gbbct9.seq - Bacterial sequence entries, part 9.
480. gbbct90.seq - Bacterial sequence entries, part 90.
481. gbbct91.seq - Bacterial sequence entries, part 91.
482. gbbct92.seq - Bacterial sequence entries, part 92.
483. gbbct93.seq - Bacterial sequence entries, part 93.
484. gbbct94.seq - Bacterial sequence entries, part 94.
485. gbbct95.seq - Bacterial sequence entries, part 95.
486. gbbct96.seq - Bacterial sequence entries, part 96.
487. gbbct97.seq - Bacterial sequence entries, part 97.
488. gbbct98.seq - Bacterial sequence entries, part 98.
489. gbbct99.seq - Bacterial sequence entries, part 99.
490. gbchg.txt - Accession numbers of entries updated since the previous release.
491. gbcon1.seq - Constructed sequence entries, part 1.
492. gbcon10.seq - Constructed sequence entries, part 10.
493. gbcon100.seq - Constructed sequence entries, part 100.
494. gbcon101.seq - Constructed sequence entries, part 101.
495. gbcon11.seq - Constructed sequence entries, part 11.
496. gbcon12.seq - Constructed sequence entries, part 12.
497. gbcon13.seq - Constructed sequence entries, part 13.
498. gbcon14.seq - Constructed sequence entries, part 14.
499. gbcon15.seq - Constructed sequence entries, part 15.
500. gbcon16.seq - Constructed sequence entries, part 16.
501. gbcon17.seq - Constructed sequence entries, part 17.
502. gbcon18.seq - Constructed sequence entries, part 18.
503. gbcon19.seq - Constructed sequence entries, part 19.
504. gbcon2.seq - Constructed sequence entries, part 2.
505. gbcon20.seq - Constructed sequence entries, part 20.
506. gbcon21.seq - Constructed sequence entries, part 21.
507. gbcon22.seq - Constructed sequence entries, part 22.
508. gbcon23.seq - Constructed sequence entries, part 23.
509. gbcon24.seq - Constructed sequence entries, part 24.
510. gbcon25.seq - Constructed sequence entries, part 25.
511. gbcon26.seq - Constructed sequence entries, part 26.
512. gbcon27.seq - Constructed sequence entries, part 27.
513. gbcon28.seq - Constructed sequence entries, part 28.
514. gbcon29.seq - Constructed sequence entries, part 29.
515. gbcon3.seq - Constructed sequence entries, part 3.
516. gbcon30.seq - Constructed sequence entries, part 30.
517. gbcon31.seq - Constructed sequence entries, part 31.
518. gbcon32.seq - Constructed sequence entries, part 32.
519. gbcon33.seq - Constructed sequence entries, part 33.
520. gbcon34.seq - Constructed sequence entries, part 34.
521. gbcon35.seq - Constructed sequence entries, part 35.
522. gbcon36.seq - Constructed sequence entries, part 36.
523. gbcon37.seq - Constructed sequence entries, part 37.
524. gbcon38.seq - Constructed sequence entries, part 38.
525. gbcon39.seq - Constructed sequence entries, part 39.
526. gbcon4.seq - Constructed sequence entries, part 4.
527. gbcon40.seq - Constructed sequence entries, part 40.
528. gbcon41.seq - Constructed sequence entries, part 41.
529. gbcon42.seq - Constructed sequence entries, part 42.
530. gbcon43.seq - Constructed sequence entries, part 43.
531. gbcon44.seq - Constructed sequence entries, part 44.
532. gbcon45.seq - Constructed sequence entries, part 45.
533. gbcon46.seq - Constructed sequence entries, part 46.
534. gbcon47.seq - Constructed sequence entries, part 47.
535. gbcon48.seq - Constructed sequence entries, part 48.
536. gbcon49.seq - Constructed sequence entries, part 49.
537. gbcon5.seq - Constructed sequence entries, part 5.
538. gbcon50.seq - Constructed sequence entries, part 50.
539. gbcon51.seq - Constructed sequence entries, part 51.
540. gbcon52.seq - Constructed sequence entries, part 52.
541. gbcon53.seq - Constructed sequence entries, part 53.
542. gbcon54.seq - Constructed sequence entries, part 54.
543. gbcon55.seq - Constructed sequence entries, part 55.
544. gbcon56.seq - Constructed sequence entries, part 56.
545. gbcon57.seq - Constructed sequence entries, part 57.
546. gbcon58.seq - Constructed sequence entries, part 58.
547. gbcon59.seq - Constructed sequence entries, part 59.
548. gbcon6.seq - Constructed sequence entries, part 6.
549. gbcon60.seq - Constructed sequence entries, part 60.
550. gbcon61.seq - Constructed sequence entries, part 61.
551. gbcon62.seq - Constructed sequence entries, part 62.
552. gbcon63.seq - Constructed sequence entries, part 63.
553. gbcon64.seq - Constructed sequence entries, part 64.
554. gbcon65.seq - Constructed sequence entries, part 65.
555. gbcon66.seq - Constructed sequence entries, part 66.
556. gbcon67.seq - Constructed sequence entries, part 67.
557. gbcon68.seq - Constructed sequence entries, part 68.
558. gbcon69.seq - Constructed sequence entries, part 69.
559. gbcon7.seq - Constructed sequence entries, part 7.
560. gbcon70.seq - Constructed sequence entries, part 70.
561. gbcon71.seq - Constructed sequence entries, part 71.
562. gbcon72.seq - Constructed sequence entries, part 72.
563. gbcon73.seq - Constructed sequence entries, part 73.
564. gbcon74.seq - Constructed sequence entries, part 74.
565. gbcon75.seq - Constructed sequence entries, part 75.
566. gbcon76.seq - Constructed sequence entries, part 76.
567. gbcon77.seq - Constructed sequence entries, part 77.
568. gbcon78.seq - Constructed sequence entries, part 78.
569. gbcon79.seq - Constructed sequence entries, part 79.
570. gbcon8.seq - Constructed sequence entries, part 8.
571. gbcon80.seq - Constructed sequence entries, part 80.
572. gbcon81.seq - Constructed sequence entries, part 81.
573. gbcon82.seq - Constructed sequence entries, part 82.
574. gbcon83.seq - Constructed sequence entries, part 83.
575. gbcon84.seq - Constructed sequence entries, part 84.
576. gbcon85.seq - Constructed sequence entries, part 85.
577. gbcon86.seq - Constructed sequence entries, part 86.
578. gbcon87.seq - Constructed sequence entries, part 87.
579. gbcon88.seq - Constructed sequence entries, part 88.
580. gbcon89.seq - Constructed sequence entries, part 89.
581. gbcon9.seq - Constructed sequence entries, part 9.
582. gbcon90.seq - Constructed sequence entries, part 90.
583. gbcon91.seq - Constructed sequence entries, part 91.
584. gbcon92.seq - Constructed sequence entries, part 92.
585. gbcon93.seq - Constructed sequence entries, part 93.
586. gbcon94.seq - Constructed sequence entries, part 94.
587. gbcon95.seq - Constructed sequence entries, part 95.
588. gbcon96.seq - Constructed sequence entries, part 96.
589. gbcon97.seq - Constructed sequence entries, part 97.
590. gbcon98.seq - Constructed sequence entries, part 98.
591. gbcon99.seq - Constructed sequence entries, part 99.
592. gbdel.txt - Accession numbers of entries deleted since the previous release.
593. gbenv1.seq - Environmental sampling sequence entries, part 1.
594. gbenv10.seq - Environmental sampling sequence entries, part 10.
595. gbenv11.seq - Environmental sampling sequence entries, part 11.
596. gbenv12.seq - Environmental sampling sequence entries, part 12.
597. gbenv13.seq - Environmental sampling sequence entries, part 13.
598. gbenv14.seq - Environmental sampling sequence entries, part 14.
599. gbenv15.seq - Environmental sampling sequence entries, part 15.
600. gbenv16.seq - Environmental sampling sequence entries, part 16.
601. gbenv17.seq - Environmental sampling sequence entries, part 17.
602. gbenv18.seq - Environmental sampling sequence entries, part 18.
603. gbenv19.seq - Environmental sampling sequence entries, part 19.
604. gbenv2.seq - Environmental sampling sequence entries, part 2.
605. gbenv20.seq - Environmental sampling sequence entries, part 20.
606. gbenv21.seq - Environmental sampling sequence entries, part 21.
607. gbenv22.seq - Environmental sampling sequence entries, part 22.
608. gbenv23.seq - Environmental sampling sequence entries, part 23.
609. gbenv24.seq - Environmental sampling sequence entries, part 24.
610. gbenv25.seq - Environmental sampling sequence entries, part 25.
611. gbenv26.seq - Environmental sampling sequence entries, part 26.
612. gbenv27.seq - Environmental sampling sequence entries, part 27.
613. gbenv28.seq - Environmental sampling sequence entries, part 28.
614. gbenv29.seq - Environmental sampling sequence entries, part 29.
615. gbenv3.seq - Environmental sampling sequence entries, part 3.
616. gbenv30.seq - Environmental sampling sequence entries, part 30.
617. gbenv31.seq - Environmental sampling sequence entries, part 31.
618. gbenv32.seq - Environmental sampling sequence entries, part 32.
619. gbenv33.seq - Environmental sampling sequence entries, part 33.
620. gbenv34.seq - Environmental sampling sequence entries, part 34.
621. gbenv35.seq - Environmental sampling sequence entries, part 35.
622. gbenv36.seq - Environmental sampling sequence entries, part 36.
623. gbenv37.seq - Environmental sampling sequence entries, part 37.
624. gbenv38.seq - Environmental sampling sequence entries, part 38.
625. gbenv4.seq - Environmental sampling sequence entries, part 4.
626. gbenv5.seq - Environmental sampling sequence entries, part 5.
627. gbenv6.seq - Environmental sampling sequence entries, part 6.
628. gbenv7.seq - Environmental sampling sequence entries, part 7.
629. gbenv8.seq - Environmental sampling sequence entries, part 8.
630. gbenv9.seq - Environmental sampling sequence entries, part 9.
631. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
632. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
633. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
634. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
635. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
636. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
637. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
638. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
639. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
640. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
641. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
642. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
643. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
644. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
645. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
646. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
647. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
648. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
649. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
650. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
651. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
652. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
653. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
654. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
655. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
656. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
657. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
658. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
659. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
660. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
661. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
662. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
663. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
664. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
665. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
666. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
667. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
668. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
669. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
670. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
671. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
672. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
673. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
674. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
675. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
676. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
677. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
678. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
679. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
680. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
681. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
682. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
683. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
684. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
685. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
686. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
687. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
688. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
689. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
690. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
691. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
692. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
693. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
694. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
695. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
696. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
697. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
698. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
699. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
700. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
701. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
702. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
703. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
704. gbest165.seq - EST (expressed sequence tag) sequence entries, part 165.
705. gbest166.seq - EST (expressed sequence tag) sequence entries, part 166.
706. gbest167.seq - EST (expressed sequence tag) sequence entries, part 167.
707. gbest168.seq - EST (expressed sequence tag) sequence entries, part 168.
708. gbest169.seq - EST (expressed sequence tag) sequence entries, part 169.
709. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
710. gbest170.seq - EST (expressed sequence tag) sequence entries, part 170.
711. gbest171.seq - EST (expressed sequence tag) sequence entries, part 171.
712. gbest172.seq - EST (expressed sequence tag) sequence entries, part 172.
713. gbest173.seq - EST (expressed sequence tag) sequence entries, part 173.
714. gbest174.seq - EST (expressed sequence tag) sequence entries, part 174.
715. gbest175.seq - EST (expressed sequence tag) sequence entries, part 175.
716. gbest176.seq - EST (expressed sequence tag) sequence entries, part 176.
717. gbest177.seq - EST (expressed sequence tag) sequence entries, part 177.
718. gbest178.seq - EST (expressed sequence tag) sequence entries, part 178.
719. gbest179.seq - EST (expressed sequence tag) sequence entries, part 179.
720. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
721. gbest180.seq - EST (expressed sequence tag) sequence entries, part 180.
722. gbest181.seq - EST (expressed sequence tag) sequence entries, part 181.
723. gbest182.seq - EST (expressed sequence tag) sequence entries, part 182.
724. gbest183.seq - EST (expressed sequence tag) sequence entries, part 183.
725. gbest184.seq - EST (expressed sequence tag) sequence entries, part 184.
726. gbest185.seq - EST (expressed sequence tag) sequence entries, part 185.
727. gbest186.seq - EST (expressed sequence tag) sequence entries, part 186.
728. gbest187.seq - EST (expressed sequence tag) sequence entries, part 187.
729. gbest188.seq - EST (expressed sequence tag) sequence entries, part 188.
730. gbest189.seq - EST (expressed sequence tag) sequence entries, part 189.
731. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
732. gbest190.seq - EST (expressed sequence tag) sequence entries, part 190.
733. gbest191.seq - EST (expressed sequence tag) sequence entries, part 191.
734. gbest192.seq - EST (expressed sequence tag) sequence entries, part 192.
735. gbest193.seq - EST (expressed sequence tag) sequence entries, part 193.
736. gbest194.seq - EST (expressed sequence tag) sequence entries, part 194.
737. gbest195.seq - EST (expressed sequence tag) sequence entries, part 195.
738. gbest196.seq - EST (expressed sequence tag) sequence entries, part 196.
739. gbest197.seq - EST (expressed sequence tag) sequence entries, part 197.
740. gbest198.seq - EST (expressed sequence tag) sequence entries, part 198.
741. gbest199.seq - EST (expressed sequence tag) sequence entries, part 199.
742. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
743. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
744. gbest200.seq - EST (expressed sequence tag) sequence entries, part 200.
745. gbest201.seq - EST (expressed sequence tag) sequence entries, part 201.
746. gbest202.seq - EST (expressed sequence tag) sequence entries, part 202.
747. gbest203.seq - EST (expressed sequence tag) sequence entries, part 203.
748. gbest204.seq - EST (expressed sequence tag) sequence entries, part 204.
749. gbest205.seq - EST (expressed sequence tag) sequence entries, part 205.
750. gbest206.seq - EST (expressed sequence tag) sequence entries, part 206.
751. gbest207.seq - EST (expressed sequence tag) sequence entries, part 207.
752. gbest208.seq - EST (expressed sequence tag) sequence entries, part 208.
753. gbest209.seq - EST (expressed sequence tag) sequence entries, part 209.
754. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
755. gbest210.seq - EST (expressed sequence tag) sequence entries, part 210.
756. gbest211.seq - EST (expressed sequence tag) sequence entries, part 211.
757. gbest212.seq - EST (expressed sequence tag) sequence entries, part 212.
758. gbest213.seq - EST (expressed sequence tag) sequence entries, part 213.
759. gbest214.seq - EST (expressed sequence tag) sequence entries, part 214.
760. gbest215.seq - EST (expressed sequence tag) sequence entries, part 215.
761. gbest216.seq - EST (expressed sequence tag) sequence entries, part 216.
762. gbest217.seq - EST (expressed sequence tag) sequence entries, part 217.
763. gbest218.seq - EST (expressed sequence tag) sequence entries, part 218.
764. gbest219.seq - EST (expressed sequence tag) sequence entries, part 219.
765. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
766. gbest220.seq - EST (expressed sequence tag) sequence entries, part 220.
767. gbest221.seq - EST (expressed sequence tag) sequence entries, part 221.
768. gbest222.seq - EST (expressed sequence tag) sequence entries, part 222.
769. gbest223.seq - EST (expressed sequence tag) sequence entries, part 223.
770. gbest224.seq - EST (expressed sequence tag) sequence entries, part 224.
771. gbest225.seq - EST (expressed sequence tag) sequence entries, part 225.
772. gbest226.seq - EST (expressed sequence tag) sequence entries, part 226.
773. gbest227.seq - EST (expressed sequence tag) sequence entries, part 227.
774. gbest228.seq - EST (expressed sequence tag) sequence entries, part 228.
775. gbest229.seq - EST (expressed sequence tag) sequence entries, part 229.
776. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
777. gbest230.seq - EST (expressed sequence tag) sequence entries, part 230.
778. gbest231.seq - EST (expressed sequence tag) sequence entries, part 231.
779. gbest232.seq - EST (expressed sequence tag) sequence entries, part 232.
780. gbest233.seq - EST (expressed sequence tag) sequence entries, part 233.
781. gbest234.seq - EST (expressed sequence tag) sequence entries, part 234.
782. gbest235.seq - EST (expressed sequence tag) sequence entries, part 235.
783. gbest236.seq - EST (expressed sequence tag) sequence entries, part 236.
784. gbest237.seq - EST (expressed sequence tag) sequence entries, part 237.
785. gbest238.seq - EST (expressed sequence tag) sequence entries, part 238.
786. gbest239.seq - EST (expressed sequence tag) sequence entries, part 239.
787. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
788. gbest240.seq - EST (expressed sequence tag) sequence entries, part 240.
789. gbest241.seq - EST (expressed sequence tag) sequence entries, part 241.
790. gbest242.seq - EST (expressed sequence tag) sequence entries, part 242.
791. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
792. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
793. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
794. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
795. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
796. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
797. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
798. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
799. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
800. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
801. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
802. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
803. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
804. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
805. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
806. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
807. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
808. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
809. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
810. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
811. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
812. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
813. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
814. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
815. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
816. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
817. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
818. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
819. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
820. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
821. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
822. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
823. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
824. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
825. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
826. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
827. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
828. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
829. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
830. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
831. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
832. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
833. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
834. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
835. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
836. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
837. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
838. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
839. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
840. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
841. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
842. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
843. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
844. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
845. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
846. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
847. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
848. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
849. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
850. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
851. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
852. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
853. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
854. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
855. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
856. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
857. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
858. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
859. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
860. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
861. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
862. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
863. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
864. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
865. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
866. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
867. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
868. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
869. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
870. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
871. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
872. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
873. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
874. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
875. gbgss100.seq - GSS (genome survey sequence) sequence entries, part 100.
876. gbgss101.seq - GSS (genome survey sequence) sequence entries, part 101.
877. gbgss102.seq - GSS (genome survey sequence) sequence entries, part 102.
878. gbgss103.seq - GSS (genome survey sequence) sequence entries, part 103.
879. gbgss104.seq - GSS (genome survey sequence) sequence entries, part 104.
880. gbgss105.seq - GSS (genome survey sequence) sequence entries, part 105.
881. gbgss106.seq - GSS (genome survey sequence) sequence entries, part 106.
882. gbgss107.seq - GSS (genome survey sequence) sequence entries, part 107.
883. gbgss108.seq - GSS (genome survey sequence) sequence entries, part 108.
884. gbgss109.seq - GSS (genome survey sequence) sequence entries, part 109.
885. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
886. gbgss110.seq - GSS (genome survey sequence) sequence entries, part 110.
887. gbgss111.seq - GSS (genome survey sequence) sequence entries, part 111.
888. gbgss112.seq - GSS (genome survey sequence) sequence entries, part 112.
889. gbgss113.seq - GSS (genome survey sequence) sequence entries, part 113.
890. gbgss114.seq - GSS (genome survey sequence) sequence entries, part 114.
891. gbgss115.seq - GSS (genome survey sequence) sequence entries, part 115.
892. gbgss116.seq - GSS (genome survey sequence) sequence entries, part 116.
893. gbgss117.seq - GSS (genome survey sequence) sequence entries, part 117.
894. gbgss118.seq - GSS (genome survey sequence) sequence entries, part 118.
895. gbgss119.seq - GSS (genome survey sequence) sequence entries, part 119.
896. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
897. gbgss120.seq - GSS (genome survey sequence) sequence entries, part 120.
898. gbgss121.seq - GSS (genome survey sequence) sequence entries, part 121.
899. gbgss122.seq - GSS (genome survey sequence) sequence entries, part 122.
900. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
901. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
902. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
903. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
904. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
905. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
906. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
907. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
908. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
909. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
910. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
911. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
912. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
913. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
914. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
915. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
916. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
917. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
918. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
919. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
920. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
921. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
922. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
923. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
924. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
925. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
926. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
927. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
928. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
929. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
930. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
931. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
932. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
933. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
934. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
935. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
936. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
937. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
938. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
939. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
940. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
941. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
942. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
943. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
944. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
945. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
946. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
947. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
948. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
949. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
950. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
951. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
952. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
953. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
954. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
955. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
956. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
957. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
958. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
959. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
960. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
961. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
962. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
963. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
964. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
965. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
966. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
967. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
968. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
969. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
970. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
971. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
972. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
973. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
974. gbgss80.seq - GSS (genome survey sequence) sequence entries, part 80.
975. gbgss81.seq - GSS (genome survey sequence) sequence entries, part 81.
976. gbgss82.seq - GSS (genome survey sequence) sequence entries, part 82.
977. gbgss83.seq - GSS (genome survey sequence) sequence entries, part 83.
978. gbgss84.seq - GSS (genome survey sequence) sequence entries, part 84.
979. gbgss85.seq - GSS (genome survey sequence) sequence entries, part 85.
980. gbgss86.seq - GSS (genome survey sequence) sequence entries, part 86.
981. gbgss87.seq - GSS (genome survey sequence) sequence entries, part 87.
982. gbgss88.seq - GSS (genome survey sequence) sequence entries, part 88.
983. gbgss89.seq - GSS (genome survey sequence) sequence entries, part 89.
984. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
985. gbgss90.seq - GSS (genome survey sequence) sequence entries, part 90.
986. gbgss91.seq - GSS (genome survey sequence) sequence entries, part 91.
987. gbgss92.seq - GSS (genome survey sequence) sequence entries, part 92.
988. gbgss93.seq - GSS (genome survey sequence) sequence entries, part 93.
989. gbgss94.seq - GSS (genome survey sequence) sequence entries, part 94.
990. gbgss95.seq - GSS (genome survey sequence) sequence entries, part 95.
991. gbgss96.seq - GSS (genome survey sequence) sequence entries, part 96.
992. gbgss97.seq - GSS (genome survey sequence) sequence entries, part 97.
993. gbgss98.seq - GSS (genome survey sequence) sequence entries, part 98.
994. gbgss99.seq - GSS (genome survey sequence) sequence entries, part 99.
995. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
996. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
997. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
998. gbhtc4.seq - HTC (high throughput cDNA sequencing) sequence entries, part 4.
999. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
1000. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
1001. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
1002. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
1003. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
1004. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
1005. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
1006. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
1007. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
1008. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
1009. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
1010. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
1011. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
1012. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
1013. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
1014. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
1015. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
1016. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
1017. gbhtg26.seq - HTGS (high throughput genomic sequencing) sequence entries, part 26.
1018. gbhtg27.seq - HTGS (high throughput genomic sequencing) sequence entries, part 27.
1019. gbhtg28.seq - HTGS (high throughput genomic sequencing) sequence entries, part 28.
1020. gbhtg29.seq - HTGS (high throughput genomic sequencing) sequence entries, part 29.
1021. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
1022. gbhtg30.seq - HTGS (high throughput genomic sequencing) sequence entries, part 30.
1023. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
1024. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
1025. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
1026. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
1027. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
1028. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
1029. gbinv1.seq - Invertebrate sequence entries, part 1.
1030. gbinv10.seq - Invertebrate sequence entries, part 10.
1031. gbinv100.seq - Invertebrate sequence entries, part 100.
1032. gbinv1000.seq - Invertebrate sequence entries, part 1000.
1033. gbinv1001.seq - Invertebrate sequence entries, part 1001.
1034. gbinv1002.seq - Invertebrate sequence entries, part 1002.
1035. gbinv1003.seq - Invertebrate sequence entries, part 1003.
1036. gbinv1004.seq - Invertebrate sequence entries, part 1004.
1037. gbinv1005.seq - Invertebrate sequence entries, part 1005.
1038. gbinv1006.seq - Invertebrate sequence entries, part 1006.
1039. gbinv1007.seq - Invertebrate sequence entries, part 1007.
1040. gbinv1008.seq - Invertebrate sequence entries, part 1008.
1041. gbinv1009.seq - Invertebrate sequence entries, part 1009.
1042. gbinv101.seq - Invertebrate sequence entries, part 101.
1043. gbinv1010.seq - Invertebrate sequence entries, part 1010.
1044. gbinv1011.seq - Invertebrate sequence entries, part 1011.
1045. gbinv1012.seq - Invertebrate sequence entries, part 1012.
1046. gbinv1013.seq - Invertebrate sequence entries, part 1013.
1047. gbinv1014.seq - Invertebrate sequence entries, part 1014.
1048. gbinv1015.seq - Invertebrate sequence entries, part 1015.
1049. gbinv1016.seq - Invertebrate sequence entries, part 1016.
1050. gbinv1017.seq - Invertebrate sequence entries, part 1017.
1051. gbinv1018.seq - Invertebrate sequence entries, part 1018.
1052. gbinv1019.seq - Invertebrate sequence entries, part 1019.
1053. gbinv102.seq - Invertebrate sequence entries, part 102.
1054. gbinv1020.seq - Invertebrate sequence entries, part 1020.
1055. gbinv1021.seq - Invertebrate sequence entries, part 1021.
1056. gbinv1022.seq - Invertebrate sequence entries, part 1022.
1057. gbinv1023.seq - Invertebrate sequence entries, part 1023.
1058. gbinv1024.seq - Invertebrate sequence entries, part 1024.
1059. gbinv1025.seq - Invertebrate sequence entries, part 1025.
1060. gbinv1026.seq - Invertebrate sequence entries, part 1026.
1061. gbinv1027.seq - Invertebrate sequence entries, part 1027.
1062. gbinv1028.seq - Invertebrate sequence entries, part 1028.
1063. gbinv1029.seq - Invertebrate sequence entries, part 1029.
1064. gbinv103.seq - Invertebrate sequence entries, part 103.
1065. gbinv1030.seq - Invertebrate sequence entries, part 1030.
1066. gbinv1031.seq - Invertebrate sequence entries, part 1031.
1067. gbinv1032.seq - Invertebrate sequence entries, part 1032.
1068. gbinv1033.seq - Invertebrate sequence entries, part 1033.
1069. gbinv1034.seq - Invertebrate sequence entries, part 1034.
1070. gbinv1035.seq - Invertebrate sequence entries, part 1035.
1071. gbinv1036.seq - Invertebrate sequence entries, part 1036.
1072. gbinv1037.seq - Invertebrate sequence entries, part 1037.
1073. gbinv1038.seq - Invertebrate sequence entries, part 1038.
1074. gbinv1039.seq - Invertebrate sequence entries, part 1039.
1075. gbinv104.seq - Invertebrate sequence entries, part 104.
1076. gbinv1040.seq - Invertebrate sequence entries, part 1040.
1077. gbinv1041.seq - Invertebrate sequence entries, part 1041.
1078. gbinv1042.seq - Invertebrate sequence entries, part 1042.
1079. gbinv1043.seq - Invertebrate sequence entries, part 1043.
1080. gbinv1044.seq - Invertebrate sequence entries, part 1044.
1081. gbinv1045.seq - Invertebrate sequence entries, part 1045.
1082. gbinv1046.seq - Invertebrate sequence entries, part 1046.
1083. gbinv1047.seq - Invertebrate sequence entries, part 1047.
1084. gbinv1048.seq - Invertebrate sequence entries, part 1048.
1085. gbinv1049.seq - Invertebrate sequence entries, part 1049.
1086. gbinv105.seq - Invertebrate sequence entries, part 105.
1087. gbinv1050.seq - Invertebrate sequence entries, part 1050.
1088. gbinv1051.seq - Invertebrate sequence entries, part 1051.
1089. gbinv1052.seq - Invertebrate sequence entries, part 1052.
1090. gbinv1053.seq - Invertebrate sequence entries, part 1053.
1091. gbinv1054.seq - Invertebrate sequence entries, part 1054.
1092. gbinv1055.seq - Invertebrate sequence entries, part 1055.
1093. gbinv1056.seq - Invertebrate sequence entries, part 1056.
1094. gbinv1057.seq - Invertebrate sequence entries, part 1057.
1095. gbinv1058.seq - Invertebrate sequence entries, part 1058.
1096. gbinv1059.seq - Invertebrate sequence entries, part 1059.
1097. gbinv106.seq - Invertebrate sequence entries, part 106.
1098. gbinv1060.seq - Invertebrate sequence entries, part 1060.
1099. gbinv1061.seq - Invertebrate sequence entries, part 1061.
1100. gbinv1062.seq - Invertebrate sequence entries, part 1062.
1101. gbinv1063.seq - Invertebrate sequence entries, part 1063.
1102. gbinv1064.seq - Invertebrate sequence entries, part 1064.
1103. gbinv1065.seq - Invertebrate sequence entries, part 1065.
1104. gbinv1066.seq - Invertebrate sequence entries, part 1066.
1105. gbinv1067.seq - Invertebrate sequence entries, part 1067.
1106. gbinv1068.seq - Invertebrate sequence entries, part 1068.
1107. gbinv1069.seq - Invertebrate sequence entries, part 1069.
1108. gbinv107.seq - Invertebrate sequence entries, part 107.
1109. gbinv1070.seq - Invertebrate sequence entries, part 1070.
1110. gbinv1071.seq - Invertebrate sequence entries, part 1071.
1111. gbinv1072.seq - Invertebrate sequence entries, part 1072.
1112. gbinv1073.seq - Invertebrate sequence entries, part 1073.
1113. gbinv1074.seq - Invertebrate sequence entries, part 1074.
1114. gbinv1075.seq - Invertebrate sequence entries, part 1075.
1115. gbinv1076.seq - Invertebrate sequence entries, part 1076.
1116. gbinv1077.seq - Invertebrate sequence entries, part 1077.
1117. gbinv108.seq - Invertebrate sequence entries, part 108.
1118. gbinv109.seq - Invertebrate sequence entries, part 109.
1119. gbinv11.seq - Invertebrate sequence entries, part 11.
1120. gbinv110.seq - Invertebrate sequence entries, part 110.
1121. gbinv111.seq - Invertebrate sequence entries, part 111.
1122. gbinv112.seq - Invertebrate sequence entries, part 112.
1123. gbinv113.seq - Invertebrate sequence entries, part 113.
1124. gbinv114.seq - Invertebrate sequence entries, part 114.
1125. gbinv115.seq - Invertebrate sequence entries, part 115.
1126. gbinv116.seq - Invertebrate sequence entries, part 116.
1127. gbinv117.seq - Invertebrate sequence entries, part 117.
1128. gbinv118.seq - Invertebrate sequence entries, part 118.
1129. gbinv119.seq - Invertebrate sequence entries, part 119.
1130. gbinv12.seq - Invertebrate sequence entries, part 12.
1131. gbinv120.seq - Invertebrate sequence entries, part 120.
1132. gbinv121.seq - Invertebrate sequence entries, part 121.
1133. gbinv122.seq - Invertebrate sequence entries, part 122.
1134. gbinv123.seq - Invertebrate sequence entries, part 123.
1135. gbinv124.seq - Invertebrate sequence entries, part 124.
1136. gbinv125.seq - Invertebrate sequence entries, part 125.
1137. gbinv126.seq - Invertebrate sequence entries, part 126.
1138. gbinv127.seq - Invertebrate sequence entries, part 127.
1139. gbinv128.seq - Invertebrate sequence entries, part 128.
1140. gbinv129.seq - Invertebrate sequence entries, part 129.
1141. gbinv13.seq - Invertebrate sequence entries, part 13.
1142. gbinv130.seq - Invertebrate sequence entries, part 130.
1143. gbinv131.seq - Invertebrate sequence entries, part 131.
1144. gbinv132.seq - Invertebrate sequence entries, part 132.
1145. gbinv133.seq - Invertebrate sequence entries, part 133.
1146. gbinv134.seq - Invertebrate sequence entries, part 134.
1147. gbinv135.seq - Invertebrate sequence entries, part 135.
1148. gbinv136.seq - Invertebrate sequence entries, part 136.
1149. gbinv137.seq - Invertebrate sequence entries, part 137.
1150. gbinv138.seq - Invertebrate sequence entries, part 138.
1151. gbinv139.seq - Invertebrate sequence entries, part 139.
1152. gbinv14.seq - Invertebrate sequence entries, part 14.
1153. gbinv140.seq - Invertebrate sequence entries, part 140.
1154. gbinv141.seq - Invertebrate sequence entries, part 141.
1155. gbinv142.seq - Invertebrate sequence entries, part 142.
1156. gbinv143.seq - Invertebrate sequence entries, part 143.
1157. gbinv144.seq - Invertebrate sequence entries, part 144.
1158. gbinv145.seq - Invertebrate sequence entries, part 145.
1159. gbinv146.seq - Invertebrate sequence entries, part 146.
1160. gbinv147.seq - Invertebrate sequence entries, part 147.
1161. gbinv148.seq - Invertebrate sequence entries, part 148.
1162. gbinv149.seq - Invertebrate sequence entries, part 149.
1163. gbinv15.seq - Invertebrate sequence entries, part 15.
1164. gbinv150.seq - Invertebrate sequence entries, part 150.
1165. gbinv151.seq - Invertebrate sequence entries, part 151.
1166. gbinv152.seq - Invertebrate sequence entries, part 152.
1167. gbinv153.seq - Invertebrate sequence entries, part 153.
1168. gbinv154.seq - Invertebrate sequence entries, part 154.
1169. gbinv155.seq - Invertebrate sequence entries, part 155.
1170. gbinv156.seq - Invertebrate sequence entries, part 156.
1171. gbinv157.seq - Invertebrate sequence entries, part 157.
1172. gbinv158.seq - Invertebrate sequence entries, part 158.
1173. gbinv159.seq - Invertebrate sequence entries, part 159.
1174. gbinv16.seq - Invertebrate sequence entries, part 16.
1175. gbinv160.seq - Invertebrate sequence entries, part 160.
1176. gbinv161.seq - Invertebrate sequence entries, part 161.
1177. gbinv162.seq - Invertebrate sequence entries, part 162.
1178. gbinv163.seq - Invertebrate sequence entries, part 163.
1179. gbinv164.seq - Invertebrate sequence entries, part 164.
1180. gbinv165.seq - Invertebrate sequence entries, part 165.
1181. gbinv166.seq - Invertebrate sequence entries, part 166.
1182. gbinv167.seq - Invertebrate sequence entries, part 167.
1183. gbinv168.seq - Invertebrate sequence entries, part 168.
1184. gbinv169.seq - Invertebrate sequence entries, part 169.
1185. gbinv17.seq - Invertebrate sequence entries, part 17.
1186. gbinv170.seq - Invertebrate sequence entries, part 170.
1187. gbinv171.seq - Invertebrate sequence entries, part 171.
1188. gbinv172.seq - Invertebrate sequence entries, part 172.
1189. gbinv173.seq - Invertebrate sequence entries, part 173.
1190. gbinv174.seq - Invertebrate sequence entries, part 174.
1191. gbinv175.seq - Invertebrate sequence entries, part 175.
1192. gbinv176.seq - Invertebrate sequence entries, part 176.
1193. gbinv177.seq - Invertebrate sequence entries, part 177.
1194. gbinv178.seq - Invertebrate sequence entries, part 178.
1195. gbinv179.seq - Invertebrate sequence entries, part 179.
1196. gbinv18.seq - Invertebrate sequence entries, part 18.
1197. gbinv180.seq - Invertebrate sequence entries, part 180.
1198. gbinv181.seq - Invertebrate sequence entries, part 181.
1199. gbinv182.seq - Invertebrate sequence entries, part 182.
1200. gbinv183.seq - Invertebrate sequence entries, part 183.
1201. gbinv184.seq - Invertebrate sequence entries, part 184.
1202. gbinv185.seq - Invertebrate sequence entries, part 185.
1203. gbinv186.seq - Invertebrate sequence entries, part 186.
1204. gbinv187.seq - Invertebrate sequence entries, part 187.
1205. gbinv188.seq - Invertebrate sequence entries, part 188.
1206. gbinv189.seq - Invertebrate sequence entries, part 189.
1207. gbinv19.seq - Invertebrate sequence entries, part 19.
1208. gbinv190.seq - Invertebrate sequence entries, part 190.
1209. gbinv191.seq - Invertebrate sequence entries, part 191.
1210. gbinv192.seq - Invertebrate sequence entries, part 192.
1211. gbinv193.seq - Invertebrate sequence entries, part 193.
1212. gbinv194.seq - Invertebrate sequence entries, part 194.
1213. gbinv195.seq - Invertebrate sequence entries, part 195.
1214. gbinv196.seq - Invertebrate sequence entries, part 196.
1215. gbinv197.seq - Invertebrate sequence entries, part 197.
1216. gbinv198.seq - Invertebrate sequence entries, part 198.
1217. gbinv199.seq - Invertebrate sequence entries, part 199.
1218. gbinv2.seq - Invertebrate sequence entries, part 2.
1219. gbinv20.seq - Invertebrate sequence entries, part 20.
1220. gbinv200.seq - Invertebrate sequence entries, part 200.
1221. gbinv201.seq - Invertebrate sequence entries, part 201.
1222. gbinv202.seq - Invertebrate sequence entries, part 202.
1223. gbinv203.seq - Invertebrate sequence entries, part 203.
1224. gbinv204.seq - Invertebrate sequence entries, part 204.
1225. gbinv205.seq - Invertebrate sequence entries, part 205.
1226. gbinv206.seq - Invertebrate sequence entries, part 206.
1227. gbinv207.seq - Invertebrate sequence entries, part 207.
1228. gbinv208.seq - Invertebrate sequence entries, part 208.
1229. gbinv209.seq - Invertebrate sequence entries, part 209.
1230. gbinv21.seq - Invertebrate sequence entries, part 21.
1231. gbinv210.seq - Invertebrate sequence entries, part 210.
1232. gbinv211.seq - Invertebrate sequence entries, part 211.
1233. gbinv212.seq - Invertebrate sequence entries, part 212.
1234. gbinv213.seq - Invertebrate sequence entries, part 213.
1235. gbinv214.seq - Invertebrate sequence entries, part 214.
1236. gbinv215.seq - Invertebrate sequence entries, part 215.
1237. gbinv216.seq - Invertebrate sequence entries, part 216.
1238. gbinv217.seq - Invertebrate sequence entries, part 217.
1239. gbinv218.seq - Invertebrate sequence entries, part 218.
1240. gbinv219.seq - Invertebrate sequence entries, part 219.
1241. gbinv22.seq - Invertebrate sequence entries, part 22.
1242. gbinv220.seq - Invertebrate sequence entries, part 220.
1243. gbinv221.seq - Invertebrate sequence entries, part 221.
1244. gbinv222.seq - Invertebrate sequence entries, part 222.
1245. gbinv223.seq - Invertebrate sequence entries, part 223.
1246. gbinv224.seq - Invertebrate sequence entries, part 224.
1247. gbinv225.seq - Invertebrate sequence entries, part 225.
1248. gbinv226.seq - Invertebrate sequence entries, part 226.
1249. gbinv227.seq - Invertebrate sequence entries, part 227.
1250. gbinv228.seq - Invertebrate sequence entries, part 228.
1251. gbinv229.seq - Invertebrate sequence entries, part 229.
1252. gbinv23.seq - Invertebrate sequence entries, part 23.
1253. gbinv230.seq - Invertebrate sequence entries, part 230.
1254. gbinv231.seq - Invertebrate sequence entries, part 231.
1255. gbinv232.seq - Invertebrate sequence entries, part 232.
1256. gbinv233.seq - Invertebrate sequence entries, part 233.
1257. gbinv234.seq - Invertebrate sequence entries, part 234.
1258. gbinv235.seq - Invertebrate sequence entries, part 235.
1259. gbinv236.seq - Invertebrate sequence entries, part 236.
1260. gbinv237.seq - Invertebrate sequence entries, part 237.
1261. gbinv238.seq - Invertebrate sequence entries, part 238.
1262. gbinv239.seq - Invertebrate sequence entries, part 239.
1263. gbinv24.seq - Invertebrate sequence entries, part 24.
1264. gbinv240.seq - Invertebrate sequence entries, part 240.
1265. gbinv241.seq - Invertebrate sequence entries, part 241.
1266. gbinv242.seq - Invertebrate sequence entries, part 242.
1267. gbinv243.seq - Invertebrate sequence entries, part 243.
1268. gbinv244.seq - Invertebrate sequence entries, part 244.
1269. gbinv245.seq - Invertebrate sequence entries, part 245.
1270. gbinv246.seq - Invertebrate sequence entries, part 246.
1271. gbinv247.seq - Invertebrate sequence entries, part 247.
1272. gbinv248.seq - Invertebrate sequence entries, part 248.
1273. gbinv249.seq - Invertebrate sequence entries, part 249.
1274. gbinv25.seq - Invertebrate sequence entries, part 25.
1275. gbinv250.seq - Invertebrate sequence entries, part 250.
1276. gbinv251.seq - Invertebrate sequence entries, part 251.
1277. gbinv252.seq - Invertebrate sequence entries, part 252.
1278. gbinv253.seq - Invertebrate sequence entries, part 253.
1279. gbinv254.seq - Invertebrate sequence entries, part 254.
1280. gbinv255.seq - Invertebrate sequence entries, part 255.
1281. gbinv256.seq - Invertebrate sequence entries, part 256.
1282. gbinv257.seq - Invertebrate sequence entries, part 257.
1283. gbinv258.seq - Invertebrate sequence entries, part 258.
1284. gbinv259.seq - Invertebrate sequence entries, part 259.
1285. gbinv26.seq - Invertebrate sequence entries, part 26.
1286. gbinv260.seq - Invertebrate sequence entries, part 260.
1287. gbinv261.seq - Invertebrate sequence entries, part 261.
1288. gbinv262.seq - Invertebrate sequence entries, part 262.
1289. gbinv263.seq - Invertebrate sequence entries, part 263.
1290. gbinv264.seq - Invertebrate sequence entries, part 264.
1291. gbinv265.seq - Invertebrate sequence entries, part 265.
1292. gbinv266.seq - Invertebrate sequence entries, part 266.
1293. gbinv267.seq - Invertebrate sequence entries, part 267.
1294. gbinv268.seq - Invertebrate sequence entries, part 268.
1295. gbinv269.seq - Invertebrate sequence entries, part 269.
1296. gbinv27.seq - Invertebrate sequence entries, part 27.
1297. gbinv270.seq - Invertebrate sequence entries, part 270.
1298. gbinv271.seq - Invertebrate sequence entries, part 271.
1299. gbinv272.seq - Invertebrate sequence entries, part 272.
1300. gbinv273.seq - Invertebrate sequence entries, part 273.
1301. gbinv274.seq - Invertebrate sequence entries, part 274.
1302. gbinv275.seq - Invertebrate sequence entries, part 275.
1303. gbinv276.seq - Invertebrate sequence entries, part 276.
1304. gbinv277.seq - Invertebrate sequence entries, part 277.
1305. gbinv278.seq - Invertebrate sequence entries, part 278.
1306. gbinv279.seq - Invertebrate sequence entries, part 279.
1307. gbinv28.seq - Invertebrate sequence entries, part 28.
1308. gbinv280.seq - Invertebrate sequence entries, part 280.
1309. gbinv281.seq - Invertebrate sequence entries, part 281.
1310. gbinv282.seq - Invertebrate sequence entries, part 282.
1311. gbinv283.seq - Invertebrate sequence entries, part 283.
1312. gbinv284.seq - Invertebrate sequence entries, part 284.
1313. gbinv285.seq - Invertebrate sequence entries, part 285.
1314. gbinv286.seq - Invertebrate sequence entries, part 286.
1315. gbinv287.seq - Invertebrate sequence entries, part 287.
1316. gbinv288.seq - Invertebrate sequence entries, part 288.
1317. gbinv289.seq - Invertebrate sequence entries, part 289.
1318. gbinv29.seq - Invertebrate sequence entries, part 29.
1319. gbinv290.seq - Invertebrate sequence entries, part 290.
1320. gbinv291.seq - Invertebrate sequence entries, part 291.
1321. gbinv292.seq - Invertebrate sequence entries, part 292.
1322. gbinv293.seq - Invertebrate sequence entries, part 293.
1323. gbinv294.seq - Invertebrate sequence entries, part 294.
1324. gbinv295.seq - Invertebrate sequence entries, part 295.
1325. gbinv296.seq - Invertebrate sequence entries, part 296.
1326. gbinv297.seq - Invertebrate sequence entries, part 297.
1327. gbinv298.seq - Invertebrate sequence entries, part 298.
1328. gbinv299.seq - Invertebrate sequence entries, part 299.
1329. gbinv3.seq - Invertebrate sequence entries, part 3.
1330. gbinv30.seq - Invertebrate sequence entries, part 30.
1331. gbinv300.seq - Invertebrate sequence entries, part 300.
1332. gbinv301.seq - Invertebrate sequence entries, part 301.
1333. gbinv302.seq - Invertebrate sequence entries, part 302.
1334. gbinv303.seq - Invertebrate sequence entries, part 303.
1335. gbinv304.seq - Invertebrate sequence entries, part 304.
1336. gbinv305.seq - Invertebrate sequence entries, part 305.
1337. gbinv306.seq - Invertebrate sequence entries, part 306.
1338. gbinv307.seq - Invertebrate sequence entries, part 307.
1339. gbinv308.seq - Invertebrate sequence entries, part 308.
1340. gbinv309.seq - Invertebrate sequence entries, part 309.
1341. gbinv31.seq - Invertebrate sequence entries, part 31.
1342. gbinv310.seq - Invertebrate sequence entries, part 310.
1343. gbinv311.seq - Invertebrate sequence entries, part 311.
1344. gbinv312.seq - Invertebrate sequence entries, part 312.
1345. gbinv313.seq - Invertebrate sequence entries, part 313.
1346. gbinv314.seq - Invertebrate sequence entries, part 314.
1347. gbinv315.seq - Invertebrate sequence entries, part 315.
1348. gbinv316.seq - Invertebrate sequence entries, part 316.
1349. gbinv317.seq - Invertebrate sequence entries, part 317.
1350. gbinv318.seq - Invertebrate sequence entries, part 318.
1351. gbinv319.seq - Invertebrate sequence entries, part 319.
1352. gbinv32.seq - Invertebrate sequence entries, part 32.
1353. gbinv320.seq - Invertebrate sequence entries, part 320.
1354. gbinv321.seq - Invertebrate sequence entries, part 321.
1355. gbinv322.seq - Invertebrate sequence entries, part 322.
1356. gbinv323.seq - Invertebrate sequence entries, part 323.
1357. gbinv324.seq - Invertebrate sequence entries, part 324.
1358. gbinv325.seq - Invertebrate sequence entries, part 325.
1359. gbinv326.seq - Invertebrate sequence entries, part 326.
1360. gbinv327.seq - Invertebrate sequence entries, part 327.
1361. gbinv328.seq - Invertebrate sequence entries, part 328.
1362. gbinv329.seq - Invertebrate sequence entries, part 329.
1363. gbinv33.seq - Invertebrate sequence entries, part 33.
1364. gbinv330.seq - Invertebrate sequence entries, part 330.
1365. gbinv331.seq - Invertebrate sequence entries, part 331.
1366. gbinv332.seq - Invertebrate sequence entries, part 332.
1367. gbinv333.seq - Invertebrate sequence entries, part 333.
1368. gbinv334.seq - Invertebrate sequence entries, part 334.
1369. gbinv335.seq - Invertebrate sequence entries, part 335.
1370. gbinv336.seq - Invertebrate sequence entries, part 336.
1371. gbinv337.seq - Invertebrate sequence entries, part 337.
1372. gbinv338.seq - Invertebrate sequence entries, part 338.
1373. gbinv339.seq - Invertebrate sequence entries, part 339.
1374. gbinv34.seq - Invertebrate sequence entries, part 34.
1375. gbinv340.seq - Invertebrate sequence entries, part 340.
1376. gbinv341.seq - Invertebrate sequence entries, part 341.
1377. gbinv342.seq - Invertebrate sequence entries, part 342.
1378. gbinv343.seq - Invertebrate sequence entries, part 343.
1379. gbinv344.seq - Invertebrate sequence entries, part 344.
1380. gbinv345.seq - Invertebrate sequence entries, part 345.
1381. gbinv346.seq - Invertebrate sequence entries, part 346.
1382. gbinv347.seq - Invertebrate sequence entries, part 347.
1383. gbinv348.seq - Invertebrate sequence entries, part 348.
1384. gbinv349.seq - Invertebrate sequence entries, part 349.
1385. gbinv35.seq - Invertebrate sequence entries, part 35.
1386. gbinv350.seq - Invertebrate sequence entries, part 350.
1387. gbinv351.seq - Invertebrate sequence entries, part 351.
1388. gbinv352.seq - Invertebrate sequence entries, part 352.
1389. gbinv353.seq - Invertebrate sequence entries, part 353.
1390. gbinv354.seq - Invertebrate sequence entries, part 354.
1391. gbinv355.seq - Invertebrate sequence entries, part 355.
1392. gbinv356.seq - Invertebrate sequence entries, part 356.
1393. gbinv357.seq - Invertebrate sequence entries, part 357.
1394. gbinv358.seq - Invertebrate sequence entries, part 358.
1395. gbinv359.seq - Invertebrate sequence entries, part 359.
1396. gbinv36.seq - Invertebrate sequence entries, part 36.
1397. gbinv360.seq - Invertebrate sequence entries, part 360.
1398. gbinv361.seq - Invertebrate sequence entries, part 361.
1399. gbinv362.seq - Invertebrate sequence entries, part 362.
1400. gbinv363.seq - Invertebrate sequence entries, part 363.
1401. gbinv364.seq - Invertebrate sequence entries, part 364.
1402. gbinv365.seq - Invertebrate sequence entries, part 365.
1403. gbinv366.seq - Invertebrate sequence entries, part 366.
1404. gbinv367.seq - Invertebrate sequence entries, part 367.
1405. gbinv368.seq - Invertebrate sequence entries, part 368.
1406. gbinv369.seq - Invertebrate sequence entries, part 369.
1407. gbinv37.seq - Invertebrate sequence entries, part 37.
1408. gbinv370.seq - Invertebrate sequence entries, part 370.
1409. gbinv371.seq - Invertebrate sequence entries, part 371.
1410. gbinv372.seq - Invertebrate sequence entries, part 372.
1411. gbinv373.seq - Invertebrate sequence entries, part 373.
1412. gbinv374.seq - Invertebrate sequence entries, part 374.
1413. gbinv375.seq - Invertebrate sequence entries, part 375.
1414. gbinv376.seq - Invertebrate sequence entries, part 376.
1415. gbinv377.seq - Invertebrate sequence entries, part 377.
1416. gbinv378.seq - Invertebrate sequence entries, part 378.
1417. gbinv379.seq - Invertebrate sequence entries, part 379.
1418. gbinv38.seq - Invertebrate sequence entries, part 38.
1419. gbinv380.seq - Invertebrate sequence entries, part 380.
1420. gbinv381.seq - Invertebrate sequence entries, part 381.
1421. gbinv382.seq - Invertebrate sequence entries, part 382.
1422. gbinv383.seq - Invertebrate sequence entries, part 383.
1423. gbinv384.seq - Invertebrate sequence entries, part 384.
1424. gbinv385.seq - Invertebrate sequence entries, part 385.
1425. gbinv386.seq - Invertebrate sequence entries, part 386.
1426. gbinv387.seq - Invertebrate sequence entries, part 387.
1427. gbinv388.seq - Invertebrate sequence entries, part 388.
1428. gbinv389.seq - Invertebrate sequence entries, part 389.
1429. gbinv39.seq - Invertebrate sequence entries, part 39.
1430. gbinv390.seq - Invertebrate sequence entries, part 390.
1431. gbinv391.seq - Invertebrate sequence entries, part 391.
1432. gbinv392.seq - Invertebrate sequence entries, part 392.
1433. gbinv393.seq - Invertebrate sequence entries, part 393.
1434. gbinv394.seq - Invertebrate sequence entries, part 394.
1435. gbinv395.seq - Invertebrate sequence entries, part 395.
1436. gbinv396.seq - Invertebrate sequence entries, part 396.
1437. gbinv397.seq - Invertebrate sequence entries, part 397.
1438. gbinv398.seq - Invertebrate sequence entries, part 398.
1439. gbinv399.seq - Invertebrate sequence entries, part 399.
1440. gbinv4.seq - Invertebrate sequence entries, part 4.
1441. gbinv40.seq - Invertebrate sequence entries, part 40.
1442. gbinv400.seq - Invertebrate sequence entries, part 400.
1443. gbinv401.seq - Invertebrate sequence entries, part 401.
1444. gbinv402.seq - Invertebrate sequence entries, part 402.
1445. gbinv403.seq - Invertebrate sequence entries, part 403.
1446. gbinv404.seq - Invertebrate sequence entries, part 404.
1447. gbinv405.seq - Invertebrate sequence entries, part 405.
1448. gbinv406.seq - Invertebrate sequence entries, part 406.
1449. gbinv407.seq - Invertebrate sequence entries, part 407.
1450. gbinv408.seq - Invertebrate sequence entries, part 408.
1451. gbinv409.seq - Invertebrate sequence entries, part 409.
1452. gbinv41.seq - Invertebrate sequence entries, part 41.
1453. gbinv410.seq - Invertebrate sequence entries, part 410.
1454. gbinv411.seq - Invertebrate sequence entries, part 411.
1455. gbinv412.seq - Invertebrate sequence entries, part 412.
1456. gbinv413.seq - Invertebrate sequence entries, part 413.
1457. gbinv414.seq - Invertebrate sequence entries, part 414.
1458. gbinv415.seq - Invertebrate sequence entries, part 415.
1459. gbinv416.seq - Invertebrate sequence entries, part 416.
1460. gbinv417.seq - Invertebrate sequence entries, part 417.
1461. gbinv418.seq - Invertebrate sequence entries, part 418.
1462. gbinv419.seq - Invertebrate sequence entries, part 419.
1463. gbinv42.seq - Invertebrate sequence entries, part 42.
1464. gbinv420.seq - Invertebrate sequence entries, part 420.
1465. gbinv421.seq - Invertebrate sequence entries, part 421.
1466. gbinv422.seq - Invertebrate sequence entries, part 422.
1467. gbinv423.seq - Invertebrate sequence entries, part 423.
1468. gbinv424.seq - Invertebrate sequence entries, part 424.
1469. gbinv425.seq - Invertebrate sequence entries, part 425.
1470. gbinv426.seq - Invertebrate sequence entries, part 426.
1471. gbinv427.seq - Invertebrate sequence entries, part 427.
1472. gbinv428.seq - Invertebrate sequence entries, part 428.
1473. gbinv429.seq - Invertebrate sequence entries, part 429.
1474. gbinv43.seq - Invertebrate sequence entries, part 43.
1475. gbinv430.seq - Invertebrate sequence entries, part 430.
1476. gbinv431.seq - Invertebrate sequence entries, part 431.
1477. gbinv432.seq - Invertebrate sequence entries, part 432.
1478. gbinv433.seq - Invertebrate sequence entries, part 433.
1479. gbinv434.seq - Invertebrate sequence entries, part 434.
1480. gbinv435.seq - Invertebrate sequence entries, part 435.
1481. gbinv436.seq - Invertebrate sequence entries, part 436.
1482. gbinv437.seq - Invertebrate sequence entries, part 437.
1483. gbinv438.seq - Invertebrate sequence entries, part 438.
1484. gbinv439.seq - Invertebrate sequence entries, part 439.
1485. gbinv44.seq - Invertebrate sequence entries, part 44.
1486. gbinv440.seq - Invertebrate sequence entries, part 440.
1487. gbinv441.seq - Invertebrate sequence entries, part 441.
1488. gbinv442.seq - Invertebrate sequence entries, part 442.
1489. gbinv443.seq - Invertebrate sequence entries, part 443.
1490. gbinv444.seq - Invertebrate sequence entries, part 444.
1491. gbinv445.seq - Invertebrate sequence entries, part 445.
1492. gbinv446.seq - Invertebrate sequence entries, part 446.
1493. gbinv447.seq - Invertebrate sequence entries, part 447.
1494. gbinv448.seq - Invertebrate sequence entries, part 448.
1495. gbinv449.seq - Invertebrate sequence entries, part 449.
1496. gbinv45.seq - Invertebrate sequence entries, part 45.
1497. gbinv450.seq - Invertebrate sequence entries, part 450.
1498. gbinv451.seq - Invertebrate sequence entries, part 451.
1499. gbinv452.seq - Invertebrate sequence entries, part 452.
1500. gbinv453.seq - Invertebrate sequence entries, part 453.
1501. gbinv454.seq - Invertebrate sequence entries, part 454.
1502. gbinv455.seq - Invertebrate sequence entries, part 455.
1503. gbinv456.seq - Invertebrate sequence entries, part 456.
1504. gbinv457.seq - Invertebrate sequence entries, part 457.
1505. gbinv458.seq - Invertebrate sequence entries, part 458.
1506. gbinv459.seq - Invertebrate sequence entries, part 459.
1507. gbinv46.seq - Invertebrate sequence entries, part 46.
1508. gbinv460.seq - Invertebrate sequence entries, part 460.
1509. gbinv461.seq - Invertebrate sequence entries, part 461.
1510. gbinv462.seq - Invertebrate sequence entries, part 462.
1511. gbinv463.seq - Invertebrate sequence entries, part 463.
1512. gbinv464.seq - Invertebrate sequence entries, part 464.
1513. gbinv465.seq - Invertebrate sequence entries, part 465.
1514. gbinv466.seq - Invertebrate sequence entries, part 466.
1515. gbinv467.seq - Invertebrate sequence entries, part 467.
1516. gbinv468.seq - Invertebrate sequence entries, part 468.
1517. gbinv469.seq - Invertebrate sequence entries, part 469.
1518. gbinv47.seq - Invertebrate sequence entries, part 47.
1519. gbinv470.seq - Invertebrate sequence entries, part 470.
1520. gbinv471.seq - Invertebrate sequence entries, part 471.
1521. gbinv472.seq - Invertebrate sequence entries, part 472.
1522. gbinv473.seq - Invertebrate sequence entries, part 473.
1523. gbinv474.seq - Invertebrate sequence entries, part 474.
1524. gbinv475.seq - Invertebrate sequence entries, part 475.
1525. gbinv476.seq - Invertebrate sequence entries, part 476.
1526. gbinv477.seq - Invertebrate sequence entries, part 477.
1527. gbinv478.seq - Invertebrate sequence entries, part 478.
1528. gbinv479.seq - Invertebrate sequence entries, part 479.
1529. gbinv48.seq - Invertebrate sequence entries, part 48.
1530. gbinv480.seq - Invertebrate sequence entries, part 480.
1531. gbinv481.seq - Invertebrate sequence entries, part 481.
1532. gbinv482.seq - Invertebrate sequence entries, part 482.
1533. gbinv483.seq - Invertebrate sequence entries, part 483.
1534. gbinv484.seq - Invertebrate sequence entries, part 484.
1535. gbinv485.seq - Invertebrate sequence entries, part 485.
1536. gbinv486.seq - Invertebrate sequence entries, part 486.
1537. gbinv487.seq - Invertebrate sequence entries, part 487.
1538. gbinv488.seq - Invertebrate sequence entries, part 488.
1539. gbinv489.seq - Invertebrate sequence entries, part 489.
1540. gbinv49.seq - Invertebrate sequence entries, part 49.
1541. gbinv490.seq - Invertebrate sequence entries, part 490.
1542. gbinv491.seq - Invertebrate sequence entries, part 491.
1543. gbinv492.seq - Invertebrate sequence entries, part 492.
1544. gbinv493.seq - Invertebrate sequence entries, part 493.
1545. gbinv494.seq - Invertebrate sequence entries, part 494.
1546. gbinv495.seq - Invertebrate sequence entries, part 495.
1547. gbinv496.seq - Invertebrate sequence entries, part 496.
1548. gbinv497.seq - Invertebrate sequence entries, part 497.
1549. gbinv498.seq - Invertebrate sequence entries, part 498.
1550. gbinv499.seq - Invertebrate sequence entries, part 499.
1551. gbinv5.seq - Invertebrate sequence entries, part 5.
1552. gbinv50.seq - Invertebrate sequence entries, part 50.
1553. gbinv500.seq - Invertebrate sequence entries, part 500.
1554. gbinv501.seq - Invertebrate sequence entries, part 501.
1555. gbinv502.seq - Invertebrate sequence entries, part 502.
1556. gbinv503.seq - Invertebrate sequence entries, part 503.
1557. gbinv504.seq - Invertebrate sequence entries, part 504.
1558. gbinv505.seq - Invertebrate sequence entries, part 505.
1559. gbinv506.seq - Invertebrate sequence entries, part 506.
1560. gbinv507.seq - Invertebrate sequence entries, part 507.
1561. gbinv508.seq - Invertebrate sequence entries, part 508.
1562. gbinv509.seq - Invertebrate sequence entries, part 509.
1563. gbinv51.seq - Invertebrate sequence entries, part 51.
1564. gbinv510.seq - Invertebrate sequence entries, part 510.
1565. gbinv511.seq - Invertebrate sequence entries, part 511.
1566. gbinv512.seq - Invertebrate sequence entries, part 512.
1567. gbinv513.seq - Invertebrate sequence entries, part 513.
1568. gbinv514.seq - Invertebrate sequence entries, part 514.
1569. gbinv515.seq - Invertebrate sequence entries, part 515.
1570. gbinv516.seq - Invertebrate sequence entries, part 516.
1571. gbinv517.seq - Invertebrate sequence entries, part 517.
1572. gbinv518.seq - Invertebrate sequence entries, part 518.
1573. gbinv519.seq - Invertebrate sequence entries, part 519.
1574. gbinv52.seq - Invertebrate sequence entries, part 52.
1575. gbinv520.seq - Invertebrate sequence entries, part 520.
1576. gbinv521.seq - Invertebrate sequence entries, part 521.
1577. gbinv522.seq - Invertebrate sequence entries, part 522.
1578. gbinv523.seq - Invertebrate sequence entries, part 523.
1579. gbinv524.seq - Invertebrate sequence entries, part 524.
1580. gbinv525.seq - Invertebrate sequence entries, part 525.
1581. gbinv526.seq - Invertebrate sequence entries, part 526.
1582. gbinv527.seq - Invertebrate sequence entries, part 527.
1583. gbinv528.seq - Invertebrate sequence entries, part 528.
1584. gbinv529.seq - Invertebrate sequence entries, part 529.
1585. gbinv53.seq - Invertebrate sequence entries, part 53.
1586. gbinv530.seq - Invertebrate sequence entries, part 530.
1587. gbinv531.seq - Invertebrate sequence entries, part 531.
1588. gbinv532.seq - Invertebrate sequence entries, part 532.
1589. gbinv533.seq - Invertebrate sequence entries, part 533.
1590. gbinv534.seq - Invertebrate sequence entries, part 534.
1591. gbinv535.seq - Invertebrate sequence entries, part 535.
1592. gbinv536.seq - Invertebrate sequence entries, part 536.
1593. gbinv537.seq - Invertebrate sequence entries, part 537.
1594. gbinv538.seq - Invertebrate sequence entries, part 538.
1595. gbinv539.seq - Invertebrate sequence entries, part 539.
1596. gbinv54.seq - Invertebrate sequence entries, part 54.
1597. gbinv540.seq - Invertebrate sequence entries, part 540.
1598. gbinv541.seq - Invertebrate sequence entries, part 541.
1599. gbinv542.seq - Invertebrate sequence entries, part 542.
1600. gbinv543.seq - Invertebrate sequence entries, part 543.
1601. gbinv544.seq - Invertebrate sequence entries, part 544.
1602. gbinv545.seq - Invertebrate sequence entries, part 545.
1603. gbinv546.seq - Invertebrate sequence entries, part 546.
1604. gbinv547.seq - Invertebrate sequence entries, part 547.
1605. gbinv548.seq - Invertebrate sequence entries, part 548.
1606. gbinv549.seq - Invertebrate sequence entries, part 549.
1607. gbinv55.seq - Invertebrate sequence entries, part 55.
1608. gbinv550.seq - Invertebrate sequence entries, part 550.
1609. gbinv551.seq - Invertebrate sequence entries, part 551.
1610. gbinv552.seq - Invertebrate sequence entries, part 552.
1611. gbinv553.seq - Invertebrate sequence entries, part 553.
1612. gbinv554.seq - Invertebrate sequence entries, part 554.
1613. gbinv555.seq - Invertebrate sequence entries, part 555.
1614. gbinv556.seq - Invertebrate sequence entries, part 556.
1615. gbinv557.seq - Invertebrate sequence entries, part 557.
1616. gbinv558.seq - Invertebrate sequence entries, part 558.
1617. gbinv559.seq - Invertebrate sequence entries, part 559.
1618. gbinv56.seq - Invertebrate sequence entries, part 56.
1619. gbinv560.seq - Invertebrate sequence entries, part 560.
1620. gbinv561.seq - Invertebrate sequence entries, part 561.
1621. gbinv562.seq - Invertebrate sequence entries, part 562.
1622. gbinv563.seq - Invertebrate sequence entries, part 563.
1623. gbinv564.seq - Invertebrate sequence entries, part 564.
1624. gbinv565.seq - Invertebrate sequence entries, part 565.
1625. gbinv566.seq - Invertebrate sequence entries, part 566.
1626. gbinv567.seq - Invertebrate sequence entries, part 567.
1627. gbinv568.seq - Invertebrate sequence entries, part 568.
1628. gbinv569.seq - Invertebrate sequence entries, part 569.
1629. gbinv57.seq - Invertebrate sequence entries, part 57.
1630. gbinv570.seq - Invertebrate sequence entries, part 570.
1631. gbinv571.seq - Invertebrate sequence entries, part 571.
1632. gbinv572.seq - Invertebrate sequence entries, part 572.
1633. gbinv573.seq - Invertebrate sequence entries, part 573.
1634. gbinv574.seq - Invertebrate sequence entries, part 574.
1635. gbinv575.seq - Invertebrate sequence entries, part 575.
1636. gbinv576.seq - Invertebrate sequence entries, part 576.
1637. gbinv577.seq - Invertebrate sequence entries, part 577.
1638. gbinv578.seq - Invertebrate sequence entries, part 578.
1639. gbinv579.seq - Invertebrate sequence entries, part 579.
1640. gbinv58.seq - Invertebrate sequence entries, part 58.
1641. gbinv580.seq - Invertebrate sequence entries, part 580.
1642. gbinv581.seq - Invertebrate sequence entries, part 581.
1643. gbinv582.seq - Invertebrate sequence entries, part 582.
1644. gbinv583.seq - Invertebrate sequence entries, part 583.
1645. gbinv584.seq - Invertebrate sequence entries, part 584.
1646. gbinv585.seq - Invertebrate sequence entries, part 585.
1647. gbinv586.seq - Invertebrate sequence entries, part 586.
1648. gbinv587.seq - Invertebrate sequence entries, part 587.
1649. gbinv588.seq - Invertebrate sequence entries, part 588.
1650. gbinv589.seq - Invertebrate sequence entries, part 589.
1651. gbinv59.seq - Invertebrate sequence entries, part 59.
1652. gbinv590.seq - Invertebrate sequence entries, part 590.
1653. gbinv591.seq - Invertebrate sequence entries, part 591.
1654. gbinv592.seq - Invertebrate sequence entries, part 592.
1655. gbinv593.seq - Invertebrate sequence entries, part 593.
1656. gbinv594.seq - Invertebrate sequence entries, part 594.
1657. gbinv595.seq - Invertebrate sequence entries, part 595.
1658. gbinv596.seq - Invertebrate sequence entries, part 596.
1659. gbinv597.seq - Invertebrate sequence entries, part 597.
1660. gbinv598.seq - Invertebrate sequence entries, part 598.
1661. gbinv599.seq - Invertebrate sequence entries, part 599.
1662. gbinv6.seq - Invertebrate sequence entries, part 6.
1663. gbinv60.seq - Invertebrate sequence entries, part 60.
1664. gbinv600.seq - Invertebrate sequence entries, part 600.
1665. gbinv601.seq - Invertebrate sequence entries, part 601.
1666. gbinv602.seq - Invertebrate sequence entries, part 602.
1667. gbinv603.seq - Invertebrate sequence entries, part 603.
1668. gbinv604.seq - Invertebrate sequence entries, part 604.
1669. gbinv605.seq - Invertebrate sequence entries, part 605.
1670. gbinv606.seq - Invertebrate sequence entries, part 606.
1671. gbinv607.seq - Invertebrate sequence entries, part 607.
1672. gbinv608.seq - Invertebrate sequence entries, part 608.
1673. gbinv609.seq - Invertebrate sequence entries, part 609.
1674. gbinv61.seq - Invertebrate sequence entries, part 61.
1675. gbinv610.seq - Invertebrate sequence entries, part 610.
1676. gbinv611.seq - Invertebrate sequence entries, part 611.
1677. gbinv612.seq - Invertebrate sequence entries, part 612.
1678. gbinv613.seq - Invertebrate sequence entries, part 613.
1679. gbinv614.seq - Invertebrate sequence entries, part 614.
1680. gbinv615.seq - Invertebrate sequence entries, part 615.
1681. gbinv616.seq - Invertebrate sequence entries, part 616.
1682. gbinv617.seq - Invertebrate sequence entries, part 617.
1683. gbinv618.seq - Invertebrate sequence entries, part 618.
1684. gbinv619.seq - Invertebrate sequence entries, part 619.
1685. gbinv62.seq - Invertebrate sequence entries, part 62.
1686. gbinv620.seq - Invertebrate sequence entries, part 620.
1687. gbinv621.seq - Invertebrate sequence entries, part 621.
1688. gbinv622.seq - Invertebrate sequence entries, part 622.
1689. gbinv623.seq - Invertebrate sequence entries, part 623.
1690. gbinv624.seq - Invertebrate sequence entries, part 624.
1691. gbinv625.seq - Invertebrate sequence entries, part 625.
1692. gbinv626.seq - Invertebrate sequence entries, part 626.
1693. gbinv627.seq - Invertebrate sequence entries, part 627.
1694. gbinv628.seq - Invertebrate sequence entries, part 628.
1695. gbinv629.seq - Invertebrate sequence entries, part 629.
1696. gbinv63.seq - Invertebrate sequence entries, part 63.
1697. gbinv630.seq - Invertebrate sequence entries, part 630.
1698. gbinv631.seq - Invertebrate sequence entries, part 631.
1699. gbinv632.seq - Invertebrate sequence entries, part 632.
1700. gbinv633.seq - Invertebrate sequence entries, part 633.
1701. gbinv634.seq - Invertebrate sequence entries, part 634.
1702. gbinv635.seq - Invertebrate sequence entries, part 635.
1703. gbinv636.seq - Invertebrate sequence entries, part 636.
1704. gbinv637.seq - Invertebrate sequence entries, part 637.
1705. gbinv638.seq - Invertebrate sequence entries, part 638.
1706. gbinv639.seq - Invertebrate sequence entries, part 639.
1707. gbinv64.seq - Invertebrate sequence entries, part 64.
1708. gbinv640.seq - Invertebrate sequence entries, part 640.
1709. gbinv641.seq - Invertebrate sequence entries, part 641.
1710. gbinv642.seq - Invertebrate sequence entries, part 642.
1711. gbinv643.seq - Invertebrate sequence entries, part 643.
1712. gbinv644.seq - Invertebrate sequence entries, part 644.
1713. gbinv645.seq - Invertebrate sequence entries, part 645.
1714. gbinv646.seq - Invertebrate sequence entries, part 646.
1715. gbinv647.seq - Invertebrate sequence entries, part 647.
1716. gbinv648.seq - Invertebrate sequence entries, part 648.
1717. gbinv649.seq - Invertebrate sequence entries, part 649.
1718. gbinv65.seq - Invertebrate sequence entries, part 65.
1719. gbinv650.seq - Invertebrate sequence entries, part 650.
1720. gbinv651.seq - Invertebrate sequence entries, part 651.
1721. gbinv652.seq - Invertebrate sequence entries, part 652.
1722. gbinv653.seq - Invertebrate sequence entries, part 653.
1723. gbinv654.seq - Invertebrate sequence entries, part 654.
1724. gbinv655.seq - Invertebrate sequence entries, part 655.
1725. gbinv656.seq - Invertebrate sequence entries, part 656.
1726. gbinv657.seq - Invertebrate sequence entries, part 657.
1727. gbinv658.seq - Invertebrate sequence entries, part 658.
1728. gbinv659.seq - Invertebrate sequence entries, part 659.
1729. gbinv66.seq - Invertebrate sequence entries, part 66.
1730. gbinv660.seq - Invertebrate sequence entries, part 660.
1731. gbinv661.seq - Invertebrate sequence entries, part 661.
1732. gbinv662.seq - Invertebrate sequence entries, part 662.
1733. gbinv663.seq - Invertebrate sequence entries, part 663.
1734. gbinv664.seq - Invertebrate sequence entries, part 664.
1735. gbinv665.seq - Invertebrate sequence entries, part 665.
1736. gbinv666.seq - Invertebrate sequence entries, part 666.
1737. gbinv667.seq - Invertebrate sequence entries, part 667.
1738. gbinv668.seq - Invertebrate sequence entries, part 668.
1739. gbinv669.seq - Invertebrate sequence entries, part 669.
1740. gbinv67.seq - Invertebrate sequence entries, part 67.
1741. gbinv670.seq - Invertebrate sequence entries, part 670.
1742. gbinv671.seq - Invertebrate sequence entries, part 671.
1743. gbinv672.seq - Invertebrate sequence entries, part 672.
1744. gbinv673.seq - Invertebrate sequence entries, part 673.
1745. gbinv674.seq - Invertebrate sequence entries, part 674.
1746. gbinv675.seq - Invertebrate sequence entries, part 675.
1747. gbinv676.seq - Invertebrate sequence entries, part 676.
1748. gbinv677.seq - Invertebrate sequence entries, part 677.
1749. gbinv678.seq - Invertebrate sequence entries, part 678.
1750. gbinv679.seq - Invertebrate sequence entries, part 679.
1751. gbinv68.seq - Invertebrate sequence entries, part 68.
1752. gbinv680.seq - Invertebrate sequence entries, part 680.
1753. gbinv681.seq - Invertebrate sequence entries, part 681.
1754. gbinv682.seq - Invertebrate sequence entries, part 682.
1755. gbinv683.seq - Invertebrate sequence entries, part 683.
1756. gbinv684.seq - Invertebrate sequence entries, part 684.
1757. gbinv685.seq - Invertebrate sequence entries, part 685.
1758. gbinv686.seq - Invertebrate sequence entries, part 686.
1759. gbinv687.seq - Invertebrate sequence entries, part 687.
1760. gbinv688.seq - Invertebrate sequence entries, part 688.
1761. gbinv689.seq - Invertebrate sequence entries, part 689.
1762. gbinv69.seq - Invertebrate sequence entries, part 69.
1763. gbinv690.seq - Invertebrate sequence entries, part 690.
1764. gbinv691.seq - Invertebrate sequence entries, part 691.
1765. gbinv692.seq - Invertebrate sequence entries, part 692.
1766. gbinv693.seq - Invertebrate sequence entries, part 693.
1767. gbinv694.seq - Invertebrate sequence entries, part 694.
1768. gbinv695.seq - Invertebrate sequence entries, part 695.
1769. gbinv696.seq - Invertebrate sequence entries, part 696.
1770. gbinv697.seq - Invertebrate sequence entries, part 697.
1771. gbinv698.seq - Invertebrate sequence entries, part 698.
1772. gbinv699.seq - Invertebrate sequence entries, part 699.
1773. gbinv7.seq - Invertebrate sequence entries, part 7.
1774. gbinv70.seq - Invertebrate sequence entries, part 70.
1775. gbinv700.seq - Invertebrate sequence entries, part 700.
1776. gbinv701.seq - Invertebrate sequence entries, part 701.
1777. gbinv702.seq - Invertebrate sequence entries, part 702.
1778. gbinv703.seq - Invertebrate sequence entries, part 703.
1779. gbinv704.seq - Invertebrate sequence entries, part 704.
1780. gbinv705.seq - Invertebrate sequence entries, part 705.
1781. gbinv706.seq - Invertebrate sequence entries, part 706.
1782. gbinv707.seq - Invertebrate sequence entries, part 707.
1783. gbinv708.seq - Invertebrate sequence entries, part 708.
1784. gbinv709.seq - Invertebrate sequence entries, part 709.
1785. gbinv71.seq - Invertebrate sequence entries, part 71.
1786. gbinv710.seq - Invertebrate sequence entries, part 710.
1787. gbinv711.seq - Invertebrate sequence entries, part 711.
1788. gbinv712.seq - Invertebrate sequence entries, part 712.
1789. gbinv713.seq - Invertebrate sequence entries, part 713.
1790. gbinv714.seq - Invertebrate sequence entries, part 714.
1791. gbinv715.seq - Invertebrate sequence entries, part 715.
1792. gbinv716.seq - Invertebrate sequence entries, part 716.
1793. gbinv717.seq - Invertebrate sequence entries, part 717.
1794. gbinv718.seq - Invertebrate sequence entries, part 718.
1795. gbinv719.seq - Invertebrate sequence entries, part 719.
1796. gbinv72.seq - Invertebrate sequence entries, part 72.
1797. gbinv720.seq - Invertebrate sequence entries, part 720.
1798. gbinv721.seq - Invertebrate sequence entries, part 721.
1799. gbinv722.seq - Invertebrate sequence entries, part 722.
1800. gbinv723.seq - Invertebrate sequence entries, part 723.
1801. gbinv724.seq - Invertebrate sequence entries, part 724.
1802. gbinv725.seq - Invertebrate sequence entries, part 725.
1803. gbinv726.seq - Invertebrate sequence entries, part 726.
1804. gbinv727.seq - Invertebrate sequence entries, part 727.
1805. gbinv728.seq - Invertebrate sequence entries, part 728.
1806. gbinv729.seq - Invertebrate sequence entries, part 729.
1807. gbinv73.seq - Invertebrate sequence entries, part 73.
1808. gbinv730.seq - Invertebrate sequence entries, part 730.
1809. gbinv731.seq - Invertebrate sequence entries, part 731.
1810. gbinv732.seq - Invertebrate sequence entries, part 732.
1811. gbinv733.seq - Invertebrate sequence entries, part 733.
1812. gbinv734.seq - Invertebrate sequence entries, part 734.
1813. gbinv735.seq - Invertebrate sequence entries, part 735.
1814. gbinv736.seq - Invertebrate sequence entries, part 736.
1815. gbinv737.seq - Invertebrate sequence entries, part 737.
1816. gbinv738.seq - Invertebrate sequence entries, part 738.
1817. gbinv739.seq - Invertebrate sequence entries, part 739.
1818. gbinv74.seq - Invertebrate sequence entries, part 74.
1819. gbinv740.seq - Invertebrate sequence entries, part 740.
1820. gbinv741.seq - Invertebrate sequence entries, part 741.
1821. gbinv742.seq - Invertebrate sequence entries, part 742.
1822. gbinv743.seq - Invertebrate sequence entries, part 743.
1823. gbinv744.seq - Invertebrate sequence entries, part 744.
1824. gbinv745.seq - Invertebrate sequence entries, part 745.
1825. gbinv746.seq - Invertebrate sequence entries, part 746.
1826. gbinv747.seq - Invertebrate sequence entries, part 747.
1827. gbinv748.seq - Invertebrate sequence entries, part 748.
1828. gbinv749.seq - Invertebrate sequence entries, part 749.
1829. gbinv75.seq - Invertebrate sequence entries, part 75.
1830. gbinv750.seq - Invertebrate sequence entries, part 750.
1831. gbinv751.seq - Invertebrate sequence entries, part 751.
1832. gbinv752.seq - Invertebrate sequence entries, part 752.
1833. gbinv753.seq - Invertebrate sequence entries, part 753.
1834. gbinv754.seq - Invertebrate sequence entries, part 754.
1835. gbinv755.seq - Invertebrate sequence entries, part 755.
1836. gbinv756.seq - Invertebrate sequence entries, part 756.
1837. gbinv757.seq - Invertebrate sequence entries, part 757.
1838. gbinv758.seq - Invertebrate sequence entries, part 758.
1839. gbinv759.seq - Invertebrate sequence entries, part 759.
1840. gbinv76.seq - Invertebrate sequence entries, part 76.
1841. gbinv760.seq - Invertebrate sequence entries, part 760.
1842. gbinv761.seq - Invertebrate sequence entries, part 761.
1843. gbinv762.seq - Invertebrate sequence entries, part 762.
1844. gbinv763.seq - Invertebrate sequence entries, part 763.
1845. gbinv764.seq - Invertebrate sequence entries, part 764.
1846. gbinv765.seq - Invertebrate sequence entries, part 765.
1847. gbinv766.seq - Invertebrate sequence entries, part 766.
1848. gbinv767.seq - Invertebrate sequence entries, part 767.
1849. gbinv768.seq - Invertebrate sequence entries, part 768.
1850. gbinv769.seq - Invertebrate sequence entries, part 769.
1851. gbinv77.seq - Invertebrate sequence entries, part 77.
1852. gbinv770.seq - Invertebrate sequence entries, part 770.
1853. gbinv771.seq - Invertebrate sequence entries, part 771.
1854. gbinv772.seq - Invertebrate sequence entries, part 772.
1855. gbinv773.seq - Invertebrate sequence entries, part 773.
1856. gbinv774.seq - Invertebrate sequence entries, part 774.
1857. gbinv775.seq - Invertebrate sequence entries, part 775.
1858. gbinv776.seq - Invertebrate sequence entries, part 776.
1859. gbinv777.seq - Invertebrate sequence entries, part 777.
1860. gbinv778.seq - Invertebrate sequence entries, part 778.
1861. gbinv779.seq - Invertebrate sequence entries, part 779.
1862. gbinv78.seq - Invertebrate sequence entries, part 78.
1863. gbinv780.seq - Invertebrate sequence entries, part 780.
1864. gbinv781.seq - Invertebrate sequence entries, part 781.
1865. gbinv782.seq - Invertebrate sequence entries, part 782.
1866. gbinv783.seq - Invertebrate sequence entries, part 783.
1867. gbinv784.seq - Invertebrate sequence entries, part 784.
1868. gbinv785.seq - Invertebrate sequence entries, part 785.
1869. gbinv786.seq - Invertebrate sequence entries, part 786.
1870. gbinv787.seq - Invertebrate sequence entries, part 787.
1871. gbinv788.seq - Invertebrate sequence entries, part 788.
1872. gbinv789.seq - Invertebrate sequence entries, part 789.
1873. gbinv79.seq - Invertebrate sequence entries, part 79.
1874. gbinv790.seq - Invertebrate sequence entries, part 790.
1875. gbinv791.seq - Invertebrate sequence entries, part 791.
1876. gbinv792.seq - Invertebrate sequence entries, part 792.
1877. gbinv793.seq - Invertebrate sequence entries, part 793.
1878. gbinv794.seq - Invertebrate sequence entries, part 794.
1879. gbinv795.seq - Invertebrate sequence entries, part 795.
1880. gbinv796.seq - Invertebrate sequence entries, part 796.
1881. gbinv797.seq - Invertebrate sequence entries, part 797.
1882. gbinv798.seq - Invertebrate sequence entries, part 798.
1883. gbinv799.seq - Invertebrate sequence entries, part 799.
1884. gbinv8.seq - Invertebrate sequence entries, part 8.
1885. gbinv80.seq - Invertebrate sequence entries, part 80.
1886. gbinv800.seq - Invertebrate sequence entries, part 800.
1887. gbinv801.seq - Invertebrate sequence entries, part 801.
1888. gbinv802.seq - Invertebrate sequence entries, part 802.
1889. gbinv803.seq - Invertebrate sequence entries, part 803.
1890. gbinv804.seq - Invertebrate sequence entries, part 804.
1891. gbinv805.seq - Invertebrate sequence entries, part 805.
1892. gbinv806.seq - Invertebrate sequence entries, part 806.
1893. gbinv807.seq - Invertebrate sequence entries, part 807.
1894. gbinv808.seq - Invertebrate sequence entries, part 808.
1895. gbinv809.seq - Invertebrate sequence entries, part 809.
1896. gbinv81.seq - Invertebrate sequence entries, part 81.
1897. gbinv810.seq - Invertebrate sequence entries, part 810.
1898. gbinv811.seq - Invertebrate sequence entries, part 811.
1899. gbinv812.seq - Invertebrate sequence entries, part 812.
1900. gbinv813.seq - Invertebrate sequence entries, part 813.
1901. gbinv814.seq - Invertebrate sequence entries, part 814.
1902. gbinv815.seq - Invertebrate sequence entries, part 815.
1903. gbinv816.seq - Invertebrate sequence entries, part 816.
1904. gbinv817.seq - Invertebrate sequence entries, part 817.
1905. gbinv818.seq - Invertebrate sequence entries, part 818.
1906. gbinv819.seq - Invertebrate sequence entries, part 819.
1907. gbinv82.seq - Invertebrate sequence entries, part 82.
1908. gbinv820.seq - Invertebrate sequence entries, part 820.
1909. gbinv821.seq - Invertebrate sequence entries, part 821.
1910. gbinv822.seq - Invertebrate sequence entries, part 822.
1911. gbinv823.seq - Invertebrate sequence entries, part 823.
1912. gbinv824.seq - Invertebrate sequence entries, part 824.
1913. gbinv825.seq - Invertebrate sequence entries, part 825.
1914. gbinv826.seq - Invertebrate sequence entries, part 826.
1915. gbinv827.seq - Invertebrate sequence entries, part 827.
1916. gbinv828.seq - Invertebrate sequence entries, part 828.
1917. gbinv829.seq - Invertebrate sequence entries, part 829.
1918. gbinv83.seq - Invertebrate sequence entries, part 83.
1919. gbinv830.seq - Invertebrate sequence entries, part 830.
1920. gbinv831.seq - Invertebrate sequence entries, part 831.
1921. gbinv832.seq - Invertebrate sequence entries, part 832.
1922. gbinv833.seq - Invertebrate sequence entries, part 833.
1923. gbinv834.seq - Invertebrate sequence entries, part 834.
1924. gbinv835.seq - Invertebrate sequence entries, part 835.
1925. gbinv836.seq - Invertebrate sequence entries, part 836.
1926. gbinv837.seq - Invertebrate sequence entries, part 837.
1927. gbinv838.seq - Invertebrate sequence entries, part 838.
1928. gbinv839.seq - Invertebrate sequence entries, part 839.
1929. gbinv84.seq - Invertebrate sequence entries, part 84.
1930. gbinv840.seq - Invertebrate sequence entries, part 840.
1931. gbinv841.seq - Invertebrate sequence entries, part 841.
1932. gbinv842.seq - Invertebrate sequence entries, part 842.
1933. gbinv843.seq - Invertebrate sequence entries, part 843.
1934. gbinv844.seq - Invertebrate sequence entries, part 844.
1935. gbinv845.seq - Invertebrate sequence entries, part 845.
1936. gbinv846.seq - Invertebrate sequence entries, part 846.
1937. gbinv847.seq - Invertebrate sequence entries, part 847.
1938. gbinv848.seq - Invertebrate sequence entries, part 848.
1939. gbinv849.seq - Invertebrate sequence entries, part 849.
1940. gbinv85.seq - Invertebrate sequence entries, part 85.
1941. gbinv850.seq - Invertebrate sequence entries, part 850.
1942. gbinv851.seq - Invertebrate sequence entries, part 851.
1943. gbinv852.seq - Invertebrate sequence entries, part 852.
1944. gbinv853.seq - Invertebrate sequence entries, part 853.
1945. gbinv854.seq - Invertebrate sequence entries, part 854.
1946. gbinv855.seq - Invertebrate sequence entries, part 855.
1947. gbinv856.seq - Invertebrate sequence entries, part 856.
1948. gbinv857.seq - Invertebrate sequence entries, part 857.
1949. gbinv858.seq - Invertebrate sequence entries, part 858.
1950. gbinv859.seq - Invertebrate sequence entries, part 859.
1951. gbinv86.seq - Invertebrate sequence entries, part 86.
1952. gbinv860.seq - Invertebrate sequence entries, part 860.
1953. gbinv861.seq - Invertebrate sequence entries, part 861.
1954. gbinv862.seq - Invertebrate sequence entries, part 862.
1955. gbinv863.seq - Invertebrate sequence entries, part 863.
1956. gbinv864.seq - Invertebrate sequence entries, part 864.
1957. gbinv865.seq - Invertebrate sequence entries, part 865.
1958. gbinv866.seq - Invertebrate sequence entries, part 866.
1959. gbinv867.seq - Invertebrate sequence entries, part 867.
1960. gbinv868.seq - Invertebrate sequence entries, part 868.
1961. gbinv869.seq - Invertebrate sequence entries, part 869.
1962. gbinv87.seq - Invertebrate sequence entries, part 87.
1963. gbinv870.seq - Invertebrate sequence entries, part 870.
1964. gbinv871.seq - Invertebrate sequence entries, part 871.
1965. gbinv872.seq - Invertebrate sequence entries, part 872.
1966. gbinv873.seq - Invertebrate sequence entries, part 873.
1967. gbinv874.seq - Invertebrate sequence entries, part 874.
1968. gbinv875.seq - Invertebrate sequence entries, part 875.
1969. gbinv876.seq - Invertebrate sequence entries, part 876.
1970. gbinv877.seq - Invertebrate sequence entries, part 877.
1971. gbinv878.seq - Invertebrate sequence entries, part 878.
1972. gbinv879.seq - Invertebrate sequence entries, part 879.
1973. gbinv88.seq - Invertebrate sequence entries, part 88.
1974. gbinv880.seq - Invertebrate sequence entries, part 880.
1975. gbinv881.seq - Invertebrate sequence entries, part 881.
1976. gbinv882.seq - Invertebrate sequence entries, part 882.
1977. gbinv883.seq - Invertebrate sequence entries, part 883.
1978. gbinv884.seq - Invertebrate sequence entries, part 884.
1979. gbinv885.seq - Invertebrate sequence entries, part 885.
1980. gbinv886.seq - Invertebrate sequence entries, part 886.
1981. gbinv887.seq - Invertebrate sequence entries, part 887.
1982. gbinv888.seq - Invertebrate sequence entries, part 888.
1983. gbinv889.seq - Invertebrate sequence entries, part 889.
1984. gbinv89.seq - Invertebrate sequence entries, part 89.
1985. gbinv890.seq - Invertebrate sequence entries, part 890.
1986. gbinv891.seq - Invertebrate sequence entries, part 891.
1987. gbinv892.seq - Invertebrate sequence entries, part 892.
1988. gbinv893.seq - Invertebrate sequence entries, part 893.
1989. gbinv894.seq - Invertebrate sequence entries, part 894.
1990. gbinv895.seq - Invertebrate sequence entries, part 895.
1991. gbinv896.seq - Invertebrate sequence entries, part 896.
1992. gbinv897.seq - Invertebrate sequence entries, part 897.
1993. gbinv898.seq - Invertebrate sequence entries, part 898.
1994. gbinv899.seq - Invertebrate sequence entries, part 899.
1995. gbinv9.seq - Invertebrate sequence entries, part 9.
1996. gbinv90.seq - Invertebrate sequence entries, part 90.
1997. gbinv900.seq - Invertebrate sequence entries, part 900.
1998. gbinv901.seq - Invertebrate sequence entries, part 901.
1999. gbinv902.seq - Invertebrate sequence entries, part 902.
2000. gbinv903.seq - Invertebrate sequence entries, part 903.
2001. gbinv904.seq - Invertebrate sequence entries, part 904.
2002. gbinv905.seq - Invertebrate sequence entries, part 905.
2003. gbinv906.seq - Invertebrate sequence entries, part 906.
2004. gbinv907.seq - Invertebrate sequence entries, part 907.
2005. gbinv908.seq - Invertebrate sequence entries, part 908.
2006. gbinv909.seq - Invertebrate sequence entries, part 909.
2007. gbinv91.seq - Invertebrate sequence entries, part 91.
2008. gbinv910.seq - Invertebrate sequence entries, part 910.
2009. gbinv911.seq - Invertebrate sequence entries, part 911.
2010. gbinv912.seq - Invertebrate sequence entries, part 912.
2011. gbinv913.seq - Invertebrate sequence entries, part 913.
2012. gbinv914.seq - Invertebrate sequence entries, part 914.
2013. gbinv915.seq - Invertebrate sequence entries, part 915.
2014. gbinv916.seq - Invertebrate sequence entries, part 916.
2015. gbinv917.seq - Invertebrate sequence entries, part 917.
2016. gbinv918.seq - Invertebrate sequence entries, part 918.
2017. gbinv919.seq - Invertebrate sequence entries, part 919.
2018. gbinv92.seq - Invertebrate sequence entries, part 92.
2019. gbinv920.seq - Invertebrate sequence entries, part 920.
2020. gbinv921.seq - Invertebrate sequence entries, part 921.
2021. gbinv922.seq - Invertebrate sequence entries, part 922.
2022. gbinv923.seq - Invertebrate sequence entries, part 923.
2023. gbinv924.seq - Invertebrate sequence entries, part 924.
2024. gbinv925.seq - Invertebrate sequence entries, part 925.
2025. gbinv926.seq - Invertebrate sequence entries, part 926.
2026. gbinv927.seq - Invertebrate sequence entries, part 927.
2027. gbinv928.seq - Invertebrate sequence entries, part 928.
2028. gbinv929.seq - Invertebrate sequence entries, part 929.
2029. gbinv93.seq - Invertebrate sequence entries, part 93.
2030. gbinv930.seq - Invertebrate sequence entries, part 930.
2031. gbinv931.seq - Invertebrate sequence entries, part 931.
2032. gbinv932.seq - Invertebrate sequence entries, part 932.
2033. gbinv933.seq - Invertebrate sequence entries, part 933.
2034. gbinv934.seq - Invertebrate sequence entries, part 934.
2035. gbinv935.seq - Invertebrate sequence entries, part 935.
2036. gbinv936.seq - Invertebrate sequence entries, part 936.
2037. gbinv937.seq - Invertebrate sequence entries, part 937.
2038. gbinv938.seq - Invertebrate sequence entries, part 938.
2039. gbinv939.seq - Invertebrate sequence entries, part 939.
2040. gbinv94.seq - Invertebrate sequence entries, part 94.
2041. gbinv940.seq - Invertebrate sequence entries, part 940.
2042. gbinv941.seq - Invertebrate sequence entries, part 941.
2043. gbinv942.seq - Invertebrate sequence entries, part 942.
2044. gbinv943.seq - Invertebrate sequence entries, part 943.
2045. gbinv944.seq - Invertebrate sequence entries, part 944.
2046. gbinv945.seq - Invertebrate sequence entries, part 945.
2047. gbinv946.seq - Invertebrate sequence entries, part 946.
2048. gbinv947.seq - Invertebrate sequence entries, part 947.
2049. gbinv948.seq - Invertebrate sequence entries, part 948.
2050. gbinv949.seq - Invertebrate sequence entries, part 949.
2051. gbinv95.seq - Invertebrate sequence entries, part 95.
2052. gbinv950.seq - Invertebrate sequence entries, part 950.
2053. gbinv951.seq - Invertebrate sequence entries, part 951.
2054. gbinv952.seq - Invertebrate sequence entries, part 952.
2055. gbinv953.seq - Invertebrate sequence entries, part 953.
2056. gbinv954.seq - Invertebrate sequence entries, part 954.
2057. gbinv955.seq - Invertebrate sequence entries, part 955.
2058. gbinv956.seq - Invertebrate sequence entries, part 956.
2059. gbinv957.seq - Invertebrate sequence entries, part 957.
2060. gbinv958.seq - Invertebrate sequence entries, part 958.
2061. gbinv959.seq - Invertebrate sequence entries, part 959.
2062. gbinv96.seq - Invertebrate sequence entries, part 96.
2063. gbinv960.seq - Invertebrate sequence entries, part 960.
2064. gbinv961.seq - Invertebrate sequence entries, part 961.
2065. gbinv962.seq - Invertebrate sequence entries, part 962.
2066. gbinv963.seq - Invertebrate sequence entries, part 963.
2067. gbinv964.seq - Invertebrate sequence entries, part 964.
2068. gbinv965.seq - Invertebrate sequence entries, part 965.
2069. gbinv966.seq - Invertebrate sequence entries, part 966.
2070. gbinv967.seq - Invertebrate sequence entries, part 967.
2071. gbinv968.seq - Invertebrate sequence entries, part 968.
2072. gbinv969.seq - Invertebrate sequence entries, part 969.
2073. gbinv97.seq - Invertebrate sequence entries, part 97.
2074. gbinv970.seq - Invertebrate sequence entries, part 970.
2075. gbinv971.seq - Invertebrate sequence entries, part 971.
2076. gbinv972.seq - Invertebrate sequence entries, part 972.
2077. gbinv973.seq - Invertebrate sequence entries, part 973.
2078. gbinv974.seq - Invertebrate sequence entries, part 974.
2079. gbinv975.seq - Invertebrate sequence entries, part 975.
2080. gbinv976.seq - Invertebrate sequence entries, part 976.
2081. gbinv977.seq - Invertebrate sequence entries, part 977.
2082. gbinv978.seq - Invertebrate sequence entries, part 978.
2083. gbinv979.seq - Invertebrate sequence entries, part 979.
2084. gbinv98.seq - Invertebrate sequence entries, part 98.
2085. gbinv980.seq - Invertebrate sequence entries, part 980.
2086. gbinv981.seq - Invertebrate sequence entries, part 981.
2087. gbinv982.seq - Invertebrate sequence entries, part 982.
2088. gbinv983.seq - Invertebrate sequence entries, part 983.
2089. gbinv984.seq - Invertebrate sequence entries, part 984.
2090. gbinv985.seq - Invertebrate sequence entries, part 985.
2091. gbinv986.seq - Invertebrate sequence entries, part 986.
2092. gbinv987.seq - Invertebrate sequence entries, part 987.
2093. gbinv988.seq - Invertebrate sequence entries, part 988.
2094. gbinv989.seq - Invertebrate sequence entries, part 989.
2095. gbinv99.seq - Invertebrate sequence entries, part 99.
2096. gbinv990.seq - Invertebrate sequence entries, part 990.
2097. gbinv991.seq - Invertebrate sequence entries, part 991.
2098. gbinv992.seq - Invertebrate sequence entries, part 992.
2099. gbinv993.seq - Invertebrate sequence entries, part 993.
2100. gbinv994.seq - Invertebrate sequence entries, part 994.
2101. gbinv995.seq - Invertebrate sequence entries, part 995.
2102. gbinv996.seq - Invertebrate sequence entries, part 996.
2103. gbinv997.seq - Invertebrate sequence entries, part 997.
2104. gbinv998.seq - Invertebrate sequence entries, part 998.
2105. gbinv999.seq - Invertebrate sequence entries, part 999.
2106. gbmam1.seq - Other mammalian sequence entries, part 1.
2107. gbmam10.seq - Other mammalian sequence entries, part 10.
2108. gbmam100.seq - Other mammalian sequence entries, part 100.
2109. gbmam101.seq - Other mammalian sequence entries, part 101.
2110. gbmam102.seq - Other mammalian sequence entries, part 102.
2111. gbmam103.seq - Other mammalian sequence entries, part 103.
2112. gbmam104.seq - Other mammalian sequence entries, part 104.
2113. gbmam105.seq - Other mammalian sequence entries, part 105.
2114. gbmam106.seq - Other mammalian sequence entries, part 106.
2115. gbmam107.seq - Other mammalian sequence entries, part 107.
2116. gbmam108.seq - Other mammalian sequence entries, part 108.
2117. gbmam109.seq - Other mammalian sequence entries, part 109.
2118. gbmam11.seq - Other mammalian sequence entries, part 11.
2119. gbmam110.seq - Other mammalian sequence entries, part 110.
2120. gbmam111.seq - Other mammalian sequence entries, part 111.
2121. gbmam112.seq - Other mammalian sequence entries, part 112.
2122. gbmam113.seq - Other mammalian sequence entries, part 113.
2123. gbmam114.seq - Other mammalian sequence entries, part 114.
2124. gbmam115.seq - Other mammalian sequence entries, part 115.
2125. gbmam116.seq - Other mammalian sequence entries, part 116.
2126. gbmam117.seq - Other mammalian sequence entries, part 117.
2127. gbmam118.seq - Other mammalian sequence entries, part 118.
2128. gbmam119.seq - Other mammalian sequence entries, part 119.
2129. gbmam12.seq - Other mammalian sequence entries, part 12.
2130. gbmam120.seq - Other mammalian sequence entries, part 120.
2131. gbmam121.seq - Other mammalian sequence entries, part 121.
2132. gbmam122.seq - Other mammalian sequence entries, part 122.
2133. gbmam123.seq - Other mammalian sequence entries, part 123.
2134. gbmam124.seq - Other mammalian sequence entries, part 124.
2135. gbmam125.seq - Other mammalian sequence entries, part 125.
2136. gbmam126.seq - Other mammalian sequence entries, part 126.
2137. gbmam127.seq - Other mammalian sequence entries, part 127.
2138. gbmam128.seq - Other mammalian sequence entries, part 128.
2139. gbmam129.seq - Other mammalian sequence entries, part 129.
2140. gbmam13.seq - Other mammalian sequence entries, part 13.
2141. gbmam130.seq - Other mammalian sequence entries, part 130.
2142. gbmam131.seq - Other mammalian sequence entries, part 131.
2143. gbmam132.seq - Other mammalian sequence entries, part 132.
2144. gbmam133.seq - Other mammalian sequence entries, part 133.
2145. gbmam134.seq - Other mammalian sequence entries, part 134.
2146. gbmam135.seq - Other mammalian sequence entries, part 135.
2147. gbmam136.seq - Other mammalian sequence entries, part 136.
2148. gbmam137.seq - Other mammalian sequence entries, part 137.
2149. gbmam138.seq - Other mammalian sequence entries, part 138.
2150. gbmam139.seq - Other mammalian sequence entries, part 139.
2151. gbmam14.seq - Other mammalian sequence entries, part 14.
2152. gbmam140.seq - Other mammalian sequence entries, part 140.
2153. gbmam141.seq - Other mammalian sequence entries, part 141.
2154. gbmam142.seq - Other mammalian sequence entries, part 142.
2155. gbmam143.seq - Other mammalian sequence entries, part 143.
2156. gbmam144.seq - Other mammalian sequence entries, part 144.
2157. gbmam145.seq - Other mammalian sequence entries, part 145.
2158. gbmam146.seq - Other mammalian sequence entries, part 146.
2159. gbmam147.seq - Other mammalian sequence entries, part 147.
2160. gbmam148.seq - Other mammalian sequence entries, part 148.
2161. gbmam149.seq - Other mammalian sequence entries, part 149.
2162. gbmam15.seq - Other mammalian sequence entries, part 15.
2163. gbmam150.seq - Other mammalian sequence entries, part 150.
2164. gbmam151.seq - Other mammalian sequence entries, part 151.
2165. gbmam152.seq - Other mammalian sequence entries, part 152.
2166. gbmam153.seq - Other mammalian sequence entries, part 153.
2167. gbmam154.seq - Other mammalian sequence entries, part 154.
2168. gbmam155.seq - Other mammalian sequence entries, part 155.
2169. gbmam156.seq - Other mammalian sequence entries, part 156.
2170. gbmam157.seq - Other mammalian sequence entries, part 157.
2171. gbmam158.seq - Other mammalian sequence entries, part 158.
2172. gbmam159.seq - Other mammalian sequence entries, part 159.
2173. gbmam16.seq - Other mammalian sequence entries, part 16.
2174. gbmam160.seq - Other mammalian sequence entries, part 160.
2175. gbmam17.seq - Other mammalian sequence entries, part 17.
2176. gbmam18.seq - Other mammalian sequence entries, part 18.
2177. gbmam19.seq - Other mammalian sequence entries, part 19.
2178. gbmam2.seq - Other mammalian sequence entries, part 2.
2179. gbmam20.seq - Other mammalian sequence entries, part 20.
2180. gbmam21.seq - Other mammalian sequence entries, part 21.
2181. gbmam22.seq - Other mammalian sequence entries, part 22.
2182. gbmam23.seq - Other mammalian sequence entries, part 23.
2183. gbmam24.seq - Other mammalian sequence entries, part 24.
2184. gbmam25.seq - Other mammalian sequence entries, part 25.
2185. gbmam26.seq - Other mammalian sequence entries, part 26.
2186. gbmam27.seq - Other mammalian sequence entries, part 27.
2187. gbmam28.seq - Other mammalian sequence entries, part 28.
2188. gbmam29.seq - Other mammalian sequence entries, part 29.
2189. gbmam3.seq - Other mammalian sequence entries, part 3.
2190. gbmam30.seq - Other mammalian sequence entries, part 30.
2191. gbmam31.seq - Other mammalian sequence entries, part 31.
2192. gbmam32.seq - Other mammalian sequence entries, part 32.
2193. gbmam33.seq - Other mammalian sequence entries, part 33.
2194. gbmam34.seq - Other mammalian sequence entries, part 34.
2195. gbmam35.seq - Other mammalian sequence entries, part 35.
2196. gbmam36.seq - Other mammalian sequence entries, part 36.
2197. gbmam37.seq - Other mammalian sequence entries, part 37.
2198. gbmam38.seq - Other mammalian sequence entries, part 38.
2199. gbmam39.seq - Other mammalian sequence entries, part 39.
2200. gbmam4.seq - Other mammalian sequence entries, part 4.
2201. gbmam40.seq - Other mammalian sequence entries, part 40.
2202. gbmam41.seq - Other mammalian sequence entries, part 41.
2203. gbmam42.seq - Other mammalian sequence entries, part 42.
2204. gbmam43.seq - Other mammalian sequence entries, part 43.
2205. gbmam44.seq - Other mammalian sequence entries, part 44.
2206. gbmam45.seq - Other mammalian sequence entries, part 45.
2207. gbmam46.seq - Other mammalian sequence entries, part 46.
2208. gbmam47.seq - Other mammalian sequence entries, part 47.
2209. gbmam48.seq - Other mammalian sequence entries, part 48.
2210. gbmam49.seq - Other mammalian sequence entries, part 49.
2211. gbmam5.seq - Other mammalian sequence entries, part 5.
2212. gbmam50.seq - Other mammalian sequence entries, part 50.
2213. gbmam51.seq - Other mammalian sequence entries, part 51.
2214. gbmam52.seq - Other mammalian sequence entries, part 52.
2215. gbmam53.seq - Other mammalian sequence entries, part 53.
2216. gbmam54.seq - Other mammalian sequence entries, part 54.
2217. gbmam55.seq - Other mammalian sequence entries, part 55.
2218. gbmam56.seq - Other mammalian sequence entries, part 56.
2219. gbmam57.seq - Other mammalian sequence entries, part 57.
2220. gbmam58.seq - Other mammalian sequence entries, part 58.
2221. gbmam59.seq - Other mammalian sequence entries, part 59.
2222. gbmam6.seq - Other mammalian sequence entries, part 6.
2223. gbmam60.seq - Other mammalian sequence entries, part 60.
2224. gbmam61.seq - Other mammalian sequence entries, part 61.
2225. gbmam62.seq - Other mammalian sequence entries, part 62.
2226. gbmam63.seq - Other mammalian sequence entries, part 63.
2227. gbmam64.seq - Other mammalian sequence entries, part 64.
2228. gbmam65.seq - Other mammalian sequence entries, part 65.
2229. gbmam66.seq - Other mammalian sequence entries, part 66.
2230. gbmam67.seq - Other mammalian sequence entries, part 67.
2231. gbmam68.seq - Other mammalian sequence entries, part 68.
2232. gbmam69.seq - Other mammalian sequence entries, part 69.
2233. gbmam7.seq - Other mammalian sequence entries, part 7.
2234. gbmam70.seq - Other mammalian sequence entries, part 70.
2235. gbmam71.seq - Other mammalian sequence entries, part 71.
2236. gbmam72.seq - Other mammalian sequence entries, part 72.
2237. gbmam73.seq - Other mammalian sequence entries, part 73.
2238. gbmam74.seq - Other mammalian sequence entries, part 74.
2239. gbmam75.seq - Other mammalian sequence entries, part 75.
2240. gbmam76.seq - Other mammalian sequence entries, part 76.
2241. gbmam77.seq - Other mammalian sequence entries, part 77.
2242. gbmam78.seq - Other mammalian sequence entries, part 78.
2243. gbmam79.seq - Other mammalian sequence entries, part 79.
2244. gbmam8.seq - Other mammalian sequence entries, part 8.
2245. gbmam80.seq - Other mammalian sequence entries, part 80.
2246. gbmam81.seq - Other mammalian sequence entries, part 81.
2247. gbmam82.seq - Other mammalian sequence entries, part 82.
2248. gbmam83.seq - Other mammalian sequence entries, part 83.
2249. gbmam84.seq - Other mammalian sequence entries, part 84.
2250. gbmam85.seq - Other mammalian sequence entries, part 85.
2251. gbmam86.seq - Other mammalian sequence entries, part 86.
2252. gbmam87.seq - Other mammalian sequence entries, part 87.
2253. gbmam88.seq - Other mammalian sequence entries, part 88.
2254. gbmam89.seq - Other mammalian sequence entries, part 89.
2255. gbmam9.seq - Other mammalian sequence entries, part 9.
2256. gbmam90.seq - Other mammalian sequence entries, part 90.
2257. gbmam91.seq - Other mammalian sequence entries, part 91.
2258. gbmam92.seq - Other mammalian sequence entries, part 92.
2259. gbmam93.seq - Other mammalian sequence entries, part 93.
2260. gbmam94.seq - Other mammalian sequence entries, part 94.
2261. gbmam95.seq - Other mammalian sequence entries, part 95.
2262. gbmam96.seq - Other mammalian sequence entries, part 96.
2263. gbmam97.seq - Other mammalian sequence entries, part 97.
2264. gbmam98.seq - Other mammalian sequence entries, part 98.
2265. gbmam99.seq - Other mammalian sequence entries, part 99.
2266. gbnew.txt - Accession numbers of entries new since the previous release.
2267. gbpat1.seq - Patent sequence entries, part 1.
2268. gbpat10.seq - Patent sequence entries, part 10.
2269. gbpat100.seq - Patent sequence entries, part 100.
2270. gbpat101.seq - Patent sequence entries, part 101.
2271. gbpat102.seq - Patent sequence entries, part 102.
2272. gbpat103.seq - Patent sequence entries, part 103.
2273. gbpat104.seq - Patent sequence entries, part 104.
2274. gbpat105.seq - Patent sequence entries, part 105.
2275. gbpat106.seq - Patent sequence entries, part 106.
2276. gbpat107.seq - Patent sequence entries, part 107.
2277. gbpat108.seq - Patent sequence entries, part 108.
2278. gbpat109.seq - Patent sequence entries, part 109.
2279. gbpat11.seq - Patent sequence entries, part 11.
2280. gbpat12.seq - Patent sequence entries, part 12.
2281. gbpat13.seq - Patent sequence entries, part 13.
2282. gbpat14.seq - Patent sequence entries, part 14.
2283. gbpat15.seq - Patent sequence entries, part 15.
2284. gbpat16.seq - Patent sequence entries, part 16.
2285. gbpat17.seq - Patent sequence entries, part 17.
2286. gbpat18.seq - Patent sequence entries, part 18.
2287. gbpat19.seq - Patent sequence entries, part 19.
2288. gbpat2.seq - Patent sequence entries, part 2.
2289. gbpat20.seq - Patent sequence entries, part 20.
2290. gbpat21.seq - Patent sequence entries, part 21.
2291. gbpat22.seq - Patent sequence entries, part 22.
2292. gbpat23.seq - Patent sequence entries, part 23.
2293. gbpat24.seq - Patent sequence entries, part 24.
2294. gbpat25.seq - Patent sequence entries, part 25.
2295. gbpat26.seq - Patent sequence entries, part 26.
2296. gbpat27.seq - Patent sequence entries, part 27.
2297. gbpat28.seq - Patent sequence entries, part 28.
2298. gbpat29.seq - Patent sequence entries, part 29.
2299. gbpat3.seq - Patent sequence entries, part 3.
2300. gbpat30.seq - Patent sequence entries, part 30.
2301. gbpat31.seq - Patent sequence entries, part 31.
2302. gbpat32.seq - Patent sequence entries, part 32.
2303. gbpat33.seq - Patent sequence entries, part 33.
2304. gbpat34.seq - Patent sequence entries, part 34.
2305. gbpat35.seq - Patent sequence entries, part 35.
2306. gbpat36.seq - Patent sequence entries, part 36.
2307. gbpat37.seq - Patent sequence entries, part 37.
2308. gbpat38.seq - Patent sequence entries, part 38.
2309. gbpat39.seq - Patent sequence entries, part 39.
2310. gbpat4.seq - Patent sequence entries, part 4.
2311. gbpat40.seq - Patent sequence entries, part 40.
2312. gbpat41.seq - Patent sequence entries, part 41.
2313. gbpat42.seq - Patent sequence entries, part 42.
2314. gbpat43.seq - Patent sequence entries, part 43.
2315. gbpat44.seq - Patent sequence entries, part 44.
2316. gbpat45.seq - Patent sequence entries, part 45.
2317. gbpat46.seq - Patent sequence entries, part 46.
2318. gbpat47.seq - Patent sequence entries, part 47.
2319. gbpat48.seq - Patent sequence entries, part 48.
2320. gbpat49.seq - Patent sequence entries, part 49.
2321. gbpat5.seq - Patent sequence entries, part 5.
2322. gbpat50.seq - Patent sequence entries, part 50.
2323. gbpat51.seq - Patent sequence entries, part 51.
2324. gbpat52.seq - Patent sequence entries, part 52.
2325. gbpat53.seq - Patent sequence entries, part 53.
2326. gbpat54.seq - Patent sequence entries, part 54.
2327. gbpat55.seq - Patent sequence entries, part 55.
2328. gbpat56.seq - Patent sequence entries, part 56.
2329. gbpat57.seq - Patent sequence entries, part 57.
2330. gbpat58.seq - Patent sequence entries, part 58.
2331. gbpat59.seq - Patent sequence entries, part 59.
2332. gbpat6.seq - Patent sequence entries, part 6.
2333. gbpat60.seq - Patent sequence entries, part 60.
2334. gbpat61.seq - Patent sequence entries, part 61.
2335. gbpat62.seq - Patent sequence entries, part 62.
2336. gbpat63.seq - Patent sequence entries, part 63.
2337. gbpat64.seq - Patent sequence entries, part 64.
2338. gbpat65.seq - Patent sequence entries, part 65.
2339. gbpat66.seq - Patent sequence entries, part 66.
2340. gbpat67.seq - Patent sequence entries, part 67.
2341. gbpat68.seq - Patent sequence entries, part 68.
2342. gbpat69.seq - Patent sequence entries, part 69.
2343. gbpat7.seq - Patent sequence entries, part 7.
2344. gbpat70.seq - Patent sequence entries, part 70.
2345. gbpat71.seq - Patent sequence entries, part 71.
2346. gbpat72.seq - Patent sequence entries, part 72.
2347. gbpat73.seq - Patent sequence entries, part 73.
2348. gbpat74.seq - Patent sequence entries, part 74.
2349. gbpat75.seq - Patent sequence entries, part 75.
2350. gbpat76.seq - Patent sequence entries, part 76.
2351. gbpat77.seq - Patent sequence entries, part 77.
2352. gbpat78.seq - Patent sequence entries, part 78.
2353. gbpat79.seq - Patent sequence entries, part 79.
2354. gbpat8.seq - Patent sequence entries, part 8.
2355. gbpat80.seq - Patent sequence entries, part 80.
2356. gbpat81.seq - Patent sequence entries, part 81.
2357. gbpat82.seq - Patent sequence entries, part 82.
2358. gbpat83.seq - Patent sequence entries, part 83.
2359. gbpat84.seq - Patent sequence entries, part 84.
2360. gbpat85.seq - Patent sequence entries, part 85.
2361. gbpat86.seq - Patent sequence entries, part 86.
2362. gbpat87.seq - Patent sequence entries, part 87.
2363. gbpat88.seq - Patent sequence entries, part 88.
2364. gbpat89.seq - Patent sequence entries, part 89.
2365. gbpat9.seq - Patent sequence entries, part 9.
2366. gbpat90.seq - Patent sequence entries, part 90.
2367. gbpat91.seq - Patent sequence entries, part 91.
2368. gbpat92.seq - Patent sequence entries, part 92.
2369. gbpat93.seq - Patent sequence entries, part 93.
2370. gbpat94.seq - Patent sequence entries, part 94.
2371. gbpat95.seq - Patent sequence entries, part 95.
2372. gbpat96.seq - Patent sequence entries, part 96.
2373. gbpat97.seq - Patent sequence entries, part 97.
2374. gbpat98.seq - Patent sequence entries, part 98.
2375. gbpat99.seq - Patent sequence entries, part 99.
2376. gbphg1.seq - Phage sequence entries, part 1.
2377. gbphg2.seq - Phage sequence entries, part 2.
2378. gbphg3.seq - Phage sequence entries, part 3.
2379. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2380. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2381. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2382. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
2383. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
2384. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
2385. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
2386. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
2387. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
2388. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
2389. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
2390. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
2391. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
2392. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2393. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
2394. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
2395. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
2396. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
2397. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
2398. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
2399. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
2400. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
2401. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
2402. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
2403. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2404. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
2405. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
2406. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
2407. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
2408. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
2409. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
2410. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
2411. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
2412. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
2413. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
2414. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2415. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
2416. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
2417. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
2418. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
2419. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
2420. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
2421. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
2422. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
2423. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
2424. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
2425. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2426. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
2427. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
2428. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
2429. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
2430. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
2431. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
2432. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
2433. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
2434. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
2435. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
2436. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2437. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
2438. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
2439. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
2440. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
2441. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
2442. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
2443. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
2444. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
2445. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
2446. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
2447. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2448. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
2449. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
2450. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
2451. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
2452. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
2453. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
2454. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
2455. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
2456. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
2457. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
2458. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2459. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
2460. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
2461. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
2462. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
2463. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
2464. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
2465. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
2466. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
2467. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
2468. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
2469. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2470. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
2471. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
2472. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
2473. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
2474. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
2475. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
2476. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
2477. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
2478. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
2479. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
2480. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2481. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
2482. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
2483. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
2484. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
2485. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
2486. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
2487. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
2488. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
2489. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
2490. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
2491. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2492. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2493. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
2494. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
2495. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
2496. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
2497. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
2498. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
2499. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
2500. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
2501. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
2502. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
2503. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2504. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
2505. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
2506. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
2507. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
2508. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
2509. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
2510. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
2511. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
2512. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
2513. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
2514. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2515. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
2516. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
2517. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
2518. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
2519. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
2520. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
2521. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
2522. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
2523. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
2524. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
2525. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2526. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
2527. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
2528. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
2529. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
2530. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
2531. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
2532. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
2533. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
2534. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
2535. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
2536. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2537. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
2538. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
2539. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
2540. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
2541. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
2542. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
2543. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
2544. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
2545. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
2546. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
2547. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2548. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
2549. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
2550. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
2551. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
2552. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
2553. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
2554. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
2555. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
2556. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
2557. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
2558. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2559. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
2560. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
2561. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
2562. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
2563. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
2564. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
2565. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
2566. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
2567. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
2568. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
2569. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2570. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
2571. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
2572. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
2573. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
2574. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
2575. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
2576. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
2577. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
2578. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
2579. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
2580. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2581. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
2582. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
2583. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
2584. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
2585. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
2586. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
2587. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
2588. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
2589. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
2590. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
2591. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2592. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
2593. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
2594. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
2595. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
2596. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
2597. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
2598. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
2599. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
2600. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
2601. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
2602. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2603. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2604. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
2605. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
2606. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
2607. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
2608. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
2609. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
2610. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
2611. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
2612. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
2613. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
2614. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2615. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
2616. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
2617. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
2618. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
2619. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
2620. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
2621. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
2622. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
2623. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
2624. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
2625. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2626. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
2627. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
2628. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
2629. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
2630. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
2631. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
2632. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
2633. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
2634. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
2635. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
2636. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2637. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
2638. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
2639. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
2640. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
2641. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
2642. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
2643. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
2644. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
2645. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
2646. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
2647. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2648. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
2649. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
2650. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
2651. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
2652. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
2653. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
2654. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
2655. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
2656. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
2657. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
2658. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2659. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
2660. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
2661. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
2662. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
2663. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
2664. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
2665. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
2666. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
2667. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
2668. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
2669. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2670. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
2671. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
2672. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
2673. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
2674. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
2675. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
2676. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
2677. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
2678. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
2679. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
2680. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2681. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
2682. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
2683. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
2684. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
2685. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
2686. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
2687. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
2688. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
2689. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
2690. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
2691. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2692. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
2693. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
2694. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
2695. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
2696. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
2697. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
2698. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
2699. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
2700. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
2701. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
2702. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2703. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
2704. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
2705. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
2706. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
2707. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
2708. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
2709. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
2710. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
2711. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
2712. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
2713. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2714. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2715. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
2716. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
2717. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
2718. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
2719. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
2720. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
2721. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
2722. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
2723. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
2724. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
2725. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2726. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
2727. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
2728. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
2729. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
2730. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
2731. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
2732. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
2733. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
2734. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
2735. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
2736. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2737. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
2738. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
2739. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
2740. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
2741. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
2742. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
2743. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
2744. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
2745. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
2746. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
2747. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2748. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
2749. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
2750. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
2751. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
2752. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
2753. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
2754. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
2755. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
2756. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
2757. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
2758. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2759. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
2760. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
2761. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
2762. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
2763. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
2764. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
2765. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
2766. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
2767. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
2768. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
2769. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2770. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
2771. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
2772. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
2773. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
2774. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
2775. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
2776. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
2777. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
2778. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
2779. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
2780. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2781. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
2782. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
2783. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
2784. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
2785. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
2786. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
2787. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
2788. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
2789. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
2790. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
2791. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2792. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
2793. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
2794. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
2795. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
2796. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
2797. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
2798. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
2799. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
2800. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
2801. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
2802. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2803. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
2804. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
2805. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
2806. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
2807. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
2808. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
2809. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
2810. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
2811. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
2812. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
2813. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2814. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
2815. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
2816. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
2817. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
2818. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
2819. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
2820. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
2821. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
2822. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
2823. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
2824. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2825. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2826. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
2827. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
2828. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
2829. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
2830. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
2831. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
2832. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
2833. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
2834. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
2835. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
2836. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2837. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
2838. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
2839. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
2840. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
2841. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
2842. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
2843. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
2844. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
2845. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
2846. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
2847. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2848. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
2849. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
2850. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
2851. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
2852. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
2853. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
2854. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
2855. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
2856. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
2857. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
2858. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2859. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
2860. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
2861. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
2862. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
2863. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
2864. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
2865. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
2866. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
2867. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
2868. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
2869. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2870. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
2871. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
2872. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
2873. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
2874. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
2875. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
2876. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
2877. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
2878. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
2879. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
2880. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2881. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
2882. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
2883. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
2884. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
2885. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
2886. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
2887. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
2888. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
2889. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
2890. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
2891. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2892. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
2893. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
2894. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
2895. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
2896. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
2897. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
2898. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
2899. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
2900. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
2901. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
2902. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2903. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
2904. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
2905. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
2906. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
2907. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
2908. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
2909. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
2910. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
2911. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
2912. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
2913. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2914. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
2915. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
2916. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
2917. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
2918. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
2919. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
2920. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
2921. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
2922. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
2923. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
2924. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2925. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
2926. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
2927. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
2928. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
2929. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
2930. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
2931. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
2932. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
2933. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
2934. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
2935. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2936. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2937. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
2938. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
2939. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
2940. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
2941. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
2942. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
2943. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
2944. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
2945. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
2946. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
2947. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2948. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
2949. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
2950. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
2951. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
2952. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
2953. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
2954. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
2955. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
2956. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
2957. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
2958. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2959. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
2960. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
2961. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
2962. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
2963. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
2964. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
2965. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
2966. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
2967. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
2968. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
2969. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2970. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
2971. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
2972. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
2973. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
2974. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
2975. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
2976. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
2977. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
2978. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
2979. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
2980. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2981. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
2982. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
2983. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
2984. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
2985. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
2986. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
2987. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
2988. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
2989. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
2990. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
2991. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2992. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
2993. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
2994. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
2995. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
2996. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
2997. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
2998. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
2999. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
3000. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
3001. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
3002. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
3003. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
3004. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
3005. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
3006. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
3007. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
3008. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
3009. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
3010. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
3011. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
3012. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
3013. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
3014. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
3015. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
3016. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
3017. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
3018. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
3019. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
3020. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
3021. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
3022. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
3023. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
3024. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
3025. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
3026. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
3027. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
3028. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
3029. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
3030. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
3031. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
3032. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
3033. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
3034. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
3035. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
3036. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
3037. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
3038. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
3039. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
3040. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
3041. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
3042. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
3043. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
3044. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
3045. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
3046. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
3047. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
3048. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
3049. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
3050. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
3051. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
3052. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
3053. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
3054. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
3055. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
3056. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
3057. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
3058. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
3059. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
3060. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
3061. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
3062. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
3063. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
3064. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
3065. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
3066. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
3067. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
3068. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
3069. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
3070. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
3071. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
3072. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
3073. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
3074. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
3075. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
3076. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
3077. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
3078. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
3079. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
3080. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
3081. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
3082. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
3083. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
3084. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
3085. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
3086. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
3087. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
3088. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
3089. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
3090. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
3091. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
3092. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
3093. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
3094. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
3095. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
3096. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
3097. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
3098. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
3099. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
3100. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
3101. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
3102. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
3103. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
3104. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
3105. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
3106. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
3107. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
3108. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
3109. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
3110. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
3111. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
3112. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
3113. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
3114. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
3115. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661.
3116. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
3117. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
3118. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
3119. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
3120. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
3121. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
3122. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
3123. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
3124. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
3125. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
3126. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
3127. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
3128. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
3129. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
3130. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
3131. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
3132. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
3133. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
3134. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
3135. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
3136. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
3137. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
3138. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
3139. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
3140. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
3141. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
3142. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
3143. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
3144. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
3145. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
3146. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
3147. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
3148. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
3149. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
3150. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
3151. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
3152. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
3153. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
3154. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
3155. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
3156. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
3157. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
3158. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
3159. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
3160. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
3161. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
3162. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
3163. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
3164. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
3165. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
3166. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
3167. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
3168. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
3169. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
3170. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
3171. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
3172. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
3173. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
3174. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
3175. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
3176. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
3177. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
3178. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
3179. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
3180. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
3181. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
3182. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
3183. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
3184. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
3185. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
3186. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
3187. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
3188. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
3189. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
3190. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
3191. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
3192. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
3193. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
3194. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
3195. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
3196. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
3197. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
3198. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
3199. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
3200. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
3201. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
3202. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
3203. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
3204. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
3205. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
3206. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
3207. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
3208. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
3209. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
3210. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
3211. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
3212. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
3213. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
3214. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
3215. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
3216. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
3217. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
3218. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
3219. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
3220. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
3221. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
3222. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
3223. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
3224. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
3225. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
3226. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
3227. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
3228. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
3229. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
3230. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
3231. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
3232. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
3233. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
3234. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
3235. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
3236. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
3237. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
3238. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
3239. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
3240. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
3241. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
3242. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
3243. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
3244. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
3245. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
3246. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
3247. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
3248. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
3249. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
3250. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
3251. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
3252. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
3253. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
3254. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
3255. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
3256. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
3257. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
3258. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
3259. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
3260. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
3261. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
3262. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
3263. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
3264. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
3265. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
3266. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
3267. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3268. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3269. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3270. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3271. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3272. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3273. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3274. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3275. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3276. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3277. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3278. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3279. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3280. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3281. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3282. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3283. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3284. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3285. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3286. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3287. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3288. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3289. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3290. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3291. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3292. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3293. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3294. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3295. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3296. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3297. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3298. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3299. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3300. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3301. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3302. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3303. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3304. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3305. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3306. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3307. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3308. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3309. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3310. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3311. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3312. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3313. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3314. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3315. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3316. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3317. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3318. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3319. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3320. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3321. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3322. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3323. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3324. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3325. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3326. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3327. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3328. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3329. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3330. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3331. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3332. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3333. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3334. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3335. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3336. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3337. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3338. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3339. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3340. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3341. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3342. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3343. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3344. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3345. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3346. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3347. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3348. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3349. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3350. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3351. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3352. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3353. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3354. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3355. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3356. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3357. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3358. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3359. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3360. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3361. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3362. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3363. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3364. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3365. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3366. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3367. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3368. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3369. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3370. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3371. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3372. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3373. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3374. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3375. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3376. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3377. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3378. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3379. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3380. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3381. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3382. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3383. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3384. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3385. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3386. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3387. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3388. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3389. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3390. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3391. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3392. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3393. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3394. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3395. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3396. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3397. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3398. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3399. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3400. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3401. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3402. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3403. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3404. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3405. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3406. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3407. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3408. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3409. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3410. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3411. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3412. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3413. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3414. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3415. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3416. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3417. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3418. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3419. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3420. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3421. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3422. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3423. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3424. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3425. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3426. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3427. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3428. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3429. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3430. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3431. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3432. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3433. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3434. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3435. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3436. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3437. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3438. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3439. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3440. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3441. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3442. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3443. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3444. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3445. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3446. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3447. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3448. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3449. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3450. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3451. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3452. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3453. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3454. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3455. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3456. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3457. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3458. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3459. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3460. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3461. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3462. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3463. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3464. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3465. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3466. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3467. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3468. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3469. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3470. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3471. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3472. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3473. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3474. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3475. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3476. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3477. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3478. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3479. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3480. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3481. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3482. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3483. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3484. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3485. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3486. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3487. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3488. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3489. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3490. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3491. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3492. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3493. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3494. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3495. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3496. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3497. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3498. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3499. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3500. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3501. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3502. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3503. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3504. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3505. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3506. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3507. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3508. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3509. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3510. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3511. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3512. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3513. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3514. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3515. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3516. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3517. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3518. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3519. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3520. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3521. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3522. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3523. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3524. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3525. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3526. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3527. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3528. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3529. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3530. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3531. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3532. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3533. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3534. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3535. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3536. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3537. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3538. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3539. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3540. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3541. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3542. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3543. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3544. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3545. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3546. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3547. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3548. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3549. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3550. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3551. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3552. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3553. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3554. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3555. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3556. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3557. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3558. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3559. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3560. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3561. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3562. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3563. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3564. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3565. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3566. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3567. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3568. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3569. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3570. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3571. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3572. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3573. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3574. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3575. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3576. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3577. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3578. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3579. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3580. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3581. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3582. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3583. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3584. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3585. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3586. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3587. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3588. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3589. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3590. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3591. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3592. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3593. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3594. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3595. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3596. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3597. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3598. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3599. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3600. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3601. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3602. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3603. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3604. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3605. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3606. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3607. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3608. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3609. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3610. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3611. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3612. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3613. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3614. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3615. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3616. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3617. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3618. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3619. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3620. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3621. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3622. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3623. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3624. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3625. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3626. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3627. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3628. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3629. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3630. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3631. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3632. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3633. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3634. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3635. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3636. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3637. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3638. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3639. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3640. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3641. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3642. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3643. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3644. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3645. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3646. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3647. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3648. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3649. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3650. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3651. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3652. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3653. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3654. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3655. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3656. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3657. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3658. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3659. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3660. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3661. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3662. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3663. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3664. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3665. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3666. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3667. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3668. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3669. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3670. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3671. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3672. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3673. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3674. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3675. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3676. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3677. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3678. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3679. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3680. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3681. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3682. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3683. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3684. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3685. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3686. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3687. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3688. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3689. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3690. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3691. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3692. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3693. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3694. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3695. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3696. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3697. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3698. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3699. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3700. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3701. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3702. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3703. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3704. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3705. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3706. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3707. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3708. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3709. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3710. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3711. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3712. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3713. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3714. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3715. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3716. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3717. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3718. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3719. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3720. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3721. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3722. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3723. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3724. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3725. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3726. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3727. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3728. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3729. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3730. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3731. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3732. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3733. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3734. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3735. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3736. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3737. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3738. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3739. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3740. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
3741. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3742. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
3743. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
3744. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
3745. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
3746. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
3747. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
3748. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
3749. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
3750. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
3751. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
3752. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3753. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
3754. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
3755. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
3756. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
3757. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
3758. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
3759. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
3760. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
3761. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
3762. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
3763. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3764. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
3765. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
3766. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
3767. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
3768. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
3769. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
3770. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
3771. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
3772. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
3773. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
3774. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3775. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
3776. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
3777. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
3778. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
3779. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
3780. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
3781. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
3782. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
3783. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
3784. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
3785. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3786. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
3787. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
3788. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
3789. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
3790. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
3791. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
3792. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
3793. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
3794. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
3795. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
3796. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3797. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
3798. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
3799. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
3800. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
3801. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
3802. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
3803. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
3804. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
3805. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
3806. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
3807. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3808. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
3809. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
3810. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
3811. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
3812. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
3813. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
3814. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
3815. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
3816. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
3817. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
3818. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3819. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3820. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
3821. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
3822. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
3823. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
3824. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
3825. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
3826. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
3827. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
3828. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
3829. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
3830. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3831. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
3832. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
3833. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
3834. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
3835. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
3836. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
3837. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
3838. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
3839. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
3840. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
3841. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3842. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
3843. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
3844. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
3845. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
3846. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
3847. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
3848. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
3849. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
3850. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
3851. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
3852. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3853. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
3854. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
3855. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
3856. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
3857. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
3858. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
3859. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
3860. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
3861. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
3862. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
3863. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3864. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
3865. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
3866. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
3867. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
3868. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
3869. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
3870. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
3871. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
3872. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
3873. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
3874. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3875. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
3876. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
3877. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
3878. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
3879. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
3880. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
3881. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
3882. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
3883. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
3884. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
3885. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3886. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
3887. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
3888. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
3889. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
3890. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
3891. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
3892. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
3893. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
3894. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
3895. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
3896. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3897. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
3898. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
3899. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
3900. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
3901. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
3902. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
3903. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
3904. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
3905. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
3906. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
3907. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3908. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
3909. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
3910. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
3911. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
3912. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
3913. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
3914. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
3915. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
3916. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
3917. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
3918. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3919. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
3920. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
3921. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
3922. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
3923. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
3924. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
3925. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
3926. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
3927. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
3928. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
3929. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3930. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3931. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
3932. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
3933. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
3934. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
3935. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
3936. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
3937. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
3938. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
3939. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
3940. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
3941. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3942. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
3943. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
3944. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
3945. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
3946. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
3947. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
3948. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
3949. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
3950. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
3951. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
3952. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3953. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
3954. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
3955. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
3956. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
3957. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
3958. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
3959. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
3960. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
3961. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
3962. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
3963. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3964. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
3965. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
3966. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
3967. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
3968. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
3969. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
3970. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
3971. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
3972. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
3973. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
3974. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3975. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
3976. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
3977. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
3978. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
3979. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
3980. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
3981. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
3982. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
3983. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
3984. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
3985. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3986. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
3987. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
3988. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
3989. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
3990. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
3991. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
3992. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
3993. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
3994. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
3995. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
3996. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3997. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
3998. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
3999. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
4000. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
4001. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
4002. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
4003. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
4004. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
4005. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
4006. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
4007. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
4008. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
4009. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
4010. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
4011. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
4012. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
4013. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
4014. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
4015. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
4016. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
4017. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
4018. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
4019. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
4020. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
4021. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
4022. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
4023. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
4024. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
4025. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
4026. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
4027. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
4028. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
4029. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
4030. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
4031. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
4032. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
4033. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
4034. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
4035. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
4036. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
4037. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
4038. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
4039. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
4040. gbpri1.seq - Primate sequence entries, part 1.
4041. gbpri10.seq - Primate sequence entries, part 10.
4042. gbpri11.seq - Primate sequence entries, part 11.
4043. gbpri12.seq - Primate sequence entries, part 12.
4044. gbpri13.seq - Primate sequence entries, part 13.
4045. gbpri14.seq - Primate sequence entries, part 14.
4046. gbpri15.seq - Primate sequence entries, part 15.
4047. gbpri16.seq - Primate sequence entries, part 16.
4048. gbpri17.seq - Primate sequence entries, part 17.
4049. gbpri18.seq - Primate sequence entries, part 18.
4050. gbpri19.seq - Primate sequence entries, part 19.
4051. gbpri2.seq - Primate sequence entries, part 2.
4052. gbpri20.seq - Primate sequence entries, part 20.
4053. gbpri21.seq - Primate sequence entries, part 21.
4054. gbpri22.seq - Primate sequence entries, part 22.
4055. gbpri23.seq - Primate sequence entries, part 23.
4056. gbpri24.seq - Primate sequence entries, part 24.
4057. gbpri25.seq - Primate sequence entries, part 25.
4058. gbpri26.seq - Primate sequence entries, part 26.
4059. gbpri27.seq - Primate sequence entries, part 27.
4060. gbpri28.seq - Primate sequence entries, part 28.
4061. gbpri29.seq - Primate sequence entries, part 29.
4062. gbpri3.seq - Primate sequence entries, part 3.
4063. gbpri30.seq - Primate sequence entries, part 30.
4064. gbpri31.seq - Primate sequence entries, part 31.
4065. gbpri32.seq - Primate sequence entries, part 32.
4066. gbpri33.seq - Primate sequence entries, part 33.
4067. gbpri34.seq - Primate sequence entries, part 34.
4068. gbpri35.seq - Primate sequence entries, part 35.
4069. gbpri4.seq - Primate sequence entries, part 4.
4070. gbpri5.seq - Primate sequence entries, part 5.
4071. gbpri6.seq - Primate sequence entries, part 6.
4072. gbpri7.seq - Primate sequence entries, part 7.
4073. gbpri8.seq - Primate sequence entries, part 8.
4074. gbpri9.seq - Primate sequence entries, part 9.
4075. gbrel.txt - Release notes (this document).
4076. gbrod1.seq - Rodent sequence entries, part 1.
4077. gbrod10.seq - Rodent sequence entries, part 10.
4078. gbrod100.seq - Rodent sequence entries, part 100.
4079. gbrod101.seq - Rodent sequence entries, part 101.
4080. gbrod102.seq - Rodent sequence entries, part 102.
4081. gbrod103.seq - Rodent sequence entries, part 103.
4082. gbrod104.seq - Rodent sequence entries, part 104.
4083. gbrod105.seq - Rodent sequence entries, part 105.
4084. gbrod106.seq - Rodent sequence entries, part 106.
4085. gbrod107.seq - Rodent sequence entries, part 107.
4086. gbrod108.seq - Rodent sequence entries, part 108.
4087. gbrod109.seq - Rodent sequence entries, part 109.
4088. gbrod11.seq - Rodent sequence entries, part 11.
4089. gbrod110.seq - Rodent sequence entries, part 110.
4090. gbrod111.seq - Rodent sequence entries, part 111.
4091. gbrod112.seq - Rodent sequence entries, part 112.
4092. gbrod113.seq - Rodent sequence entries, part 113.
4093. gbrod114.seq - Rodent sequence entries, part 114.
4094. gbrod115.seq - Rodent sequence entries, part 115.
4095. gbrod116.seq - Rodent sequence entries, part 116.
4096. gbrod117.seq - Rodent sequence entries, part 117.
4097. gbrod118.seq - Rodent sequence entries, part 118.
4098. gbrod119.seq - Rodent sequence entries, part 119.
4099. gbrod12.seq - Rodent sequence entries, part 12.
4100. gbrod120.seq - Rodent sequence entries, part 120.
4101. gbrod13.seq - Rodent sequence entries, part 13.
4102. gbrod14.seq - Rodent sequence entries, part 14.
4103. gbrod15.seq - Rodent sequence entries, part 15.
4104. gbrod16.seq - Rodent sequence entries, part 16.
4105. gbrod17.seq - Rodent sequence entries, part 17.
4106. gbrod18.seq - Rodent sequence entries, part 18.
4107. gbrod19.seq - Rodent sequence entries, part 19.
4108. gbrod2.seq - Rodent sequence entries, part 2.
4109. gbrod20.seq - Rodent sequence entries, part 20.
4110. gbrod21.seq - Rodent sequence entries, part 21.
4111. gbrod22.seq - Rodent sequence entries, part 22.
4112. gbrod23.seq - Rodent sequence entries, part 23.
4113. gbrod24.seq - Rodent sequence entries, part 24.
4114. gbrod25.seq - Rodent sequence entries, part 25.
4115. gbrod26.seq - Rodent sequence entries, part 26.
4116. gbrod27.seq - Rodent sequence entries, part 27.
4117. gbrod28.seq - Rodent sequence entries, part 28.
4118. gbrod29.seq - Rodent sequence entries, part 29.
4119. gbrod3.seq - Rodent sequence entries, part 3.
4120. gbrod30.seq - Rodent sequence entries, part 30.
4121. gbrod31.seq - Rodent sequence entries, part 31.
4122. gbrod32.seq - Rodent sequence entries, part 32.
4123. gbrod33.seq - Rodent sequence entries, part 33.
4124. gbrod34.seq - Rodent sequence entries, part 34.
4125. gbrod35.seq - Rodent sequence entries, part 35.
4126. gbrod36.seq - Rodent sequence entries, part 36.
4127. gbrod37.seq - Rodent sequence entries, part 37.
4128. gbrod38.seq - Rodent sequence entries, part 38.
4129. gbrod39.seq - Rodent sequence entries, part 39.
4130. gbrod4.seq - Rodent sequence entries, part 4.
4131. gbrod40.seq - Rodent sequence entries, part 40.
4132. gbrod41.seq - Rodent sequence entries, part 41.
4133. gbrod42.seq - Rodent sequence entries, part 42.
4134. gbrod43.seq - Rodent sequence entries, part 43.
4135. gbrod44.seq - Rodent sequence entries, part 44.
4136. gbrod45.seq - Rodent sequence entries, part 45.
4137. gbrod46.seq - Rodent sequence entries, part 46.
4138. gbrod47.seq - Rodent sequence entries, part 47.
4139. gbrod48.seq - Rodent sequence entries, part 48.
4140. gbrod49.seq - Rodent sequence entries, part 49.
4141. gbrod5.seq - Rodent sequence entries, part 5.
4142. gbrod50.seq - Rodent sequence entries, part 50.
4143. gbrod51.seq - Rodent sequence entries, part 51.
4144. gbrod52.seq - Rodent sequence entries, part 52.
4145. gbrod53.seq - Rodent sequence entries, part 53.
4146. gbrod54.seq - Rodent sequence entries, part 54.
4147. gbrod55.seq - Rodent sequence entries, part 55.
4148. gbrod56.seq - Rodent sequence entries, part 56.
4149. gbrod57.seq - Rodent sequence entries, part 57.
4150. gbrod58.seq - Rodent sequence entries, part 58.
4151. gbrod59.seq - Rodent sequence entries, part 59.
4152. gbrod6.seq - Rodent sequence entries, part 6.
4153. gbrod60.seq - Rodent sequence entries, part 60.
4154. gbrod61.seq - Rodent sequence entries, part 61.
4155. gbrod62.seq - Rodent sequence entries, part 62.
4156. gbrod63.seq - Rodent sequence entries, part 63.
4157. gbrod64.seq - Rodent sequence entries, part 64.
4158. gbrod65.seq - Rodent sequence entries, part 65.
4159. gbrod66.seq - Rodent sequence entries, part 66.
4160. gbrod67.seq - Rodent sequence entries, part 67.
4161. gbrod68.seq - Rodent sequence entries, part 68.
4162. gbrod69.seq - Rodent sequence entries, part 69.
4163. gbrod7.seq - Rodent sequence entries, part 7.
4164. gbrod70.seq - Rodent sequence entries, part 70.
4165. gbrod71.seq - Rodent sequence entries, part 71.
4166. gbrod72.seq - Rodent sequence entries, part 72.
4167. gbrod73.seq - Rodent sequence entries, part 73.
4168. gbrod74.seq - Rodent sequence entries, part 74.
4169. gbrod75.seq - Rodent sequence entries, part 75.
4170. gbrod76.seq - Rodent sequence entries, part 76.
4171. gbrod77.seq - Rodent sequence entries, part 77.
4172. gbrod78.seq - Rodent sequence entries, part 78.
4173. gbrod79.seq - Rodent sequence entries, part 79.
4174. gbrod8.seq - Rodent sequence entries, part 8.
4175. gbrod80.seq - Rodent sequence entries, part 80.
4176. gbrod81.seq - Rodent sequence entries, part 81.
4177. gbrod82.seq - Rodent sequence entries, part 82.
4178. gbrod83.seq - Rodent sequence entries, part 83.
4179. gbrod84.seq - Rodent sequence entries, part 84.
4180. gbrod85.seq - Rodent sequence entries, part 85.
4181. gbrod86.seq - Rodent sequence entries, part 86.
4182. gbrod87.seq - Rodent sequence entries, part 87.
4183. gbrod88.seq - Rodent sequence entries, part 88.
4184. gbrod89.seq - Rodent sequence entries, part 89.
4185. gbrod9.seq - Rodent sequence entries, part 9.
4186. gbrod90.seq - Rodent sequence entries, part 90.
4187. gbrod91.seq - Rodent sequence entries, part 91.
4188. gbrod92.seq - Rodent sequence entries, part 92.
4189. gbrod93.seq - Rodent sequence entries, part 93.
4190. gbrod94.seq - Rodent sequence entries, part 94.
4191. gbrod95.seq - Rodent sequence entries, part 95.
4192. gbrod96.seq - Rodent sequence entries, part 96.
4193. gbrod97.seq - Rodent sequence entries, part 97.
4194. gbrod98.seq - Rodent sequence entries, part 98.
4195. gbrod99.seq - Rodent sequence entries, part 99.
4196. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
4197. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
4198. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
4199. gbsts4.seq - STS (sequence tagged site) sequence entries, part 4.
4200. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
4201. gbsyn10.seq - Synthetic and chimeric sequence entries, part 10.
4202. gbsyn11.seq - Synthetic and chimeric sequence entries, part 11.
4203. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
4204. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
4205. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
4206. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
4207. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
4208. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
4209. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
4210. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
4211. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
4212. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
4213. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
4214. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
4215. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
4216. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
4217. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
4218. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
4219. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
4220. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
4221. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
4222. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
4223. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
4224. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
4225. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
4226. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
4227. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
4228. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
4229. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
4230. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
4231. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
4232. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
4233. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
4234. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
4235. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
4236. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
4237. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
4238. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
4239. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
4240. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
4241. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
4242. gbtsa38.seq - TSA (transcriptome shotgun assembly) sequence entries, part 38.
4243. gbtsa39.seq - TSA (transcriptome shotgun assembly) sequence entries, part 39.
4244. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
4245. gbtsa40.seq - TSA (transcriptome shotgun assembly) sequence entries, part 40.
4246. gbtsa41.seq - TSA (transcriptome shotgun assembly) sequence entries, part 41.
4247. gbtsa42.seq - TSA (transcriptome shotgun assembly) sequence entries, part 42.
4248. gbtsa43.seq - TSA (transcriptome shotgun assembly) sequence entries, part 43.
4249. gbtsa44.seq - TSA (transcriptome shotgun assembly) sequence entries, part 44.
4250. gbtsa45.seq - TSA (transcriptome shotgun assembly) sequence entries, part 45.
4251. gbtsa46.seq - TSA (transcriptome shotgun assembly) sequence entries, part 46.
4252. gbtsa47.seq - TSA (transcriptome shotgun assembly) sequence entries, part 47.
4253. gbtsa48.seq - TSA (transcriptome shotgun assembly) sequence entries, part 48.
4254. gbtsa49.seq - TSA (transcriptome shotgun assembly) sequence entries, part 49.
4255. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
4256. gbtsa50.seq - TSA (transcriptome shotgun assembly) sequence entries, part 50.
4257. gbtsa51.seq - TSA (transcriptome shotgun assembly) sequence entries, part 51.
4258. gbtsa52.seq - TSA (transcriptome shotgun assembly) sequence entries, part 52.
4259. gbtsa53.seq - TSA (transcriptome shotgun assembly) sequence entries, part 53.
4260. gbtsa54.seq - TSA (transcriptome shotgun assembly) sequence entries, part 54.
4261. gbtsa55.seq - TSA (transcriptome shotgun assembly) sequence entries, part 55.
4262. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
4263. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
4264. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
4265. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
4266. gbuna1.seq - Unannotated sequence entries, part 1.
4267. gbvrl1.seq - Viral sequence entries, part 1.
4268. gbvrl10.seq - Viral sequence entries, part 10.
4269. gbvrl100.seq - Viral sequence entries, part 100.
4270. gbvrl101.seq - Viral sequence entries, part 101.
4271. gbvrl102.seq - Viral sequence entries, part 102.
4272. gbvrl103.seq - Viral sequence entries, part 103.
4273. gbvrl104.seq - Viral sequence entries, part 104.
4274. gbvrl105.seq - Viral sequence entries, part 105.
4275. gbvrl106.seq - Viral sequence entries, part 106.
4276. gbvrl107.seq - Viral sequence entries, part 107.
4277. gbvrl108.seq - Viral sequence entries, part 108.
4278. gbvrl109.seq - Viral sequence entries, part 109.
4279. gbvrl11.seq - Viral sequence entries, part 11.
4280. gbvrl110.seq - Viral sequence entries, part 110.
4281. gbvrl111.seq - Viral sequence entries, part 111.
4282. gbvrl112.seq - Viral sequence entries, part 112.
4283. gbvrl113.seq - Viral sequence entries, part 113.
4284. gbvrl114.seq - Viral sequence entries, part 114.
4285. gbvrl115.seq - Viral sequence entries, part 115.
4286. gbvrl116.seq - Viral sequence entries, part 116.
4287. gbvrl117.seq - Viral sequence entries, part 117.
4288. gbvrl118.seq - Viral sequence entries, part 118.
4289. gbvrl119.seq - Viral sequence entries, part 119.
4290. gbvrl12.seq - Viral sequence entries, part 12.
4291. gbvrl120.seq - Viral sequence entries, part 120.
4292. gbvrl121.seq - Viral sequence entries, part 121.
4293. gbvrl122.seq - Viral sequence entries, part 122.
4294. gbvrl123.seq - Viral sequence entries, part 123.
4295. gbvrl124.seq - Viral sequence entries, part 124.
4296. gbvrl125.seq - Viral sequence entries, part 125.
4297. gbvrl126.seq - Viral sequence entries, part 126.
4298. gbvrl127.seq - Viral sequence entries, part 127.
4299. gbvrl128.seq - Viral sequence entries, part 128.
4300. gbvrl129.seq - Viral sequence entries, part 129.
4301. gbvrl13.seq - Viral sequence entries, part 13.
4302. gbvrl130.seq - Viral sequence entries, part 130.
4303. gbvrl131.seq - Viral sequence entries, part 131.
4304. gbvrl132.seq - Viral sequence entries, part 132.
4305. gbvrl133.seq - Viral sequence entries, part 133.
4306. gbvrl134.seq - Viral sequence entries, part 134.
4307. gbvrl135.seq - Viral sequence entries, part 135.
4308. gbvrl136.seq - Viral sequence entries, part 136.
4309. gbvrl137.seq - Viral sequence entries, part 137.
4310. gbvrl138.seq - Viral sequence entries, part 138.
4311. gbvrl139.seq - Viral sequence entries, part 139.
4312. gbvrl14.seq - Viral sequence entries, part 14.
4313. gbvrl140.seq - Viral sequence entries, part 140.
4314. gbvrl141.seq - Viral sequence entries, part 141.
4315. gbvrl142.seq - Viral sequence entries, part 142.
4316. gbvrl143.seq - Viral sequence entries, part 143.
4317. gbvrl144.seq - Viral sequence entries, part 144.
4318. gbvrl145.seq - Viral sequence entries, part 145.
4319. gbvrl146.seq - Viral sequence entries, part 146.
4320. gbvrl147.seq - Viral sequence entries, part 147.
4321. gbvrl148.seq - Viral sequence entries, part 148.
4322. gbvrl149.seq - Viral sequence entries, part 149.
4323. gbvrl15.seq - Viral sequence entries, part 15.
4324. gbvrl150.seq - Viral sequence entries, part 150.
4325. gbvrl151.seq - Viral sequence entries, part 151.
4326. gbvrl152.seq - Viral sequence entries, part 152.
4327. gbvrl153.seq - Viral sequence entries, part 153.
4328. gbvrl154.seq - Viral sequence entries, part 154.
4329. gbvrl155.seq - Viral sequence entries, part 155.
4330. gbvrl156.seq - Viral sequence entries, part 156.
4331. gbvrl157.seq - Viral sequence entries, part 157.
4332. gbvrl158.seq - Viral sequence entries, part 158.
4333. gbvrl159.seq - Viral sequence entries, part 159.
4334. gbvrl16.seq - Viral sequence entries, part 16.
4335. gbvrl160.seq - Viral sequence entries, part 160.
4336. gbvrl161.seq - Viral sequence entries, part 161.
4337. gbvrl162.seq - Viral sequence entries, part 162.
4338. gbvrl163.seq - Viral sequence entries, part 163.
4339. gbvrl164.seq - Viral sequence entries, part 164.
4340. gbvrl165.seq - Viral sequence entries, part 165.
4341. gbvrl166.seq - Viral sequence entries, part 166.
4342. gbvrl167.seq - Viral sequence entries, part 167.
4343. gbvrl168.seq - Viral sequence entries, part 168.
4344. gbvrl169.seq - Viral sequence entries, part 169.
4345. gbvrl17.seq - Viral sequence entries, part 17.
4346. gbvrl170.seq - Viral sequence entries, part 170.
4347. gbvrl171.seq - Viral sequence entries, part 171.
4348. gbvrl172.seq - Viral sequence entries, part 172.
4349. gbvrl173.seq - Viral sequence entries, part 173.
4350. gbvrl174.seq - Viral sequence entries, part 174.
4351. gbvrl175.seq - Viral sequence entries, part 175.
4352. gbvrl176.seq - Viral sequence entries, part 176.
4353. gbvrl177.seq - Viral sequence entries, part 177.
4354. gbvrl178.seq - Viral sequence entries, part 178.
4355. gbvrl179.seq - Viral sequence entries, part 179.
4356. gbvrl18.seq - Viral sequence entries, part 18.
4357. gbvrl180.seq - Viral sequence entries, part 180.
4358. gbvrl181.seq - Viral sequence entries, part 181.
4359. gbvrl182.seq - Viral sequence entries, part 182.
4360. gbvrl183.seq - Viral sequence entries, part 183.
4361. gbvrl184.seq - Viral sequence entries, part 184.
4362. gbvrl185.seq - Viral sequence entries, part 185.
4363. gbvrl186.seq - Viral sequence entries, part 186.
4364. gbvrl187.seq - Viral sequence entries, part 187.
4365. gbvrl188.seq - Viral sequence entries, part 188.
4366. gbvrl189.seq - Viral sequence entries, part 189.
4367. gbvrl19.seq - Viral sequence entries, part 19.
4368. gbvrl190.seq - Viral sequence entries, part 190.
4369. gbvrl191.seq - Viral sequence entries, part 191.
4370. gbvrl192.seq - Viral sequence entries, part 192.
4371. gbvrl193.seq - Viral sequence entries, part 193.
4372. gbvrl194.seq - Viral sequence entries, part 194.
4373. gbvrl195.seq - Viral sequence entries, part 195.
4374. gbvrl196.seq - Viral sequence entries, part 196.
4375. gbvrl197.seq - Viral sequence entries, part 197.
4376. gbvrl198.seq - Viral sequence entries, part 198.
4377. gbvrl199.seq - Viral sequence entries, part 199.
4378. gbvrl2.seq - Viral sequence entries, part 2.
4379. gbvrl20.seq - Viral sequence entries, part 20.
4380. gbvrl200.seq - Viral sequence entries, part 200.
4381. gbvrl201.seq - Viral sequence entries, part 201.
4382. gbvrl202.seq - Viral sequence entries, part 202.
4383. gbvrl203.seq - Viral sequence entries, part 203.
4384. gbvrl204.seq - Viral sequence entries, part 204.
4385. gbvrl205.seq - Viral sequence entries, part 205.
4386. gbvrl206.seq - Viral sequence entries, part 206.
4387. gbvrl207.seq - Viral sequence entries, part 207.
4388. gbvrl208.seq - Viral sequence entries, part 208.
4389. gbvrl209.seq - Viral sequence entries, part 209.
4390. gbvrl21.seq - Viral sequence entries, part 21.
4391. gbvrl210.seq - Viral sequence entries, part 210.
4392. gbvrl211.seq - Viral sequence entries, part 211.
4393. gbvrl212.seq - Viral sequence entries, part 212.
4394. gbvrl213.seq - Viral sequence entries, part 213.
4395. gbvrl214.seq - Viral sequence entries, part 214.
4396. gbvrl215.seq - Viral sequence entries, part 215.
4397. gbvrl216.seq - Viral sequence entries, part 216.
4398. gbvrl217.seq - Viral sequence entries, part 217.
4399. gbvrl218.seq - Viral sequence entries, part 218.
4400. gbvrl219.seq - Viral sequence entries, part 219.
4401. gbvrl22.seq - Viral sequence entries, part 22.
4402. gbvrl220.seq - Viral sequence entries, part 220.
4403. gbvrl221.seq - Viral sequence entries, part 221.
4404. gbvrl222.seq - Viral sequence entries, part 222.
4405. gbvrl223.seq - Viral sequence entries, part 223.
4406. gbvrl224.seq - Viral sequence entries, part 224.
4407. gbvrl225.seq - Viral sequence entries, part 225.
4408. gbvrl226.seq - Viral sequence entries, part 226.
4409. gbvrl227.seq - Viral sequence entries, part 227.
4410. gbvrl228.seq - Viral sequence entries, part 228.
4411. gbvrl229.seq - Viral sequence entries, part 229.
4412. gbvrl23.seq - Viral sequence entries, part 23.
4413. gbvrl230.seq - Viral sequence entries, part 230.
4414. gbvrl231.seq - Viral sequence entries, part 231.
4415. gbvrl232.seq - Viral sequence entries, part 232.
4416. gbvrl233.seq - Viral sequence entries, part 233.
4417. gbvrl234.seq - Viral sequence entries, part 234.
4418. gbvrl235.seq - Viral sequence entries, part 235.
4419. gbvrl236.seq - Viral sequence entries, part 236.
4420. gbvrl237.seq - Viral sequence entries, part 237.
4421. gbvrl238.seq - Viral sequence entries, part 238.
4422. gbvrl239.seq - Viral sequence entries, part 239.
4423. gbvrl24.seq - Viral sequence entries, part 24.
4424. gbvrl240.seq - Viral sequence entries, part 240.
4425. gbvrl241.seq - Viral sequence entries, part 241.
4426. gbvrl242.seq - Viral sequence entries, part 242.
4427. gbvrl243.seq - Viral sequence entries, part 243.
4428. gbvrl244.seq - Viral sequence entries, part 244.
4429. gbvrl245.seq - Viral sequence entries, part 245.
4430. gbvrl246.seq - Viral sequence entries, part 246.
4431. gbvrl247.seq - Viral sequence entries, part 247.
4432. gbvrl248.seq - Viral sequence entries, part 248.
4433. gbvrl249.seq - Viral sequence entries, part 249.
4434. gbvrl25.seq - Viral sequence entries, part 25.
4435. gbvrl250.seq - Viral sequence entries, part 250.
4436. gbvrl251.seq - Viral sequence entries, part 251.
4437. gbvrl252.seq - Viral sequence entries, part 252.
4438. gbvrl253.seq - Viral sequence entries, part 253.
4439. gbvrl254.seq - Viral sequence entries, part 254.
4440. gbvrl255.seq - Viral sequence entries, part 255.
4441. gbvrl256.seq - Viral sequence entries, part 256.
4442. gbvrl257.seq - Viral sequence entries, part 257.
4443. gbvrl258.seq - Viral sequence entries, part 258.
4444. gbvrl259.seq - Viral sequence entries, part 259.
4445. gbvrl26.seq - Viral sequence entries, part 26.
4446. gbvrl260.seq - Viral sequence entries, part 260.
4447. gbvrl261.seq - Viral sequence entries, part 261.
4448. gbvrl262.seq - Viral sequence entries, part 262.
4449. gbvrl263.seq - Viral sequence entries, part 263.
4450. gbvrl264.seq - Viral sequence entries, part 264.
4451. gbvrl265.seq - Viral sequence entries, part 265.
4452. gbvrl266.seq - Viral sequence entries, part 266.
4453. gbvrl267.seq - Viral sequence entries, part 267.
4454. gbvrl268.seq - Viral sequence entries, part 268.
4455. gbvrl269.seq - Viral sequence entries, part 269.
4456. gbvrl27.seq - Viral sequence entries, part 27.
4457. gbvrl270.seq - Viral sequence entries, part 270.
4458. gbvrl271.seq - Viral sequence entries, part 271.
4459. gbvrl272.seq - Viral sequence entries, part 272.
4460. gbvrl273.seq - Viral sequence entries, part 273.
4461. gbvrl274.seq - Viral sequence entries, part 274.
4462. gbvrl275.seq - Viral sequence entries, part 275.
4463. gbvrl276.seq - Viral sequence entries, part 276.
4464. gbvrl277.seq - Viral sequence entries, part 277.
4465. gbvrl278.seq - Viral sequence entries, part 278.
4466. gbvrl279.seq - Viral sequence entries, part 279.
4467. gbvrl28.seq - Viral sequence entries, part 28.
4468. gbvrl280.seq - Viral sequence entries, part 280.
4469. gbvrl281.seq - Viral sequence entries, part 281.
4470. gbvrl282.seq - Viral sequence entries, part 282.
4471. gbvrl283.seq - Viral sequence entries, part 283.
4472. gbvrl284.seq - Viral sequence entries, part 284.
4473. gbvrl285.seq - Viral sequence entries, part 285.
4474. gbvrl286.seq - Viral sequence entries, part 286.
4475. gbvrl287.seq - Viral sequence entries, part 287.
4476. gbvrl288.seq - Viral sequence entries, part 288.
4477. gbvrl289.seq - Viral sequence entries, part 289.
4478. gbvrl29.seq - Viral sequence entries, part 29.
4479. gbvrl290.seq - Viral sequence entries, part 290.
4480. gbvrl291.seq - Viral sequence entries, part 291.
4481. gbvrl292.seq - Viral sequence entries, part 292.
4482. gbvrl293.seq - Viral sequence entries, part 293.
4483. gbvrl294.seq - Viral sequence entries, part 294.
4484. gbvrl295.seq - Viral sequence entries, part 295.
4485. gbvrl296.seq - Viral sequence entries, part 296.
4486. gbvrl297.seq - Viral sequence entries, part 297.
4487. gbvrl298.seq - Viral sequence entries, part 298.
4488. gbvrl299.seq - Viral sequence entries, part 299.
4489. gbvrl3.seq - Viral sequence entries, part 3.
4490. gbvrl30.seq - Viral sequence entries, part 30.
4491. gbvrl300.seq - Viral sequence entries, part 300.
4492. gbvrl301.seq - Viral sequence entries, part 301.
4493. gbvrl302.seq - Viral sequence entries, part 302.
4494. gbvrl303.seq - Viral sequence entries, part 303.
4495. gbvrl304.seq - Viral sequence entries, part 304.
4496. gbvrl305.seq - Viral sequence entries, part 305.
4497. gbvrl306.seq - Viral sequence entries, part 306.
4498. gbvrl307.seq - Viral sequence entries, part 307.
4499. gbvrl308.seq - Viral sequence entries, part 308.
4500. gbvrl309.seq - Viral sequence entries, part 309.
4501. gbvrl31.seq - Viral sequence entries, part 31.
4502. gbvrl310.seq - Viral sequence entries, part 310.
4503. gbvrl311.seq - Viral sequence entries, part 311.
4504. gbvrl312.seq - Viral sequence entries, part 312.
4505. gbvrl313.seq - Viral sequence entries, part 313.
4506. gbvrl314.seq - Viral sequence entries, part 314.
4507. gbvrl315.seq - Viral sequence entries, part 315.
4508. gbvrl316.seq - Viral sequence entries, part 316.
4509. gbvrl317.seq - Viral sequence entries, part 317.
4510. gbvrl318.seq - Viral sequence entries, part 318.
4511. gbvrl319.seq - Viral sequence entries, part 319.
4512. gbvrl32.seq - Viral sequence entries, part 32.
4513. gbvrl320.seq - Viral sequence entries, part 320.
4514. gbvrl321.seq - Viral sequence entries, part 321.
4515. gbvrl322.seq - Viral sequence entries, part 322.
4516. gbvrl323.seq - Viral sequence entries, part 323.
4517. gbvrl324.seq - Viral sequence entries, part 324.
4518. gbvrl325.seq - Viral sequence entries, part 325.
4519. gbvrl326.seq - Viral sequence entries, part 326.
4520. gbvrl327.seq - Viral sequence entries, part 327.
4521. gbvrl328.seq - Viral sequence entries, part 328.
4522. gbvrl329.seq - Viral sequence entries, part 329.
4523. gbvrl33.seq - Viral sequence entries, part 33.
4524. gbvrl330.seq - Viral sequence entries, part 330.
4525. gbvrl331.seq - Viral sequence entries, part 331.
4526. gbvrl332.seq - Viral sequence entries, part 332.
4527. gbvrl333.seq - Viral sequence entries, part 333.
4528. gbvrl334.seq - Viral sequence entries, part 334.
4529. gbvrl335.seq - Viral sequence entries, part 335.
4530. gbvrl336.seq - Viral sequence entries, part 336.
4531. gbvrl337.seq - Viral sequence entries, part 337.
4532. gbvrl338.seq - Viral sequence entries, part 338.
4533. gbvrl339.seq - Viral sequence entries, part 339.
4534. gbvrl34.seq - Viral sequence entries, part 34.
4535. gbvrl340.seq - Viral sequence entries, part 340.
4536. gbvrl341.seq - Viral sequence entries, part 341.
4537. gbvrl342.seq - Viral sequence entries, part 342.
4538. gbvrl343.seq - Viral sequence entries, part 343.
4539. gbvrl344.seq - Viral sequence entries, part 344.
4540. gbvrl345.seq - Viral sequence entries, part 345.
4541. gbvrl346.seq - Viral sequence entries, part 346.
4542. gbvrl347.seq - Viral sequence entries, part 347.
4543. gbvrl348.seq - Viral sequence entries, part 348.
4544. gbvrl349.seq - Viral sequence entries, part 349.
4545. gbvrl35.seq - Viral sequence entries, part 35.
4546. gbvrl350.seq - Viral sequence entries, part 350.
4547. gbvrl351.seq - Viral sequence entries, part 351.
4548. gbvrl352.seq - Viral sequence entries, part 352.
4549. gbvrl353.seq - Viral sequence entries, part 353.
4550. gbvrl354.seq - Viral sequence entries, part 354.
4551. gbvrl355.seq - Viral sequence entries, part 355.
4552. gbvrl356.seq - Viral sequence entries, part 356.
4553. gbvrl357.seq - Viral sequence entries, part 357.
4554. gbvrl358.seq - Viral sequence entries, part 358.
4555. gbvrl359.seq - Viral sequence entries, part 359.
4556. gbvrl36.seq - Viral sequence entries, part 36.
4557. gbvrl360.seq - Viral sequence entries, part 360.
4558. gbvrl361.seq - Viral sequence entries, part 361.
4559. gbvrl362.seq - Viral sequence entries, part 362.
4560. gbvrl363.seq - Viral sequence entries, part 363.
4561. gbvrl364.seq - Viral sequence entries, part 364.
4562. gbvrl365.seq - Viral sequence entries, part 365.
4563. gbvrl366.seq - Viral sequence entries, part 366.
4564. gbvrl367.seq - Viral sequence entries, part 367.
4565. gbvrl368.seq - Viral sequence entries, part 368.
4566. gbvrl369.seq - Viral sequence entries, part 369.
4567. gbvrl37.seq - Viral sequence entries, part 37.
4568. gbvrl370.seq - Viral sequence entries, part 370.
4569. gbvrl371.seq - Viral sequence entries, part 371.
4570. gbvrl372.seq - Viral sequence entries, part 372.
4571. gbvrl373.seq - Viral sequence entries, part 373.
4572. gbvrl374.seq - Viral sequence entries, part 374.
4573. gbvrl375.seq - Viral sequence entries, part 375.
4574. gbvrl376.seq - Viral sequence entries, part 376.
4575. gbvrl377.seq - Viral sequence entries, part 377.
4576. gbvrl378.seq - Viral sequence entries, part 378.
4577. gbvrl379.seq - Viral sequence entries, part 379.
4578. gbvrl38.seq - Viral sequence entries, part 38.
4579. gbvrl380.seq - Viral sequence entries, part 380.
4580. gbvrl381.seq - Viral sequence entries, part 381.
4581. gbvrl382.seq - Viral sequence entries, part 382.
4582. gbvrl383.seq - Viral sequence entries, part 383.
4583. gbvrl384.seq - Viral sequence entries, part 384.
4584. gbvrl385.seq - Viral sequence entries, part 385.
4585. gbvrl386.seq - Viral sequence entries, part 386.
4586. gbvrl387.seq - Viral sequence entries, part 387.
4587. gbvrl388.seq - Viral sequence entries, part 388.
4588. gbvrl389.seq - Viral sequence entries, part 389.
4589. gbvrl39.seq - Viral sequence entries, part 39.
4590. gbvrl390.seq - Viral sequence entries, part 390.
4591. gbvrl391.seq - Viral sequence entries, part 391.
4592. gbvrl392.seq - Viral sequence entries, part 392.
4593. gbvrl393.seq - Viral sequence entries, part 393.
4594. gbvrl394.seq - Viral sequence entries, part 394.
4595. gbvrl395.seq - Viral sequence entries, part 395.
4596. gbvrl396.seq - Viral sequence entries, part 396.
4597. gbvrl397.seq - Viral sequence entries, part 397.
4598. gbvrl398.seq - Viral sequence entries, part 398.
4599. gbvrl399.seq - Viral sequence entries, part 399.
4600. gbvrl4.seq - Viral sequence entries, part 4.
4601. gbvrl40.seq - Viral sequence entries, part 40.
4602. gbvrl400.seq - Viral sequence entries, part 400.
4603. gbvrl401.seq - Viral sequence entries, part 401.
4604. gbvrl402.seq - Viral sequence entries, part 402.
4605. gbvrl403.seq - Viral sequence entries, part 403.
4606. gbvrl404.seq - Viral sequence entries, part 404.
4607. gbvrl405.seq - Viral sequence entries, part 405.
4608. gbvrl406.seq - Viral sequence entries, part 406.
4609. gbvrl407.seq - Viral sequence entries, part 407.
4610. gbvrl408.seq - Viral sequence entries, part 408.
4611. gbvrl409.seq - Viral sequence entries, part 409.
4612. gbvrl41.seq - Viral sequence entries, part 41.
4613. gbvrl410.seq - Viral sequence entries, part 410.
4614. gbvrl411.seq - Viral sequence entries, part 411.
4615. gbvrl412.seq - Viral sequence entries, part 412.
4616. gbvrl413.seq - Viral sequence entries, part 413.
4617. gbvrl414.seq - Viral sequence entries, part 414.
4618. gbvrl415.seq - Viral sequence entries, part 415.
4619. gbvrl416.seq - Viral sequence entries, part 416.
4620. gbvrl417.seq - Viral sequence entries, part 417.
4621. gbvrl418.seq - Viral sequence entries, part 418.
4622. gbvrl419.seq - Viral sequence entries, part 419.
4623. gbvrl42.seq - Viral sequence entries, part 42.
4624. gbvrl420.seq - Viral sequence entries, part 420.
4625. gbvrl421.seq - Viral sequence entries, part 421.
4626. gbvrl422.seq - Viral sequence entries, part 422.
4627. gbvrl423.seq - Viral sequence entries, part 423.
4628. gbvrl424.seq - Viral sequence entries, part 424.
4629. gbvrl425.seq - Viral sequence entries, part 425.
4630. gbvrl426.seq - Viral sequence entries, part 426.
4631. gbvrl427.seq - Viral sequence entries, part 427.
4632. gbvrl428.seq - Viral sequence entries, part 428.
4633. gbvrl429.seq - Viral sequence entries, part 429.
4634. gbvrl43.seq - Viral sequence entries, part 43.
4635. gbvrl430.seq - Viral sequence entries, part 430.
4636. gbvrl431.seq - Viral sequence entries, part 431.
4637. gbvrl432.seq - Viral sequence entries, part 432.
4638. gbvrl433.seq - Viral sequence entries, part 433.
4639. gbvrl434.seq - Viral sequence entries, part 434.
4640. gbvrl435.seq - Viral sequence entries, part 435.
4641. gbvrl436.seq - Viral sequence entries, part 436.
4642. gbvrl437.seq - Viral sequence entries, part 437.
4643. gbvrl438.seq - Viral sequence entries, part 438.
4644. gbvrl439.seq - Viral sequence entries, part 439.
4645. gbvrl44.seq - Viral sequence entries, part 44.
4646. gbvrl440.seq - Viral sequence entries, part 440.
4647. gbvrl441.seq - Viral sequence entries, part 441.
4648. gbvrl442.seq - Viral sequence entries, part 442.
4649. gbvrl443.seq - Viral sequence entries, part 443.
4650. gbvrl444.seq - Viral sequence entries, part 444.
4651. gbvrl445.seq - Viral sequence entries, part 445.
4652. gbvrl446.seq - Viral sequence entries, part 446.
4653. gbvrl447.seq - Viral sequence entries, part 447.
4654. gbvrl448.seq - Viral sequence entries, part 448.
4655. gbvrl449.seq - Viral sequence entries, part 449.
4656. gbvrl45.seq - Viral sequence entries, part 45.
4657. gbvrl450.seq - Viral sequence entries, part 450.
4658. gbvrl451.seq - Viral sequence entries, part 451.
4659. gbvrl452.seq - Viral sequence entries, part 452.
4660. gbvrl453.seq - Viral sequence entries, part 453.
4661. gbvrl454.seq - Viral sequence entries, part 454.
4662. gbvrl455.seq - Viral sequence entries, part 455.
4663. gbvrl456.seq - Viral sequence entries, part 456.
4664. gbvrl457.seq - Viral sequence entries, part 457.
4665. gbvrl458.seq - Viral sequence entries, part 458.
4666. gbvrl459.seq - Viral sequence entries, part 459.
4667. gbvrl46.seq - Viral sequence entries, part 46.
4668. gbvrl460.seq - Viral sequence entries, part 460.
4669. gbvrl461.seq - Viral sequence entries, part 461.
4670. gbvrl462.seq - Viral sequence entries, part 462.
4671. gbvrl463.seq - Viral sequence entries, part 463.
4672. gbvrl464.seq - Viral sequence entries, part 464.
4673. gbvrl465.seq - Viral sequence entries, part 465.
4674. gbvrl466.seq - Viral sequence entries, part 466.
4675. gbvrl467.seq - Viral sequence entries, part 467.
4676. gbvrl468.seq - Viral sequence entries, part 468.
4677. gbvrl469.seq - Viral sequence entries, part 469.
4678. gbvrl47.seq - Viral sequence entries, part 47.
4679. gbvrl470.seq - Viral sequence entries, part 470.
4680. gbvrl471.seq - Viral sequence entries, part 471.
4681. gbvrl472.seq - Viral sequence entries, part 472.
4682. gbvrl473.seq - Viral sequence entries, part 473.
4683. gbvrl474.seq - Viral sequence entries, part 474.
4684. gbvrl475.seq - Viral sequence entries, part 475.
4685. gbvrl476.seq - Viral sequence entries, part 476.
4686. gbvrl477.seq - Viral sequence entries, part 477.
4687. gbvrl478.seq - Viral sequence entries, part 478.
4688. gbvrl479.seq - Viral sequence entries, part 479.
4689. gbvrl48.seq - Viral sequence entries, part 48.
4690. gbvrl480.seq - Viral sequence entries, part 480.
4691. gbvrl481.seq - Viral sequence entries, part 481.
4692. gbvrl482.seq - Viral sequence entries, part 482.
4693. gbvrl483.seq - Viral sequence entries, part 483.
4694. gbvrl484.seq - Viral sequence entries, part 484.
4695. gbvrl485.seq - Viral sequence entries, part 485.
4696. gbvrl486.seq - Viral sequence entries, part 486.
4697. gbvrl487.seq - Viral sequence entries, part 487.
4698. gbvrl488.seq - Viral sequence entries, part 488.
4699. gbvrl489.seq - Viral sequence entries, part 489.
4700. gbvrl49.seq - Viral sequence entries, part 49.
4701. gbvrl490.seq - Viral sequence entries, part 490.
4702. gbvrl491.seq - Viral sequence entries, part 491.
4703. gbvrl492.seq - Viral sequence entries, part 492.
4704. gbvrl493.seq - Viral sequence entries, part 493.
4705. gbvrl494.seq - Viral sequence entries, part 494.
4706. gbvrl495.seq - Viral sequence entries, part 495.
4707. gbvrl496.seq - Viral sequence entries, part 496.
4708. gbvrl497.seq - Viral sequence entries, part 497.
4709. gbvrl498.seq - Viral sequence entries, part 498.
4710. gbvrl499.seq - Viral sequence entries, part 499.
4711. gbvrl5.seq - Viral sequence entries, part 5.
4712. gbvrl50.seq - Viral sequence entries, part 50.
4713. gbvrl500.seq - Viral sequence entries, part 500.
4714. gbvrl51.seq - Viral sequence entries, part 51.
4715. gbvrl52.seq - Viral sequence entries, part 52.
4716. gbvrl53.seq - Viral sequence entries, part 53.
4717. gbvrl54.seq - Viral sequence entries, part 54.
4718. gbvrl55.seq - Viral sequence entries, part 55.
4719. gbvrl56.seq - Viral sequence entries, part 56.
4720. gbvrl57.seq - Viral sequence entries, part 57.
4721. gbvrl58.seq - Viral sequence entries, part 58.
4722. gbvrl59.seq - Viral sequence entries, part 59.
4723. gbvrl6.seq - Viral sequence entries, part 6.
4724. gbvrl60.seq - Viral sequence entries, part 60.
4725. gbvrl61.seq - Viral sequence entries, part 61.
4726. gbvrl62.seq - Viral sequence entries, part 62.
4727. gbvrl63.seq - Viral sequence entries, part 63.
4728. gbvrl64.seq - Viral sequence entries, part 64.
4729. gbvrl65.seq - Viral sequence entries, part 65.
4730. gbvrl66.seq - Viral sequence entries, part 66.
4731. gbvrl67.seq - Viral sequence entries, part 67.
4732. gbvrl68.seq - Viral sequence entries, part 68.
4733. gbvrl69.seq - Viral sequence entries, part 69.
4734. gbvrl7.seq - Viral sequence entries, part 7.
4735. gbvrl70.seq - Viral sequence entries, part 70.
4736. gbvrl71.seq - Viral sequence entries, part 71.
4737. gbvrl72.seq - Viral sequence entries, part 72.
4738. gbvrl73.seq - Viral sequence entries, part 73.
4739. gbvrl74.seq - Viral sequence entries, part 74.
4740. gbvrl75.seq - Viral sequence entries, part 75.
4741. gbvrl76.seq - Viral sequence entries, part 76.
4742. gbvrl77.seq - Viral sequence entries, part 77.
4743. gbvrl78.seq - Viral sequence entries, part 78.
4744. gbvrl79.seq - Viral sequence entries, part 79.
4745. gbvrl8.seq - Viral sequence entries, part 8.
4746. gbvrl80.seq - Viral sequence entries, part 80.
4747. gbvrl81.seq - Viral sequence entries, part 81.
4748. gbvrl82.seq - Viral sequence entries, part 82.
4749. gbvrl83.seq - Viral sequence entries, part 83.
4750. gbvrl84.seq - Viral sequence entries, part 84.
4751. gbvrl85.seq - Viral sequence entries, part 85.
4752. gbvrl86.seq - Viral sequence entries, part 86.
4753. gbvrl87.seq - Viral sequence entries, part 87.
4754. gbvrl88.seq - Viral sequence entries, part 88.
4755. gbvrl89.seq - Viral sequence entries, part 89.
4756. gbvrl9.seq - Viral sequence entries, part 9.
4757. gbvrl90.seq - Viral sequence entries, part 90.
4758. gbvrl91.seq - Viral sequence entries, part 91.
4759. gbvrl92.seq - Viral sequence entries, part 92.
4760. gbvrl93.seq - Viral sequence entries, part 93.
4761. gbvrl94.seq - Viral sequence entries, part 94.
4762. gbvrl95.seq - Viral sequence entries, part 95.
4763. gbvrl96.seq - Viral sequence entries, part 96.
4764. gbvrl97.seq - Viral sequence entries, part 97.
4765. gbvrl98.seq - Viral sequence entries, part 98.
4766. gbvrl99.seq - Viral sequence entries, part 99.
4767. gbvrt1.seq - Other vertebrate sequence entries, part 1.
4768. gbvrt10.seq - Other vertebrate sequence entries, part 10.
4769. gbvrt100.seq - Other vertebrate sequence entries, part 100.
4770. gbvrt101.seq - Other vertebrate sequence entries, part 101.
4771. gbvrt102.seq - Other vertebrate sequence entries, part 102.
4772. gbvrt103.seq - Other vertebrate sequence entries, part 103.
4773. gbvrt104.seq - Other vertebrate sequence entries, part 104.
4774. gbvrt105.seq - Other vertebrate sequence entries, part 105.
4775. gbvrt106.seq - Other vertebrate sequence entries, part 106.
4776. gbvrt107.seq - Other vertebrate sequence entries, part 107.
4777. gbvrt108.seq - Other vertebrate sequence entries, part 108.
4778. gbvrt109.seq - Other vertebrate sequence entries, part 109.
4779. gbvrt11.seq - Other vertebrate sequence entries, part 11.
4780. gbvrt110.seq - Other vertebrate sequence entries, part 110.
4781. gbvrt111.seq - Other vertebrate sequence entries, part 111.
4782. gbvrt112.seq - Other vertebrate sequence entries, part 112.
4783. gbvrt113.seq - Other vertebrate sequence entries, part 113.
4784. gbvrt114.seq - Other vertebrate sequence entries, part 114.
4785. gbvrt115.seq - Other vertebrate sequence entries, part 115.
4786. gbvrt116.seq - Other vertebrate sequence entries, part 116.
4787. gbvrt117.seq - Other vertebrate sequence entries, part 117.
4788. gbvrt118.seq - Other vertebrate sequence entries, part 118.
4789. gbvrt119.seq - Other vertebrate sequence entries, part 119.
4790. gbvrt12.seq - Other vertebrate sequence entries, part 12.
4791. gbvrt120.seq - Other vertebrate sequence entries, part 120.
4792. gbvrt121.seq - Other vertebrate sequence entries, part 121.
4793. gbvrt122.seq - Other vertebrate sequence entries, part 122.
4794. gbvrt123.seq - Other vertebrate sequence entries, part 123.
4795. gbvrt124.seq - Other vertebrate sequence entries, part 124.
4796. gbvrt125.seq - Other vertebrate sequence entries, part 125.
4797. gbvrt126.seq - Other vertebrate sequence entries, part 126.
4798. gbvrt127.seq - Other vertebrate sequence entries, part 127.
4799. gbvrt128.seq - Other vertebrate sequence entries, part 128.
4800. gbvrt129.seq - Other vertebrate sequence entries, part 129.
4801. gbvrt13.seq - Other vertebrate sequence entries, part 13.
4802. gbvrt130.seq - Other vertebrate sequence entries, part 130.
4803. gbvrt131.seq - Other vertebrate sequence entries, part 131.
4804. gbvrt132.seq - Other vertebrate sequence entries, part 132.
4805. gbvrt133.seq - Other vertebrate sequence entries, part 133.
4806. gbvrt134.seq - Other vertebrate sequence entries, part 134.
4807. gbvrt135.seq - Other vertebrate sequence entries, part 135.
4808. gbvrt136.seq - Other vertebrate sequence entries, part 136.
4809. gbvrt137.seq - Other vertebrate sequence entries, part 137.
4810. gbvrt138.seq - Other vertebrate sequence entries, part 138.
4811. gbvrt139.seq - Other vertebrate sequence entries, part 139.
4812. gbvrt14.seq - Other vertebrate sequence entries, part 14.
4813. gbvrt140.seq - Other vertebrate sequence entries, part 140.
4814. gbvrt141.seq - Other vertebrate sequence entries, part 141.
4815. gbvrt142.seq - Other vertebrate sequence entries, part 142.
4816. gbvrt143.seq - Other vertebrate sequence entries, part 143.
4817. gbvrt144.seq - Other vertebrate sequence entries, part 144.
4818. gbvrt145.seq - Other vertebrate sequence entries, part 145.
4819. gbvrt146.seq - Other vertebrate sequence entries, part 146.
4820. gbvrt147.seq - Other vertebrate sequence entries, part 147.
4821. gbvrt148.seq - Other vertebrate sequence entries, part 148.
4822. gbvrt149.seq - Other vertebrate sequence entries, part 149.
4823. gbvrt15.seq - Other vertebrate sequence entries, part 15.
4824. gbvrt150.seq - Other vertebrate sequence entries, part 150.
4825. gbvrt151.seq - Other vertebrate sequence entries, part 151.
4826. gbvrt152.seq - Other vertebrate sequence entries, part 152.
4827. gbvrt153.seq - Other vertebrate sequence entries, part 153.
4828. gbvrt154.seq - Other vertebrate sequence entries, part 154.
4829. gbvrt155.seq - Other vertebrate sequence entries, part 155.
4830. gbvrt156.seq - Other vertebrate sequence entries, part 156.
4831. gbvrt157.seq - Other vertebrate sequence entries, part 157.
4832. gbvrt158.seq - Other vertebrate sequence entries, part 158.
4833. gbvrt159.seq - Other vertebrate sequence entries, part 159.
4834. gbvrt16.seq - Other vertebrate sequence entries, part 16.
4835. gbvrt160.seq - Other vertebrate sequence entries, part 160.
4836. gbvrt161.seq - Other vertebrate sequence entries, part 161.
4837. gbvrt162.seq - Other vertebrate sequence entries, part 162.
4838. gbvrt163.seq - Other vertebrate sequence entries, part 163.
4839. gbvrt164.seq - Other vertebrate sequence entries, part 164.
4840. gbvrt165.seq - Other vertebrate sequence entries, part 165.
4841. gbvrt166.seq - Other vertebrate sequence entries, part 166.
4842. gbvrt167.seq - Other vertebrate sequence entries, part 167.
4843. gbvrt168.seq - Other vertebrate sequence entries, part 168.
4844. gbvrt169.seq - Other vertebrate sequence entries, part 169.
4845. gbvrt17.seq - Other vertebrate sequence entries, part 17.
4846. gbvrt170.seq - Other vertebrate sequence entries, part 170.
4847. gbvrt171.seq - Other vertebrate sequence entries, part 171.
4848. gbvrt172.seq - Other vertebrate sequence entries, part 172.
4849. gbvrt173.seq - Other vertebrate sequence entries, part 173.
4850. gbvrt174.seq - Other vertebrate sequence entries, part 174.
4851. gbvrt175.seq - Other vertebrate sequence entries, part 175.
4852. gbvrt176.seq - Other vertebrate sequence entries, part 176.
4853. gbvrt177.seq - Other vertebrate sequence entries, part 177.
4854. gbvrt178.seq - Other vertebrate sequence entries, part 178.
4855. gbvrt179.seq - Other vertebrate sequence entries, part 179.
4856. gbvrt18.seq - Other vertebrate sequence entries, part 18.
4857. gbvrt180.seq - Other vertebrate sequence entries, part 180.
4858. gbvrt181.seq - Other vertebrate sequence entries, part 181.
4859. gbvrt182.seq - Other vertebrate sequence entries, part 182.
4860. gbvrt183.seq - Other vertebrate sequence entries, part 183.
4861. gbvrt184.seq - Other vertebrate sequence entries, part 184.
4862. gbvrt185.seq - Other vertebrate sequence entries, part 185.
4863. gbvrt186.seq - Other vertebrate sequence entries, part 186.
4864. gbvrt187.seq - Other vertebrate sequence entries, part 187.
4865. gbvrt188.seq - Other vertebrate sequence entries, part 188.
4866. gbvrt189.seq - Other vertebrate sequence entries, part 189.
4867. gbvrt19.seq - Other vertebrate sequence entries, part 19.
4868. gbvrt190.seq - Other vertebrate sequence entries, part 190.
4869. gbvrt191.seq - Other vertebrate sequence entries, part 191.
4870. gbvrt192.seq - Other vertebrate sequence entries, part 192.
4871. gbvrt193.seq - Other vertebrate sequence entries, part 193.
4872. gbvrt194.seq - Other vertebrate sequence entries, part 194.
4873. gbvrt195.seq - Other vertebrate sequence entries, part 195.
4874. gbvrt196.seq - Other vertebrate sequence entries, part 196.
4875. gbvrt197.seq - Other vertebrate sequence entries, part 197.
4876. gbvrt198.seq - Other vertebrate sequence entries, part 198.
4877. gbvrt199.seq - Other vertebrate sequence entries, part 199.
4878. gbvrt2.seq - Other vertebrate sequence entries, part 2.
4879. gbvrt20.seq - Other vertebrate sequence entries, part 20.
4880. gbvrt200.seq - Other vertebrate sequence entries, part 200.
4881. gbvrt201.seq - Other vertebrate sequence entries, part 201.
4882. gbvrt202.seq - Other vertebrate sequence entries, part 202.
4883. gbvrt203.seq - Other vertebrate sequence entries, part 203.
4884. gbvrt204.seq - Other vertebrate sequence entries, part 204.
4885. gbvrt205.seq - Other vertebrate sequence entries, part 205.
4886. gbvrt206.seq - Other vertebrate sequence entries, part 206.
4887. gbvrt207.seq - Other vertebrate sequence entries, part 207.
4888. gbvrt208.seq - Other vertebrate sequence entries, part 208.
4889. gbvrt209.seq - Other vertebrate sequence entries, part 209.
4890. gbvrt21.seq - Other vertebrate sequence entries, part 21.
4891. gbvrt210.seq - Other vertebrate sequence entries, part 210.
4892. gbvrt211.seq - Other vertebrate sequence entries, part 211.
4893. gbvrt212.seq - Other vertebrate sequence entries, part 212.
4894. gbvrt213.seq - Other vertebrate sequence entries, part 213.
4895. gbvrt214.seq - Other vertebrate sequence entries, part 214.
4896. gbvrt215.seq - Other vertebrate sequence entries, part 215.
4897. gbvrt216.seq - Other vertebrate sequence entries, part 216.
4898. gbvrt217.seq - Other vertebrate sequence entries, part 217.
4899. gbvrt218.seq - Other vertebrate sequence entries, part 218.
4900. gbvrt219.seq - Other vertebrate sequence entries, part 219.
4901. gbvrt22.seq - Other vertebrate sequence entries, part 22.
4902. gbvrt220.seq - Other vertebrate sequence entries, part 220.
4903. gbvrt221.seq - Other vertebrate sequence entries, part 221.
4904. gbvrt222.seq - Other vertebrate sequence entries, part 222.
4905. gbvrt223.seq - Other vertebrate sequence entries, part 223.
4906. gbvrt224.seq - Other vertebrate sequence entries, part 224.
4907. gbvrt225.seq - Other vertebrate sequence entries, part 225.
4908. gbvrt226.seq - Other vertebrate sequence entries, part 226.
4909. gbvrt227.seq - Other vertebrate sequence entries, part 227.
4910. gbvrt228.seq - Other vertebrate sequence entries, part 228.
4911. gbvrt229.seq - Other vertebrate sequence entries, part 229.
4912. gbvrt23.seq - Other vertebrate sequence entries, part 23.
4913. gbvrt230.seq - Other vertebrate sequence entries, part 230.
4914. gbvrt231.seq - Other vertebrate sequence entries, part 231.
4915. gbvrt232.seq - Other vertebrate sequence entries, part 232.
4916. gbvrt233.seq - Other vertebrate sequence entries, part 233.
4917. gbvrt234.seq - Other vertebrate sequence entries, part 234.
4918. gbvrt235.seq - Other vertebrate sequence entries, part 235.
4919. gbvrt236.seq - Other vertebrate sequence entries, part 236.
4920. gbvrt237.seq - Other vertebrate sequence entries, part 237.
4921. gbvrt238.seq - Other vertebrate sequence entries, part 238.
4922. gbvrt239.seq - Other vertebrate sequence entries, part 239.
4923. gbvrt24.seq - Other vertebrate sequence entries, part 24.
4924. gbvrt240.seq - Other vertebrate sequence entries, part 240.
4925. gbvrt241.seq - Other vertebrate sequence entries, part 241.
4926. gbvrt242.seq - Other vertebrate sequence entries, part 242.
4927. gbvrt243.seq - Other vertebrate sequence entries, part 243.
4928. gbvrt244.seq - Other vertebrate sequence entries, part 244.
4929. gbvrt245.seq - Other vertebrate sequence entries, part 245.
4930. gbvrt246.seq - Other vertebrate sequence entries, part 246.
4931. gbvrt247.seq - Other vertebrate sequence entries, part 247.
4932. gbvrt248.seq - Other vertebrate sequence entries, part 248.
4933. gbvrt249.seq - Other vertebrate sequence entries, part 249.
4934. gbvrt25.seq - Other vertebrate sequence entries, part 25.
4935. gbvrt250.seq - Other vertebrate sequence entries, part 250.
4936. gbvrt251.seq - Other vertebrate sequence entries, part 251.
4937. gbvrt252.seq - Other vertebrate sequence entries, part 252.
4938. gbvrt253.seq - Other vertebrate sequence entries, part 253.
4939. gbvrt254.seq - Other vertebrate sequence entries, part 254.
4940. gbvrt255.seq - Other vertebrate sequence entries, part 255.
4941. gbvrt256.seq - Other vertebrate sequence entries, part 256.
4942. gbvrt257.seq - Other vertebrate sequence entries, part 257.
4943. gbvrt258.seq - Other vertebrate sequence entries, part 258.
4944. gbvrt259.seq - Other vertebrate sequence entries, part 259.
4945. gbvrt26.seq - Other vertebrate sequence entries, part 26.
4946. gbvrt260.seq - Other vertebrate sequence entries, part 260.
4947. gbvrt261.seq - Other vertebrate sequence entries, part 261.
4948. gbvrt262.seq - Other vertebrate sequence entries, part 262.
4949. gbvrt27.seq - Other vertebrate sequence entries, part 27.
4950. gbvrt28.seq - Other vertebrate sequence entries, part 28.
4951. gbvrt29.seq - Other vertebrate sequence entries, part 29.
4952. gbvrt3.seq - Other vertebrate sequence entries, part 3.
4953. gbvrt30.seq - Other vertebrate sequence entries, part 30.
4954. gbvrt31.seq - Other vertebrate sequence entries, part 31.
4955. gbvrt32.seq - Other vertebrate sequence entries, part 32.
4956. gbvrt33.seq - Other vertebrate sequence entries, part 33.
4957. gbvrt34.seq - Other vertebrate sequence entries, part 34.
4958. gbvrt35.seq - Other vertebrate sequence entries, part 35.
4959. gbvrt36.seq - Other vertebrate sequence entries, part 36.
4960. gbvrt37.seq - Other vertebrate sequence entries, part 37.
4961. gbvrt38.seq - Other vertebrate sequence entries, part 38.
4962. gbvrt39.seq - Other vertebrate sequence entries, part 39.
4963. gbvrt4.seq - Other vertebrate sequence entries, part 4.
4964. gbvrt40.seq - Other vertebrate sequence entries, part 40.
4965. gbvrt41.seq - Other vertebrate sequence entries, part 41.
4966. gbvrt42.seq - Other vertebrate sequence entries, part 42.
4967. gbvrt43.seq - Other vertebrate sequence entries, part 43.
4968. gbvrt44.seq - Other vertebrate sequence entries, part 44.
4969. gbvrt45.seq - Other vertebrate sequence entries, part 45.
4970. gbvrt46.seq - Other vertebrate sequence entries, part 46.
4971. gbvrt47.seq - Other vertebrate sequence entries, part 47.
4972. gbvrt48.seq - Other vertebrate sequence entries, part 48.
4973. gbvrt49.seq - Other vertebrate sequence entries, part 49.
4974. gbvrt5.seq - Other vertebrate sequence entries, part 5.
4975. gbvrt50.seq - Other vertebrate sequence entries, part 50.
4976. gbvrt51.seq - Other vertebrate sequence entries, part 51.
4977. gbvrt52.seq - Other vertebrate sequence entries, part 52.
4978. gbvrt53.seq - Other vertebrate sequence entries, part 53.
4979. gbvrt54.seq - Other vertebrate sequence entries, part 54.
4980. gbvrt55.seq - Other vertebrate sequence entries, part 55.
4981. gbvrt56.seq - Other vertebrate sequence entries, part 56.
4982. gbvrt57.seq - Other vertebrate sequence entries, part 57.
4983. gbvrt58.seq - Other vertebrate sequence entries, part 58.
4984. gbvrt59.seq - Other vertebrate sequence entries, part 59.
4985. gbvrt6.seq - Other vertebrate sequence entries, part 6.
4986. gbvrt60.seq - Other vertebrate sequence entries, part 60.
4987. gbvrt61.seq - Other vertebrate sequence entries, part 61.
4988. gbvrt62.seq - Other vertebrate sequence entries, part 62.
4989. gbvrt63.seq - Other vertebrate sequence entries, part 63.
4990. gbvrt64.seq - Other vertebrate sequence entries, part 64.
4991. gbvrt65.seq - Other vertebrate sequence entries, part 65.
4992. gbvrt66.seq - Other vertebrate sequence entries, part 66.
4993. gbvrt67.seq - Other vertebrate sequence entries, part 67.
4994. gbvrt68.seq - Other vertebrate sequence entries, part 68.
4995. gbvrt69.seq - Other vertebrate sequence entries, part 69.
4996. gbvrt7.seq - Other vertebrate sequence entries, part 7.
4997. gbvrt70.seq - Other vertebrate sequence entries, part 70.
4998. gbvrt71.seq - Other vertebrate sequence entries, part 71.
4999. gbvrt72.seq - Other vertebrate sequence entries, part 72.
5000. gbvrt73.seq - Other vertebrate sequence entries, part 73.
5001. gbvrt74.seq - Other vertebrate sequence entries, part 74.
5002. gbvrt75.seq - Other vertebrate sequence entries, part 75.
5003. gbvrt76.seq - Other vertebrate sequence entries, part 76.
5004. gbvrt77.seq - Other vertebrate sequence entries, part 77.
5005. gbvrt78.seq - Other vertebrate sequence entries, part 78.
5006. gbvrt79.seq - Other vertebrate sequence entries, part 79.
5007. gbvrt8.seq - Other vertebrate sequence entries, part 8.
5008. gbvrt80.seq - Other vertebrate sequence entries, part 80.
5009. gbvrt81.seq - Other vertebrate sequence entries, part 81.
5010. gbvrt82.seq - Other vertebrate sequence entries, part 82.
5011. gbvrt83.seq - Other vertebrate sequence entries, part 83.
5012. gbvrt84.seq - Other vertebrate sequence entries, part 84.
5013. gbvrt85.seq - Other vertebrate sequence entries, part 85.
5014. gbvrt86.seq - Other vertebrate sequence entries, part 86.
5015. gbvrt87.seq - Other vertebrate sequence entries, part 87.
5016. gbvrt88.seq - Other vertebrate sequence entries, part 88.
5017. gbvrt89.seq - Other vertebrate sequence entries, part 89.
5018. gbvrt9.seq - Other vertebrate sequence entries, part 9.
5019. gbvrt90.seq - Other vertebrate sequence entries, part 90.
5020. gbvrt91.seq - Other vertebrate sequence entries, part 91.
5021. gbvrt92.seq - Other vertebrate sequence entries, part 92.
5022. gbvrt93.seq - Other vertebrate sequence entries, part 93.
5023. gbvrt94.seq - Other vertebrate sequence entries, part 94.
5024. gbvrt95.seq - Other vertebrate sequence entries, part 95.
5025. gbvrt96.seq - Other vertebrate sequence entries, part 96.
5026. gbvrt97.seq - Other vertebrate sequence entries, part 97.
5027. gbvrt98.seq - Other vertebrate sequence entries, part 98.
5028. gbvrt99.seq - Other vertebrate sequence entries, part 99.

  Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:

        ftp://ftp.ncbi.nih.gov/genbank/README.genbank

2.2.5 File Sizes

  Uncompressed, the Release 261.0 flatfiles require roughly 5249 GB,
including the sequence files and the *.txt files.

  The following table contains the approximate sizes of the
individual files in this release.  Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.

File Size      File Name

1300177991     gbbct1.seq
1494920342     gbbct10.seq
1498881052     gbbct100.seq
 397935460     gbbct101.seq
1492628274     gbbct102.seq
 372448970     gbbct103.seq
1496847708     gbbct104.seq
 721671623     gbbct105.seq
1498272731     gbbct106.seq
 185848277     gbbct107.seq
1490154918     gbbct108.seq
 678882882     gbbct109.seq
 632787129     gbbct11.seq
1492669401     gbbct110.seq
 625464854     gbbct111.seq
1490523491     gbbct112.seq
 536514463     gbbct113.seq
1491070358     gbbct114.seq
 448505664     gbbct115.seq
1496990297     gbbct116.seq
1125413243     gbbct117.seq
1490530099     gbbct118.seq
 447443024     gbbct119.seq
1491607760     gbbct12.seq
1499536717     gbbct120.seq
 562512248     gbbct121.seq
1497991956     gbbct122.seq
1495060746     gbbct123.seq
 771545814     gbbct124.seq
1484728519     gbbct125.seq
 414251305     gbbct126.seq
1490750476     gbbct127.seq
 468997883     gbbct128.seq
1494405796     gbbct129.seq
1026601278     gbbct13.seq
 531174815     gbbct130.seq
1492175241     gbbct131.seq
 590454241     gbbct132.seq
1490679638     gbbct133.seq
1489254937     gbbct134.seq
 367961744     gbbct135.seq
1495797570     gbbct136.seq
 899966862     gbbct137.seq
1498294763     gbbct138.seq
 922218074     gbbct139.seq
1485503356     gbbct14.seq
1496611892     gbbct140.seq
1007638068     gbbct141.seq
1493345316     gbbct142.seq
 902115658     gbbct143.seq
1499490395     gbbct144.seq
1141504836     gbbct145.seq
1499231508     gbbct146.seq
 747719352     gbbct147.seq
1499001224     gbbct148.seq
1001747042     gbbct149.seq
 633355554     gbbct15.seq
1498222451     gbbct150.seq
1490829057     gbbct151.seq
 865844173     gbbct152.seq
1498776012     gbbct153.seq
1497222139     gbbct154.seq
 274102356     gbbct155.seq
1497125673     gbbct156.seq
1046899210     gbbct157.seq
1498387011     gbbct158.seq
1496048870     gbbct159.seq
1493744829     gbbct16.seq
 533194999     gbbct160.seq
1489350928     gbbct161.seq
 738386261     gbbct162.seq
1491321589     gbbct163.seq
 657854122     gbbct164.seq
1498529961     gbbct165.seq
1493582321     gbbct166.seq
 730657693     gbbct167.seq
1480016405     gbbct168.seq
1492358675     gbbct169.seq
 937819477     gbbct17.seq
 533003198     gbbct170.seq
1488708282     gbbct171.seq
1300558107     gbbct172.seq
1496429019     gbbct173.seq
1496613807     gbbct174.seq
 315596476     gbbct175.seq
1497524996     gbbct176.seq
1490742714     gbbct177.seq
 707383380     gbbct178.seq
1491886745     gbbct179.seq
1494225724     gbbct18.seq
1090367906     gbbct180.seq
1495911281     gbbct181.seq
 974620906     gbbct182.seq
1498912698     gbbct183.seq
 795071608     gbbct184.seq
1485760910     gbbct185.seq
 897604258     gbbct186.seq
1499804277     gbbct187.seq
 665481717     gbbct188.seq
1495144042     gbbct189.seq
 631580903     gbbct19.seq
 514151316     gbbct190.seq
1495326621     gbbct191.seq
1311468007     gbbct192.seq
1496277978     gbbct193.seq
1493204870     gbbct194.seq
 316723707     gbbct195.seq
1491509206     gbbct196.seq
 579457920     gbbct197.seq
1499470825     gbbct198.seq
 471560799     gbbct199.seq
 394935368     gbbct2.seq
1497607124     gbbct20.seq
1493504285     gbbct200.seq
1496761902     gbbct201.seq
 219408606     gbbct202.seq
1491330340     gbbct203.seq
1436307952     gbbct204.seq
1495174060     gbbct205.seq
 711986648     gbbct206.seq
1488468408     gbbct207.seq
 561392750     gbbct208.seq
1493393405     gbbct209.seq
 421301045     gbbct21.seq
 722443682     gbbct210.seq
1497585233     gbbct211.seq
1493658397     gbbct212.seq
 291826581     gbbct213.seq
1498979274     gbbct214.seq
1492524373     gbbct215.seq
 501938080     gbbct216.seq
1498112499     gbbct217.seq
 666665926     gbbct218.seq
1487372977     gbbct219.seq
1491407646     gbbct22.seq
 678685495     gbbct220.seq
1491240939     gbbct221.seq
1492339631     gbbct222.seq
 688979203     gbbct223.seq
1499235015     gbbct224.seq
1491528190     gbbct225.seq
 147315955     gbbct226.seq
1499120739     gbbct227.seq
1179025118     gbbct228.seq
1492340666     gbbct229.seq
 839880629     gbbct23.seq
1489152014     gbbct230.seq
 213003833     gbbct231.seq
1499470681     gbbct232.seq
 832566854     gbbct233.seq
1493440129     gbbct234.seq
1429661414     gbbct235.seq
1495914531     gbbct236.seq
1046050574     gbbct237.seq
1498424623     gbbct238.seq
1067705511     gbbct239.seq
1497947347     gbbct24.seq
1497164566     gbbct240.seq
1495172022     gbbct241.seq
 277933089     gbbct242.seq
1493163574     gbbct243.seq
1367307653     gbbct244.seq
1497755772     gbbct245.seq
1494492695     gbbct246.seq
 445324933     gbbct247.seq
1499130394     gbbct248.seq
1321340826     gbbct249.seq
1483824105     gbbct25.seq
1498946086     gbbct250.seq
 788829444     gbbct251.seq
1498455374     gbbct252.seq
 816093969     gbbct253.seq
1493792682     gbbct254.seq
 488070586     gbbct255.seq
1494989471     gbbct256.seq
 605545293     gbbct257.seq
1497012099     gbbct258.seq
 658647876     gbbct259.seq
 678195163     gbbct26.seq
1498972629     gbbct260.seq
1104217490     gbbct261.seq
1497030717     gbbct262.seq
 938533849     gbbct263.seq
1498737207     gbbct264.seq
1237317628     gbbct265.seq
1489210123     gbbct266.seq
 564230255     gbbct267.seq
1494138925     gbbct268.seq
1042890797     gbbct269.seq
  21439470     gbbct27.seq
1496045120     gbbct270.seq
1167694449     gbbct271.seq
1490380887     gbbct272.seq
 565673882     gbbct273.seq
1496181634     gbbct274.seq
 886813463     gbbct275.seq
1495035438     gbbct276.seq
1059442249     gbbct277.seq
1496367291     gbbct278.seq
1464921705     gbbct279.seq
  38705584     gbbct28.seq
1498515801     gbbct280.seq
 929225517     gbbct281.seq
1492214165     gbbct282.seq
1491975131     gbbct283.seq
 621987039     gbbct284.seq
1489375741     gbbct285.seq
1150916894     gbbct286.seq
1498196213     gbbct287.seq
 863342560     gbbct288.seq
1495486456     gbbct289.seq
1494134189     gbbct29.seq
1495032658     gbbct290.seq
 376494284     gbbct291.seq
1492611368     gbbct292.seq
 716258261     gbbct293.seq
1497550366     gbbct294.seq
 756839506     gbbct295.seq
1491163863     gbbct296.seq
1497527609     gbbct297.seq
 196661163     gbbct298.seq
1496589259     gbbct299.seq
 440968747     gbbct3.seq
 480482223     gbbct30.seq
1481293944     gbbct300.seq
1499267670     gbbct301.seq
 756402359     gbbct302.seq
1494682057     gbbct303.seq
 746613899     gbbct304.seq
1498444856     gbbct305.seq
1494803960     gbbct306.seq
  43389672     gbbct307.seq
1497713907     gbbct308.seq
1498515669     gbbct309.seq
1495481620     gbbct31.seq
 663733782     gbbct310.seq
1499618143     gbbct311.seq
1489762250     gbbct312.seq
1498975093     gbbct313.seq
1152570777     gbbct314.seq
1499583507     gbbct315.seq
1356238458     gbbct316.seq
1490688868     gbbct317.seq
1498493113     gbbct318.seq
 301820840     gbbct319.seq
1318993333     gbbct32.seq
1497190193     gbbct320.seq
 651635497     gbbct321.seq
1488262692     gbbct322.seq
 610803316     gbbct323.seq
1497463106     gbbct324.seq
 636389968     gbbct325.seq
1489629962     gbbct326.seq
1155690383     gbbct327.seq
1499783178     gbbct328.seq
 946349068     gbbct329.seq
1491827000     gbbct33.seq
1499583236     gbbct330.seq
1485779432     gbbct331.seq
  27886221     gbbct332.seq
1476559086     gbbct333.seq
1453669035     gbbct334.seq
1488575393     gbbct335.seq
 795442774     gbbct336.seq
1485163835     gbbct337.seq
 998330304     gbbct338.seq
1498481607     gbbct339.seq
1340303157     gbbct34.seq
1019169566     gbbct340.seq
1491499388     gbbct341.seq
 556367803     gbbct342.seq
1486811205     gbbct343.seq
 581524100     gbbct344.seq
1490610259     gbbct345.seq
1343056388     gbbct346.seq
1480116152     gbbct347.seq
1188991800     gbbct348.seq
1493062071     gbbct349.seq
1481720049     gbbct35.seq
 904122215     gbbct350.seq
1491702237     gbbct351.seq
1123591601     gbbct352.seq
1490108686     gbbct353.seq
1186070266     gbbct354.seq
1488256186     gbbct355.seq
 639605210     gbbct356.seq
1496144270     gbbct357.seq
 606941691     gbbct358.seq
1495823069     gbbct359.seq
1488663426     gbbct36.seq
1036692173     gbbct360.seq
1492085815     gbbct361.seq
1498437821     gbbct362.seq
 120983575     gbbct363.seq
1493628126     gbbct364.seq
1414469298     gbbct365.seq
1494977151     gbbct366.seq
1198198047     gbbct367.seq
1497808225     gbbct368.seq
 560939731     gbbct369.seq
 124843461     gbbct37.seq
1487711180     gbbct370.seq
 533776081     gbbct371.seq
1493205003     gbbct372.seq
 883260300     gbbct373.seq
1489859319     gbbct374.seq
1495775240     gbbct375.seq
 670427597     gbbct376.seq
1492795446     gbbct377.seq
1444027054     gbbct378.seq
1484153226     gbbct379.seq
1499697553     gbbct38.seq
1492426160     gbbct380.seq
 253127756     gbbct381.seq
1496715646     gbbct382.seq
1494190640     gbbct383.seq
 300187677     gbbct384.seq
1494342748     gbbct385.seq
1125312223     gbbct386.seq
1494621377     gbbct387.seq
 674064343     gbbct388.seq
1497448367     gbbct389.seq
1492631339     gbbct39.seq
 935171108     gbbct390.seq
1498129618     gbbct391.seq
1067620018     gbbct392.seq
1494081185     gbbct393.seq
1480423943     gbbct394.seq
1498327971     gbbct395.seq
 825042690     gbbct396.seq
1497787037     gbbct397.seq
1453704711     gbbct398.seq
1494473542     gbbct399.seq
 102364473     gbbct4.seq
 246524366     gbbct40.seq
 816943814     gbbct400.seq
1490372476     gbbct401.seq
1092919442     gbbct402.seq
1497628189     gbbct403.seq
 645011304     gbbct404.seq
1497016057     gbbct405.seq
1032498246     gbbct406.seq
1491292664     gbbct407.seq
1108874242     gbbct408.seq
1495821074     gbbct409.seq
1481883826     gbbct41.seq
1412434458     gbbct410.seq
1489792857     gbbct411.seq
 933052861     gbbct412.seq
1499188036     gbbct413.seq
1495124469     gbbct414.seq
 895248208     gbbct415.seq
1491423178     gbbct416.seq
 861726757     gbbct417.seq
1492616306     gbbct418.seq
1199367036     gbbct419.seq
 957679690     gbbct42.seq
1496157364     gbbct420.seq
1490488781     gbbct421.seq
 460649836     gbbct422.seq
1490365865     gbbct423.seq
 718692260     gbbct424.seq
1495719164     gbbct425.seq
1494169041     gbbct426.seq
  82649563     gbbct427.seq
1483095178     gbbct428.seq
 579221392     gbbct429.seq
1494893823     gbbct43.seq
1498735730     gbbct430.seq
 686792090     gbbct431.seq
1499451401     gbbct432.seq
 725101778     gbbct433.seq
1495675291     gbbct434.seq
 686923622     gbbct435.seq
1494276437     gbbct436.seq
 588950854     gbbct437.seq
1493677587     gbbct438.seq
1318556027     gbbct439.seq
 789309180     gbbct44.seq
 305005446     gbbct440.seq
   6898742     gbbct441.seq
  14178459     gbbct442.seq
  22823369     gbbct443.seq
  44533895     gbbct444.seq
  86687137     gbbct445.seq
 168680242     gbbct446.seq
1496835762     gbbct447.seq
1499998005     gbbct448.seq
 123190838     gbbct449.seq
1492617140     gbbct45.seq
1487452914     gbbct450.seq
 709605416     gbbct451.seq
 791763491     gbbct452.seq
 586087659     gbbct453.seq
 626268045     gbbct454.seq
 544319902     gbbct455.seq
 148407448     gbbct456.seq
1131332347     gbbct457.seq
1493448098     gbbct458.seq
1484833134     gbbct459.seq
1248491439     gbbct46.seq
 291905719     gbbct460.seq
1496414481     gbbct461.seq
 163883507     gbbct462.seq
1496860173     gbbct463.seq
 615755463     gbbct464.seq
1499014700     gbbct465.seq
 295118899     gbbct466.seq
1493319826     gbbct467.seq
 590024546     gbbct468.seq
1492911744     gbbct469.seq
1496615283     gbbct47.seq
 243476185     gbbct470.seq
1499570731     gbbct471.seq
 592957716     gbbct472.seq
1494576725     gbbct473.seq
 480923910     gbbct474.seq
  51295351     gbbct475.seq
 108039589     gbbct476.seq
1422472863     gbbct477.seq
1499997767     gbbct478.seq
1311069699     gbbct479.seq
 886059368     gbbct48.seq
1493440049     gbbct480.seq
1498373587     gbbct481.seq
 133617493     gbbct482.seq
1492246104     gbbct483.seq
 619695519     gbbct484.seq
1498275274     gbbct485.seq
 437799857     gbbct486.seq
1496629731     gbbct487.seq
1499999213     gbbct488.seq
 282999747     gbbct489.seq
1496550412     gbbct49.seq
 282580177     gbbct5.seq
 290986411     gbbct50.seq
1492158968     gbbct51.seq
  88462798     gbbct52.seq
1496025399     gbbct53.seq
 253462586     gbbct54.seq
1498430551     gbbct55.seq
 505162037     gbbct56.seq
1495242100     gbbct57.seq
 675129841     gbbct58.seq
1494190005     gbbct59.seq
1497013058     gbbct6.seq
 499172635     gbbct60.seq
1494455787     gbbct61.seq
 330781299     gbbct62.seq
1499126002     gbbct63.seq
 492171187     gbbct64.seq
1487505189     gbbct65.seq
1498199893     gbbct66.seq
 394473051     gbbct67.seq
1491164687     gbbct68.seq
 457611102     gbbct69.seq
1023080506     gbbct7.seq
1492313968     gbbct70.seq
1135423073     gbbct71.seq
1496704394     gbbct72.seq
 893721813     gbbct73.seq
1493269352     gbbct74.seq
1412198748     gbbct75.seq
1498288490     gbbct76.seq
1496251773     gbbct77.seq
 170803050     gbbct78.seq
1496560040     gbbct79.seq
1498918813     gbbct8.seq
 475149035     gbbct80.seq
1491398737     gbbct81.seq
 514295883     gbbct82.seq
1492454379     gbbct83.seq
 676991923     gbbct84.seq
1497134590     gbbct85.seq
 260568507     gbbct86.seq
1492255008     gbbct87.seq
 292181906     gbbct88.seq
1494990751     gbbct89.seq
 609385399     gbbct9.seq
 574348826     gbbct90.seq
1490144676     gbbct91.seq
1212329207     gbbct92.seq
1499838833     gbbct93.seq
 763934399     gbbct94.seq
1496833560     gbbct95.seq
 748681224     gbbct96.seq
1494274774     gbbct97.seq
 937765404     gbbct98.seq
1490173396     gbbct99.seq
  18852986     gbchg.txt
1499995442     gbcon1.seq
1499999111     gbcon10.seq
1499995104     gbcon100.seq
 576706802     gbcon101.seq
  84953982     gbcon11.seq
1498405814     gbcon12.seq
 318319660     gbcon13.seq
 636023858     gbcon14.seq
 126587923     gbcon15.seq
1028310251     gbcon16.seq
1444131052     gbcon17.seq
1500000000     gbcon18.seq
  43306374     gbcon19.seq
  94251153     gbcon2.seq
1278157868     gbcon20.seq
1271755654     gbcon21.seq
1386617844     gbcon22.seq
1177824385     gbcon23.seq
1240101010     gbcon24.seq
1337030035     gbcon25.seq
1299675944     gbcon26.seq
1261114939     gbcon27.seq
1188545530     gbcon28.seq
1365754855     gbcon29.seq
1498911488     gbcon3.seq
1387263027     gbcon30.seq
 973412454     gbcon31.seq
 174082386     gbcon32.seq
 524074151     gbcon33.seq
 704808554     gbcon34.seq
 199583073     gbcon35.seq
1338812924     gbcon36.seq
1499950578     gbcon37.seq
 200881441     gbcon38.seq
1499426434     gbcon39.seq
 552185356     gbcon4.seq
 167922947     gbcon40.seq
1134129251     gbcon41.seq
1500000194     gbcon42.seq
 266937090     gbcon43.seq
1170180709     gbcon44.seq
1499998926     gbcon45.seq
 775619178     gbcon46.seq
1304341687     gbcon47.seq
1133188230     gbcon48.seq
1499978784     gbcon49.seq
1498697728     gbcon5.seq
 222300907     gbcon50.seq
1224503700     gbcon51.seq
  45938911     gbcon52.seq
1330569622     gbcon53.seq
1499998104     gbcon54.seq
 197763134     gbcon55.seq
1245238228     gbcon56.seq
 969999009     gbcon57.seq
1250166723     gbcon58.seq
1402937643     gbcon59.seq
1494211664     gbcon6.seq
1183343266     gbcon60.seq
1023833403     gbcon61.seq
1411488563     gbcon62.seq
1380478657     gbcon63.seq
1266881900     gbcon64.seq
1078797150     gbcon65.seq
1499995975     gbcon66.seq
 147611220     gbcon67.seq
1499963496     gbcon68.seq
 336803374     gbcon69.seq
 170068344     gbcon7.seq
1188837926     gbcon70.seq
1499974655     gbcon71.seq
 275481498     gbcon72.seq
1499498042     gbcon73.seq
 648844765     gbcon74.seq
1133518053     gbcon75.seq
1499997651     gbcon76.seq
 298184095     gbcon77.seq
1478756571     gbcon78.seq
1382038697     gbcon79.seq
1499170121     gbcon8.seq
1499994450     gbcon80.seq
 140170892     gbcon81.seq
1038927029     gbcon82.seq
1499970544     gbcon83.seq
1326569427     gbcon84.seq
1002937116     gbcon85.seq
1499994940     gbcon86.seq
   4745738     gbcon87.seq
1499997187     gbcon88.seq
  13882959     gbcon89.seq
1197352043     gbcon9.seq
1499997568     gbcon90.seq
 277989840     gbcon91.seq
1499997568     gbcon92.seq
 244697140     gbcon93.seq
1499911631     gbcon94.seq
 345862390     gbcon95.seq
1499998327     gbcon96.seq
 151429954     gbcon97.seq
1499987892     gbcon98.seq
 234692153     gbcon99.seq
     18307     gbdel.txt
1492468627     gbenv1.seq
 506901903     gbenv10.seq
1192210508     gbenv11.seq
1499998905     gbenv12.seq
  85400539     gbenv13.seq
1178756231     gbenv14.seq
1499998855     gbenv15.seq
  47233015     gbenv16.seq
1193836854     gbenv17.seq
1336273984     gbenv18.seq
1473171021     gbenv19.seq
  15345825     gbenv2.seq
1339459548     gbenv20.seq
1395970079     gbenv21.seq
1347344789     gbenv22.seq
1239590869     gbenv23.seq
1392834664     gbenv24.seq
1499998930     gbenv25.seq
 160986033     gbenv26.seq
1499973638     gbenv27.seq
 228109202     gbenv28.seq
1316354462     gbenv29.seq
1495179478     gbenv3.seq
1492554575     gbenv30.seq
1499999023     gbenv31.seq
 494274878     gbenv32.seq
1497379922     gbenv33.seq
 563114560     gbenv34.seq
1499350902     gbenv35.seq
 555965397     gbenv36.seq
1498872495     gbenv37.seq
1470062868     gbenv38.seq
 636903289     gbenv4.seq
1499184973     gbenv5.seq
1499996853     gbenv6.seq
 484082209     gbenv7.seq
1055682345     gbenv8.seq
1499999103     gbenv9.seq
1499998040     gbest1.seq
1244432541     gbest10.seq
 478350574     gbest100.seq
1499997280     gbest101.seq
 462325791     gbest102.seq
1499999379     gbest103.seq
 495993472     gbest104.seq
1499997040     gbest105.seq
 525244681     gbest106.seq
1497312411     gbest107.seq
1499999347     gbest108.seq
 521629824     gbest109.seq
1499997183     gbest11.seq
1499995864     gbest110.seq
 576966057     gbest111.seq
1499998965     gbest112.seq
 515152623     gbest113.seq
1499995627     gbest114.seq
 561257795     gbest115.seq
1499996889     gbest116.seq
 122786557     gbest117.seq
1499999273     gbest118.seq
 554232080     gbest119.seq
 549054583     gbest12.seq
1499998164     gbest120.seq
 557205143     gbest121.seq
1499997807     gbest122.seq
 512758961     gbest123.seq
1499999836     gbest124.seq
 525506279     gbest125.seq
1485629481     gbest126.seq
1499998193     gbest127.seq
 506412822     gbest128.seq
1499997315     gbest129.seq
1499998193     gbest13.seq
 508751058     gbest130.seq
1499997805     gbest131.seq
 425307183     gbest132.seq
1499997662     gbest133.seq
 501891818     gbest134.seq
1469227149     gbest135.seq
1499998647     gbest136.seq
 540445509     gbest137.seq
1499999161     gbest138.seq
 494322862     gbest139.seq
 487101889     gbest14.seq
1499999827     gbest140.seq
 557621047     gbest141.seq
1499998388     gbest142.seq
 469754446     gbest143.seq
1499998627     gbest144.seq
 519798159     gbest145.seq
 993935320     gbest146.seq
1499999348     gbest147.seq
 507254809     gbest148.seq
1500000021     gbest149.seq
1499998954     gbest15.seq
 445590247     gbest150.seq
1499998952     gbest151.seq
 385956825     gbest152.seq
1499998826     gbest153.seq
 523821485     gbest154.seq
1499997097     gbest155.seq
 561909274     gbest156.seq
 166258344     gbest157.seq
1499999473     gbest158.seq
 588310541     gbest159.seq
 465921293     gbest16.seq
1499997261     gbest160.seq
 667269525     gbest161.seq
1499996792     gbest162.seq
 656073978     gbest163.seq
1499999457     gbest164.seq
 496989121     gbest165.seq
1499999635     gbest166.seq
  68562748     gbest167.seq
1499996309     gbest168.seq
 584714025     gbest169.seq
1499998232     gbest17.seq
1499997599     gbest170.seq
 588027958     gbest171.seq
1499998506     gbest172.seq
 549399505     gbest173.seq
1499998583     gbest174.seq
 589133348     gbest175.seq
1499995926     gbest176.seq
 624829775     gbest177.seq
 828529101     gbest178.seq
1500000164     gbest179.seq
 691425682     gbest18.seq
 560913835     gbest180.seq
1499999145     gbest181.seq
 410568558     gbest182.seq
1335975617     gbest183.seq
1261733551     gbest184.seq
1457029314     gbest185.seq
1305524661     gbest186.seq
1336201281     gbest187.seq
1188592078     gbest188.seq
1120643618     gbest189.seq
1499999283     gbest19.seq
1161929695     gbest190.seq
1146695156     gbest191.seq
1499997719     gbest192.seq
 500797842     gbest193.seq
1499999707     gbest194.seq
 523700291     gbest195.seq
 170019681     gbest196.seq
1499997341     gbest197.seq
 528584856     gbest198.seq
1499998621     gbest199.seq
 434903673     gbest2.seq
 689546565     gbest20.seq
 568551449     gbest200.seq
1499998462     gbest201.seq
 558919353     gbest202.seq
1499999440     gbest203.seq
 536887953     gbest204.seq
1499999584     gbest205.seq
 574354727     gbest206.seq
1499996590     gbest207.seq
 208394234     gbest208.seq
1499999236     gbest209.seq
1500000157     gbest21.seq
 595444718     gbest210.seq
1499997620     gbest211.seq
 557673476     gbest212.seq
1499993891     gbest213.seq
 644690195     gbest214.seq
1499998771     gbest215.seq
 644817182     gbest216.seq
1499999913     gbest217.seq
 520851900     gbest218.seq
 174271459     gbest219.seq
 477034729     gbest22.seq
1086399495     gbest220.seq
1076881402     gbest221.seq
1499997622     gbest222.seq
 600064016     gbest223.seq
1499998945     gbest224.seq
 511158642     gbest225.seq
1499999387     gbest226.seq
 478133188     gbest227.seq
1499999379     gbest228.seq
 418383466     gbest229.seq
 856398835     gbest23.seq
1499998117     gbest230.seq
 583428041     gbest231.seq
1499997412     gbest232.seq
 533027091     gbest233.seq
1499996728     gbest234.seq
 544540944     gbest235.seq
1499999416     gbest236.seq
 512071277     gbest237.seq
1393300531     gbest238.seq
1111029018     gbest239.seq
1499997446     gbest24.seq
1050519718     gbest240.seq
1500000059     gbest241.seq
 794336253     gbest242.seq
 483805760     gbest25.seq
1499998922     gbest26.seq
 464409095     gbest27.seq
1499999699     gbest28.seq
 507844464     gbest29.seq
1499997198     gbest3.seq
1499999570     gbest30.seq
 484327194     gbest31.seq
1499999068     gbest32.seq
 510303762     gbest33.seq
 123414980     gbest34.seq
1499998430     gbest35.seq
 506586281     gbest36.seq
1499999189     gbest37.seq
 547151633     gbest38.seq
1499997615     gbest39.seq
 469427397     gbest4.seq
 553867571     gbest40.seq
1499997028     gbest41.seq
 472251879     gbest42.seq
1499999234     gbest43.seq
 500143998     gbest44.seq
  35244903     gbest45.seq
1500000064     gbest46.seq
 527793872     gbest47.seq
1499999919     gbest48.seq
 509963387     gbest49.seq
1500000133     gbest5.seq
1499999721     gbest50.seq
 521815827     gbest51.seq
1499999782     gbest52.seq
  18202008     gbest53.seq
1500000156     gbest54.seq
  69236135     gbest55.seq
1223774214     gbest56.seq
1195302920     gbest57.seq
1499996399     gbest58.seq
 585312182     gbest59.seq
 475309806     gbest6.seq
1499999280     gbest60.seq
 604731539     gbest61.seq
1500000230     gbest62.seq
 529223178     gbest63.seq
1499996796     gbest64.seq
 531776150     gbest65.seq
1499997515     gbest66.seq
 324381871     gbest67.seq
1499996680     gbest68.seq
 526476819     gbest69.seq
 749994801     gbest7.seq
1499997847     gbest70.seq
 511189553     gbest71.seq
1499999626     gbest72.seq
 586437033     gbest73.seq
1499998278     gbest74.seq
 620380874     gbest75.seq
1499997465     gbest76.seq
 565990987     gbest77.seq
 903618988     gbest78.seq
1499996645     gbest79.seq
1421196661     gbest8.seq
 542966457     gbest80.seq
1499998408     gbest81.seq
 542345429     gbest82.seq
1499999039     gbest83.seq
 511589181     gbest84.seq
1499997738     gbest85.seq
 529848771     gbest86.seq
1499998284     gbest87.seq
 534252432     gbest88.seq
  13610370     gbest89.seq
1262840416     gbest9.seq
1328952216     gbest90.seq
1321735732     gbest91.seq
1267561364     gbest92.seq
1270177636     gbest93.seq
1499998534     gbest94.seq
 552065616     gbest95.seq
1499999987     gbest96.seq
 547762830     gbest97.seq
1176578724     gbest98.seq
1499998766     gbest99.seq
1499998207     gbgss1.seq
1499998915     gbgss10.seq
   6147876     gbgss100.seq
1499999483     gbgss101.seq
 264587590     gbgss102.seq
1499998544     gbgss103.seq
 429620282     gbgss104.seq
1499999258     gbgss105.seq
 471953405     gbgss106.seq
1499999910     gbgss107.seq
 419754980     gbgss108.seq
1499997195     gbgss109.seq
 549831935     gbgss11.seq
 518244381     gbgss110.seq
 315572447     gbgss111.seq
1499999898     gbgss112.seq
 467315305     gbgss113.seq
1499998567     gbgss114.seq
 536130050     gbgss115.seq
1499997700     gbgss116.seq
 522038817     gbgss117.seq
1499998777     gbgss118.seq
   1959679     gbgss119.seq
1499997027     gbgss12.seq
1499999188     gbgss120.seq
 499937285     gbgss121.seq
1477073385     gbgss122.seq
 531335589     gbgss13.seq
1499998944     gbgss14.seq
 475326860     gbgss15.seq
1499997653     gbgss16.seq
 512509603     gbgss17.seq
1168552167     gbgss18.seq
1499999631     gbgss19.seq
 541483221     gbgss2.seq
 486877826     gbgss20.seq
1499999507     gbgss21.seq
 443938499     gbgss22.seq
1499999209     gbgss23.seq
 421053044     gbgss24.seq
1499998509     gbgss25.seq
 427908143     gbgss26.seq
  67665344     gbgss27.seq
1499998254     gbgss28.seq
 492393725     gbgss29.seq
1499998711     gbgss3.seq
1499999477     gbgss30.seq
 502274583     gbgss31.seq
1499999580     gbgss32.seq
 419366282     gbgss33.seq
1499997062     gbgss34.seq
  34855955     gbgss35.seq
1499998229     gbgss36.seq
 492754354     gbgss37.seq
1499998171     gbgss38.seq
 506753602     gbgss39.seq
 555792228     gbgss4.seq
1499999418     gbgss40.seq
 534174148     gbgss41.seq
1499999956     gbgss42.seq
 465182812     gbgss43.seq
 244248654     gbgss44.seq
1499997597     gbgss45.seq
 545807577     gbgss46.seq
1499999893     gbgss47.seq
 468704724     gbgss48.seq
1499997211     gbgss49.seq
1499999765     gbgss5.seq
 542546055     gbgss50.seq
1499996778     gbgss51.seq
 319646789     gbgss52.seq
1499997389     gbgss53.seq
 605483733     gbgss54.seq
1499998554     gbgss55.seq
 508922285     gbgss56.seq
1499998603     gbgss57.seq
 451766711     gbgss58.seq
1499998515     gbgss59.seq
 504918542     gbgss6.seq
 529780376     gbgss60.seq
 709677252     gbgss61.seq
1499997150     gbgss62.seq
 514831545     gbgss63.seq
1499997106     gbgss64.seq
 516779569     gbgss65.seq
1499997356     gbgss66.seq
 502038098     gbgss67.seq
1499997413     gbgss68.seq
 506828983     gbgss69.seq
1499999123     gbgss7.seq
 373345547     gbgss70.seq
1499998660     gbgss71.seq
 456782348     gbgss72.seq
1499999602     gbgss73.seq
 458341813     gbgss74.seq
1499998619     gbgss75.seq
 456856216     gbgss76.seq
1499999360     gbgss77.seq
 364170901     gbgss78.seq
1215813295     gbgss79.seq
 483126560     gbgss8.seq
1068461944     gbgss80.seq
1499999007     gbgss81.seq
 549668532     gbgss82.seq
1499999044     gbgss83.seq
 541154416     gbgss84.seq
1057630775     gbgss85.seq
1499998892     gbgss86.seq
 496080781     gbgss87.seq
1499999252     gbgss88.seq
 556326282     gbgss89.seq
 826435019     gbgss9.seq
1499998428     gbgss90.seq
 480820480     gbgss91.seq
1055215094     gbgss92.seq
1499998172     gbgss93.seq
 483143456     gbgss94.seq
1499997645     gbgss95.seq
 487712323     gbgss96.seq
1499998457     gbgss97.seq
 475204364     gbgss98.seq
1499998809     gbgss99.seq
1499996974     gbhtc1.seq
 331477785     gbhtc2.seq
 940143493     gbhtc3.seq
 715450895     gbhtc4.seq
1499970679     gbhtg1.seq
 983504262     gbhtg10.seq
1267889827     gbhtg11.seq
1224664835     gbhtg12.seq
1265349521     gbhtg13.seq
1222991892     gbhtg14.seq
1234734328     gbhtg15.seq
1201837478     gbhtg16.seq
1205529949     gbhtg17.seq
1193774323     gbhtg18.seq
1161219247     gbhtg19.seq
1002667041     gbhtg2.seq
1252713164     gbhtg20.seq
1499944551     gbhtg21.seq
 167070684     gbhtg22.seq
1499895691     gbhtg23.seq
 468416937     gbhtg24.seq
1499942226     gbhtg25.seq
1417599358     gbhtg26.seq
1384967615     gbhtg27.seq
1383479100     gbhtg28.seq
1499949671     gbhtg29.seq
1499664703     gbhtg3.seq
1307517582     gbhtg30.seq
 985106395     gbhtg4.seq
1499788429     gbhtg5.seq
 974339073     gbhtg6.seq
1499819070     gbhtg7.seq
 972857837     gbhtg8.seq
1499901770     gbhtg9.seq
1499997271     gbinv1.seq
  94381501     gbinv10.seq
1182054227     gbinv100.seq
1386518936     gbinv1000.se
 592071448     gbinv1001.se
1478483619     gbinv1002.se
 530982066     gbinv1003.se
1462302633     gbinv1004.se
1488222098     gbinv1005.se
 316978161     gbinv1006.se
1428447642     gbinv1007.se
 748970586     gbinv1008.se
1447037924     gbinv1009.se
1499663239     gbinv101.seq
 497131956     gbinv1010.se
1476470436     gbinv1011.se
 723654522     gbinv1012.se
1488497897     gbinv1013.se
 776269438     gbinv1014.se
1401070087     gbinv1015.se
1499767191     gbinv1016.se
  26774817     gbinv1017.se
1374498134     gbinv1018.se
 839509523     gbinv1019.se
 133410444     gbinv102.seq
1429054226     gbinv1020.se
 511579884     gbinv1021.se
1499769508     gbinv1022.se
 285714929     gbinv1023.se
1488663552     gbinv1024.se
 852471186     gbinv1025.se
1497639222     gbinv1026.se
 940269075     gbinv1027.se
1372239390     gbinv1028.se
 883953960     gbinv1029.se
 548623487     gbinv103.seq
1414834225     gbinv1030.se
 950346640     gbinv1031.se
1420677910     gbinv1032.se
1484572405     gbinv1033.se
 302207567     gbinv1034.se
1471402527     gbinv1035.se
 242824332     gbinv1036.se
1486519935     gbinv1037.se
 516118654     gbinv1038.se
1443896344     gbinv1039.se
1489473163     gbinv104.seq
 401590756     gbinv1040.se
1482551138     gbinv1041.se
 379825603     gbinv1042.se
1471607599     gbinv1043.se
 627240431     gbinv1044.se
1483677454     gbinv1045.se
 534260145     gbinv1046.se
1470409794     gbinv1047.se
 815630388     gbinv1048.se
1439612217     gbinv1049.se
 510289823     gbinv105.seq
 634137125     gbinv1050.se
1476799939     gbinv1051.se
 690990472     gbinv1052.se
1446569710     gbinv1053.se
 586322661     gbinv1054.se
1395031330     gbinv1055.se
 705605596     gbinv1056.se
1433843315     gbinv1057.se
1481381148     gbinv1058.se
1499117349     gbinv1059.se
1499621237     gbinv106.seq
1497681677     gbinv1060.se
1372784832     gbinv1061.se
1479685759     gbinv1062.se
 230078798     gbinv1063.se
1447125165     gbinv1064.se
1453467490     gbinv1065.se
 206238518     gbinv1066.se
1487439186     gbinv1067.se
1224203052     gbinv1068.se
1357832111     gbinv1069.se
1479771613     gbinv107.seq
1403389078     gbinv1070.se
 656055076     gbinv1071.se
1121741672     gbinv1072.se
1368086883     gbinv1073.se
 686317202     gbinv1074.se
1399135479     gbinv1075.se
1499999238     gbinv1076.se
 225740432     gbinv1077.se
 305143352     gbinv108.seq
 933854214     gbinv109.seq
1497689770     gbinv11.seq
1488026360     gbinv110.seq
1271327187     gbinv111.seq
1479772341     gbinv112.seq
1340183057     gbinv113.seq
1499959282     gbinv114.seq
1329791463     gbinv115.seq
1462835389     gbinv116.seq
1384398530     gbinv117.seq
1497744691     gbinv118.seq
1308739356     gbinv119.seq
 613722125     gbinv12.seq
1480253815     gbinv120.seq
1356395603     gbinv121.seq
1465230120     gbinv122.seq
1346183566     gbinv123.seq
1483867182     gbinv124.seq
 709054487     gbinv125.seq
1481355114     gbinv126.seq
1099028683     gbinv127.seq
1467670433     gbinv128.seq
1431209353     gbinv129.seq
1484460112     gbinv13.seq
1398298296     gbinv130.seq
1236029882     gbinv131.seq
1290962298     gbinv132.seq
1406619747     gbinv133.seq
1499567137     gbinv134.seq
 855577670     gbinv135.seq
1394266063     gbinv136.seq
1499862021     gbinv137.seq
 262234281     gbinv138.seq
1499966002     gbinv139.seq
1472044257     gbinv14.seq
 218517075     gbinv140.seq
1499976501     gbinv141.seq
 349146665     gbinv142.seq
1499822212     gbinv143.seq
1067070303     gbinv144.seq
1499998695     gbinv145.seq
 567604836     gbinv146.seq
1499930839     gbinv147.seq
1122240846     gbinv148.seq
1468682724     gbinv149.seq
 252009079     gbinv15.seq
1499999519     gbinv150.seq
  89706920     gbinv151.seq
1499998320     gbinv152.seq
1135262858     gbinv153.seq
1499996884     gbinv154.seq
  61144100     gbinv155.seq
1499999630     gbinv156.seq
 681130891     gbinv157.seq
1234792748     gbinv158.seq
1127903322     gbinv159.seq
1411212874     gbinv16.seq
1370092189     gbinv160.seq
1071522534     gbinv161.seq
1491749892     gbinv162.seq
1482077488     gbinv163.seq
1428486102     gbinv164.seq
 785387038     gbinv165.seq
1485746848     gbinv166.seq
 950447013     gbinv167.seq
1496705944     gbinv168.seq
 806848727     gbinv169.seq
 472455130     gbinv17.seq
1493872622     gbinv170.seq
 856340119     gbinv171.seq
1495116171     gbinv172.seq
 830173484     gbinv173.seq
1462548683     gbinv174.seq
 909175094     gbinv175.seq
1497255008     gbinv176.seq
 948159065     gbinv177.seq
1168251683     gbinv178.seq
1001728647     gbinv179.seq
1463087102     gbinv18.seq
1484591726     gbinv180.seq
 818944818     gbinv181.seq
1365196578     gbinv182.seq
 656430488     gbinv183.seq
1469549148     gbinv184.seq
 304494269     gbinv185.seq
1465424531     gbinv186.seq
 326171717     gbinv187.seq
1481915194     gbinv188.seq
 280017103     gbinv189.seq
 382893064     gbinv19.seq
1461126854     gbinv190.seq
 363343781     gbinv191.seq
1485699469     gbinv192.seq
 492580334     gbinv193.seq
1484074546     gbinv194.seq
 116340814     gbinv195.seq
1495860854     gbinv196.seq
1302209762     gbinv197.seq
1494942690     gbinv198.seq
1230663377     gbinv199.seq
1329032078     gbinv2.seq
1491326951     gbinv20.seq
1476437097     gbinv200.seq
 444097657     gbinv201.seq
1475045916     gbinv202.seq
 476777023     gbinv203.seq
1498005845     gbinv204.seq
1493093103     gbinv205.seq
  30575344     gbinv206.seq
1498741126     gbinv207.seq
1488696868     gbinv208.seq
1451061108     gbinv209.seq
 478394243     gbinv21.seq
1433437455     gbinv210.seq
 262703171     gbinv211.seq
1491835196     gbinv212.seq
 572555681     gbinv213.seq
1486458372     gbinv214.seq
1488217107     gbinv215.seq
1490465641     gbinv216.seq
1126350077     gbinv217.seq
1450277543     gbinv218.seq
1319901770     gbinv219.seq
1499969093     gbinv22.seq
1347201702     gbinv220.seq
1495706167     gbinv221.seq
 421394198     gbinv222.seq
1469684916     gbinv223.seq
1112043464     gbinv224.seq
1495036534     gbinv225.seq
 569557824     gbinv226.seq
1488360125     gbinv227.seq
 678444187     gbinv228.seq
1478247791     gbinv229.seq
1121660607     gbinv23.seq
1499359194     gbinv230.seq
  31554185     gbinv231.seq
1490085879     gbinv232.seq
1437458515     gbinv233.seq
  72193350     gbinv234.seq
1498596856     gbinv235.seq
1144961759     gbinv236.seq
1146698377     gbinv237.seq
1036956058     gbinv238.seq
 544459581     gbinv239.seq
1474452321     gbinv24.seq
1439602775     gbinv240.seq
1414400959     gbinv241.seq
 216067261     gbinv242.seq
1474729500     gbinv243.seq
 462939038     gbinv244.seq
1490427003     gbinv245.seq
 571039519     gbinv246.seq
1485366449     gbinv247.seq
1448567597     gbinv248.seq
 102290543     gbinv249.seq
1480929712     gbinv25.seq
1489524458     gbinv250.seq
 512699050     gbinv251.seq
1395656265     gbinv252.seq
 353041445     gbinv253.seq
1475607229     gbinv254.seq
 367023446     gbinv255.seq
1498739195     gbinv256.seq
 532000359     gbinv257.seq
1463905811     gbinv258.seq
 342931318     gbinv259.seq
 133188059     gbinv26.seq
1334667769     gbinv260.seq
 538071589     gbinv261.seq
1485299655     gbinv262.seq
1082764780     gbinv263.seq
1440782442     gbinv264.seq
1136943111     gbinv265.seq
1495736706     gbinv266.seq
 961513285     gbinv267.seq
1488706132     gbinv268.seq
 421826050     gbinv269.seq
1449149144     gbinv27.seq
1417643381     gbinv270.seq
 628806708     gbinv271.seq
1495082612     gbinv272.seq
 562813715     gbinv273.seq
1337955552     gbinv274.seq
 316192878     gbinv275.seq
1480026370     gbinv276.seq
 532334004     gbinv277.seq
1411065540     gbinv278.seq
 358679242     gbinv279.seq
 192334243     gbinv28.seq
1429898216     gbinv280.seq
 513013670     gbinv281.seq
1489350842     gbinv282.seq
 334664659     gbinv283.seq
1492745138     gbinv284.seq
 459659257     gbinv285.seq
1488662358     gbinv286.seq
 329960301     gbinv287.seq
1498430713     gbinv288.seq
 732438165     gbinv289.seq
1484791811     gbinv29.seq
1439672263     gbinv290.seq
 856718137     gbinv291.seq
1494030148     gbinv292.seq
 746097843     gbinv293.seq
1461000022     gbinv294.seq
 831048648     gbinv295.seq
1414274849     gbinv296.seq
 743540755     gbinv297.seq
1442985378     gbinv298.seq
1032623400     gbinv299.seq
1395011208     gbinv3.seq
 416869708     gbinv30.seq
1449037838     gbinv300.seq
 780441251     gbinv301.seq
1376944968     gbinv302.seq
 347219848     gbinv303.seq
1484503489     gbinv304.seq
 326435281     gbinv305.seq
1466419199     gbinv306.seq
 282550709     gbinv307.seq
1481213432     gbinv308.seq
 258304685     gbinv309.seq
1464142701     gbinv31.seq
1277131227     gbinv310.seq
 321246481     gbinv311.seq
1385396260     gbinv312.seq
1369192781     gbinv313.seq
 355690685     gbinv314.seq
1334142726     gbinv315.seq
1470257963     gbinv316.seq
 509392891     gbinv317.seq
1484501940     gbinv318.seq
1358747502     gbinv319.seq
 421068898     gbinv32.seq
 312842405     gbinv320.seq
1421658161     gbinv321.seq
1476020704     gbinv322.seq
 353309462     gbinv323.seq
1484355892     gbinv324.seq
1489535757     gbinv325.seq
 124238895     gbinv326.seq
1352328131     gbinv327.seq
 436474776     gbinv328.seq
1496458691     gbinv329.seq
1486507586     gbinv33.seq
 713914519     gbinv330.seq
1439419495     gbinv331.seq
1197396451     gbinv332.seq
1495699303     gbinv333.seq
 198554656     gbinv334.seq
1430730340     gbinv335.seq
1100445017     gbinv336.seq
1492366474     gbinv337.seq
 586627743     gbinv338.seq
1471256820     gbinv339.seq
 234808981     gbinv34.seq
1430049479     gbinv340.seq
 346087558     gbinv341.seq
1442141266     gbinv342.seq
1446928519     gbinv343.seq
 413523689     gbinv344.seq
1405608717     gbinv345.seq
 640456621     gbinv346.seq
1240136015     gbinv347.seq
 824225634     gbinv348.seq
1498393137     gbinv349.seq
1496624930     gbinv35.seq
 542931472     gbinv350.seq
1491758087     gbinv351.seq
 415614640     gbinv352.seq
1407782754     gbinv353.seq
 500660668     gbinv354.seq
1443611809     gbinv355.seq
 674031425     gbinv356.seq
1479938154     gbinv357.seq
1223421144     gbinv358.seq
1393719787     gbinv359.seq
 204078060     gbinv36.seq
1482861531     gbinv360.seq
1479953476     gbinv361.seq
1209325387     gbinv362.seq
 357962786     gbinv363.seq
1478381690     gbinv364.seq
 421175954     gbinv365.seq
1447728294     gbinv366.seq
 601914982     gbinv367.seq
1377783156     gbinv368.seq
 902573572     gbinv369.seq
1478381151     gbinv37.seq
1426894153     gbinv370.seq
 879778924     gbinv371.seq
1456066923     gbinv372.seq
1485824143     gbinv373.seq
 141189064     gbinv374.seq
1472791262     gbinv375.seq
1442050951     gbinv376.seq
  62656836     gbinv377.seq
1332945717     gbinv378.seq
1388892442     gbinv379.seq
 277391075     gbinv38.seq
 263791263     gbinv380.seq
1472556828     gbinv381.seq
1161993956     gbinv382.seq
1496224837     gbinv383.seq
1136721010     gbinv384.seq
1351507764     gbinv385.seq
1212772183     gbinv386.seq
1478983332     gbinv387.seq
1285994500     gbinv388.seq
1397715201     gbinv389.seq
1476172723     gbinv39.seq
 982484040     gbinv390.seq
1471745710     gbinv391.seq
1469784460     gbinv392.seq
1490304786     gbinv393.seq
1139848900     gbinv394.seq
1459727733     gbinv395.seq
1406579342     gbinv396.seq
 299175085     gbinv397.seq
1440324771     gbinv398.seq
 634804122     gbinv399.seq
 448191300     gbinv4.seq
 241897360     gbinv40.seq
1476156793     gbinv400.seq
 583773776     gbinv401.seq
1439439559     gbinv402.seq
 590897802     gbinv403.seq
 869432927     gbinv404.seq
2729769834     gbinv405.seq
1951209797     gbinv406.seq
1255792905     gbinv407.seq
 898357564     gbinv408.seq
 708100575     gbinv409.seq
1490840269     gbinv41.seq
1285990042     gbinv410.seq
 862289027     gbinv411.seq
1443272573     gbinv412.seq
 530056032     gbinv413.seq
1455700870     gbinv414.seq
 289519034     gbinv415.seq
1496990721     gbinv416.seq
 400324666     gbinv417.seq
1484025346     gbinv418.seq
 234725199     gbinv419.seq
 247566661     gbinv42.seq
1496745524     gbinv420.seq
 219755877     gbinv421.seq
1473176550     gbinv422.seq
 250139837     gbinv423.seq
1490216426     gbinv424.seq
 245438038     gbinv425.seq
1421504392     gbinv426.seq
 389948490     gbinv427.seq
1456740438     gbinv428.seq
 332242654     gbinv429.seq
1483209265     gbinv43.seq
1495130891     gbinv430.seq
 323405403     gbinv431.seq
1490655527     gbinv432.seq
 314601722     gbinv433.seq
1485311445     gbinv434.seq
 487095099     gbinv435.seq
1477554828     gbinv436.seq
 615885650     gbinv437.seq
1493130408     gbinv438.seq
 530737214     gbinv439.seq
 247826516     gbinv44.seq
1497402423     gbinv440.seq
 496766028     gbinv441.seq
1388528914     gbinv442.seq
 382943701     gbinv443.seq
1377089717     gbinv444.seq
 466011910     gbinv445.seq
1486110854     gbinv446.seq
 345122102     gbinv447.seq
1485700745     gbinv448.seq
 371367831     gbinv449.seq
1454074717     gbinv45.seq
1490043094     gbinv450.seq
 289247942     gbinv451.seq
1428729976     gbinv452.seq
 461978251     gbinv453.seq
1456581853     gbinv454.seq
 126003479     gbinv455.seq
1480297042     gbinv456.seq
 659311954     gbinv457.seq
1483437625     gbinv458.seq
 586388071     gbinv459.seq
 308472259     gbinv46.seq
1434897706     gbinv460.seq
 660034729     gbinv461.seq
1485826608     gbinv462.seq
 603779440     gbinv463.seq
1479700425     gbinv464.seq
 565812317     gbinv465.seq
1493710702     gbinv466.seq
 594270540     gbinv467.seq
1463114920     gbinv468.seq
 961101608     gbinv469.seq
1332046634     gbinv47.seq
1468567869     gbinv470.seq
 305294342     gbinv471.seq
1490770719     gbinv472.seq
 876126175     gbinv473.seq
1485474619     gbinv474.seq
 864451948     gbinv475.seq
1491363203     gbinv476.seq
 866828741     gbinv477.seq
1340897041     gbinv478.seq
1497646503     gbinv479.seq
1030101320     gbinv48.seq
 258588435     gbinv480.seq
1491648578     gbinv481.seq
 422460477     gbinv482.seq
1469557945     gbinv483.seq
 583322803     gbinv484.seq
1473586952     gbinv485.seq
 512626556     gbinv486.seq
1484985659     gbinv487.seq
 475110570     gbinv488.seq
1460025895     gbinv489.seq
1278053548     gbinv49.seq
 480742216     gbinv490.seq
1418812379     gbinv491.seq
 564645002     gbinv492.seq
1471722405     gbinv493.seq
 546679836     gbinv494.seq
1464315366     gbinv495.seq
1488596506     gbinv496.seq
  33427006     gbinv497.seq
1482877481     gbinv498.seq
1490889124     gbinv499.seq
1499532558     gbinv5.seq
 650487144     gbinv50.seq
  90441378     gbinv500.seq
1476477408     gbinv501.seq
 480868562     gbinv502.seq
1464325796     gbinv503.seq
1338568836     gbinv504.seq
 480059394     gbinv505.seq
1496895763     gbinv506.seq
 342037518     gbinv507.seq
1484204605     gbinv508.seq
 583980876     gbinv509.seq
1479054590     gbinv51.seq
1483484812     gbinv510.seq
 433456206     gbinv511.seq
1498027089     gbinv512.seq
 871379341     gbinv513.seq
1474039476     gbinv514.seq
 920098493     gbinv515.seq
1484696408     gbinv516.seq
 837001192     gbinv517.seq
1474790353     gbinv518.seq
 971677762     gbinv519.seq
 395398421     gbinv52.seq
1488358577     gbinv520.seq
 988576390     gbinv521.seq
1493913751     gbinv522.seq
1337790154     gbinv523.seq
1482674926     gbinv524.seq
1393357388     gbinv525.seq
1483083030     gbinv526.seq
1347199508     gbinv527.seq
1390153087     gbinv528.seq
 746496786     gbinv529.seq
1498186435     gbinv53.seq
1405110366     gbinv530.seq
 490736101     gbinv531.seq
1495749208     gbinv532.seq
 622207073     gbinv533.seq
1477768331     gbinv534.seq
 442461420     gbinv535.seq
1496013057     gbinv536.seq
 688690731     gbinv537.seq
1470664484     gbinv538.seq
 735441637     gbinv539.seq
 804909390     gbinv54.seq
1476090858     gbinv540.seq
 674365936     gbinv541.seq
1473275233     gbinv542.seq
 693591870     gbinv543.seq
1487352246     gbinv544.seq
 349494731     gbinv545.seq
1490482586     gbinv546.seq
 357339548     gbinv547.seq
1490279069     gbinv548.seq
 380118841     gbinv549.seq
1489731441     gbinv55.seq
1482629494     gbinv550.seq
 463916298     gbinv551.seq
1499586214     gbinv552.seq
 876874119     gbinv553.seq
1489968687     gbinv554.seq
 880061477     gbinv555.seq
1483044191     gbinv556.seq
1445615250     gbinv557.seq
 403386358     gbinv558.seq
1426566075     gbinv559.seq
 737332801     gbinv56.seq
1496817860     gbinv560.seq
 223857543     gbinv561.seq
1483084573     gbinv562.seq
1474052588     gbinv563.seq
1471567223     gbinv564.seq
 277662519     gbinv565.seq
1490877824     gbinv566.seq
 234260561     gbinv567.seq
1397325934     gbinv568.seq
 256237162     gbinv569.seq
 907425481     gbinv57.seq
1466164356     gbinv570.seq
1480718563     gbinv571.seq
 357065534     gbinv572.seq
1402593345     gbinv573.seq
 417293984     gbinv574.seq
1477814635     gbinv575.seq
 508922492     gbinv576.seq
1483472015     gbinv577.seq
 307039761     gbinv578.seq
1481273614     gbinv579.seq
1490935406     gbinv58.seq
 296798815     gbinv580.seq
1486500129     gbinv581.seq
 298302504     gbinv582.seq
1341735347     gbinv583.seq
 397549581     gbinv584.seq
1412631682     gbinv585.seq
 337603338     gbinv586.seq
1486261599     gbinv587.seq
 284851118     gbinv588.seq
1473724294     gbinv589.seq
 544785313     gbinv59.seq
 303768123     gbinv590.seq
1482098162     gbinv591.seq
1493449401     gbinv592.seq
 186693625     gbinv593.seq
1474232828     gbinv594.seq
1456821165     gbinv595.seq
1288636561     gbinv596.seq
 266841777     gbinv597.seq
1454813168     gbinv598.seq
 598400576     gbinv599.seq
 376885091     gbinv6.seq
1498785008     gbinv60.seq
1466601574     gbinv600.seq
 442907988     gbinv601.seq
1456573641     gbinv602.seq
 450458935     gbinv603.seq
1382342143     gbinv604.seq
1311359408     gbinv605.seq
1469464974     gbinv606.seq
1410573714     gbinv607.seq
 172769725     gbinv608.seq
1475074278     gbinv609.seq
 603657088     gbinv61.seq
1047572275     gbinv610.seq
1493941367     gbinv611.seq
1320519774     gbinv612.seq
1360414353     gbinv613.seq
 549289075     gbinv614.seq
1433764026     gbinv615.seq
 763646403     gbinv616.seq
1485107474     gbinv617.seq
 383346236     gbinv618.seq
1496398328     gbinv619.seq
1479614288     gbinv62.seq
1405593335     gbinv620.seq
 282285546     gbinv621.seq
1488486307     gbinv622.seq
 139774590     gbinv623.seq
1486138248     gbinv624.seq
1495956862     gbinv625.seq
 200580819     gbinv626.seq
1364141678     gbinv627.seq
1445853769     gbinv628.seq
 464187387     gbinv629.seq
 622090538     gbinv63.seq
1456011602     gbinv630.seq
1492021897     gbinv631.seq
1455513038     gbinv632.seq
 607420336     gbinv633.seq
1457809849     gbinv634.seq
 391487819     gbinv635.seq
1493536102     gbinv636.seq
 405891713     gbinv637.seq
1494386441     gbinv638.seq
 898135207     gbinv639.seq
1493842327     gbinv64.seq
1498797785     gbinv640.seq
 420062004     gbinv641.seq
1487421789     gbinv642.seq
1359918423     gbinv643.seq
1446355632     gbinv644.seq
 416385113     gbinv645.seq
1487964141     gbinv646.seq
 622377949     gbinv647.seq
1330488898     gbinv648.seq
 781012844     gbinv649.seq
1416177336     gbinv65.seq
1494742476     gbinv650.seq
 359613667     gbinv651.seq
1495531651     gbinv652.seq
 730071997     gbinv653.seq
 882426802     gbinv654.seq
1391549013     gbinv655.seq
 348223370     gbinv656.seq
1480519637     gbinv657.seq
1019143842     gbinv658.seq
1471388777     gbinv659.seq
 119585423     gbinv66.seq
 991065078     gbinv660.seq
1496789782     gbinv661.seq
 916577370     gbinv662.seq
1328094736     gbinv663.seq
1293174012     gbinv664.seq
1487955820     gbinv665.seq
1058914911     gbinv666.seq
1315022365     gbinv667.seq
1495303361     gbinv668.seq
 579569335     gbinv669.seq
1491972535     gbinv67.seq
1339680698     gbinv670.seq
1033801010     gbinv671.seq
1444565030     gbinv672.seq
 506481911     gbinv673.seq
1431143280     gbinv674.seq
1487474924     gbinv675.seq
 188364630     gbinv676.seq
1485486972     gbinv677.seq
1490457877     gbinv678.seq
 143748171     gbinv679.seq
1373956709     gbinv68.seq
1480393377     gbinv680.seq
1455854789     gbinv681.seq
1430191058     gbinv682.seq
1491332213     gbinv683.seq
 561720368     gbinv684.seq
1414146754     gbinv685.seq
1468601310     gbinv686.seq
1496553038     gbinv687.seq
 896187392     gbinv688.seq
1455214357     gbinv689.seq
1475287000     gbinv69.seq
 438664195     gbinv690.seq
1399948877     gbinv691.seq
 664645337     gbinv692.seq
1479610876     gbinv693.seq
 579018913     gbinv694.seq
1449261388     gbinv695.seq
 641464470     gbinv696.seq
1478015439     gbinv697.seq
 626080102     gbinv698.seq
1477053842     gbinv699.seq
1499042801     gbinv7.seq
 813062851     gbinv70.seq
 690971066     gbinv700.seq
1495345098     gbinv701.seq
 533918523     gbinv702.seq
1363404622     gbinv703.seq
 667544827     gbinv704.seq
1285411718     gbinv705.seq
 442095444     gbinv706.seq
1439898744     gbinv707.seq
1235239831     gbinv708.seq
1456319177     gbinv709.seq
1484969356     gbinv71.seq
1193234454     gbinv710.seq
1313629197     gbinv711.seq
 247425525     gbinv712.seq
1499807967     gbinv713.seq
 404075944     gbinv714.seq
1490770554     gbinv715.seq
 250762610     gbinv716.seq
1477609082     gbinv717.seq
 547072028     gbinv718.seq
1461590078     gbinv719.seq
 962155388     gbinv72.seq
 759983319     gbinv720.seq
1435908609     gbinv721.seq
1484827153     gbinv722.seq
 363604107     gbinv723.seq
1492209083     gbinv724.seq
 367366059     gbinv725.seq
1499784421     gbinv726.seq
1104373125     gbinv727.seq
1493069824     gbinv728.seq
1215456811     gbinv729.seq
1491078346     gbinv73.seq
1486397133     gbinv730.seq
1246006985     gbinv731.seq
1247632781     gbinv732.seq
1469774909     gbinv733.seq
1226701605     gbinv734.seq
1306210890     gbinv735.seq
 220144678     gbinv736.seq
1489544639     gbinv737.seq
1357913570     gbinv738.seq
1409850073     gbinv739.seq
 928003060     gbinv74.seq
 362223579     gbinv740.seq
1485497031     gbinv741.seq
 491448177     gbinv742.seq
1492301654     gbinv743.seq
1204981677     gbinv744.seq
1498916960     gbinv745.seq
 364756780     gbinv746.seq
1477226845     gbinv747.seq
 422540971     gbinv748.seq
1466569383     gbinv749.seq
1498796751     gbinv75.seq
 357530571     gbinv750.seq
1468997307     gbinv751.seq
1452486126     gbinv752.seq
1483476796     gbinv753.seq
1365877479     gbinv754.seq
 178767394     gbinv755.seq
1489624021     gbinv756.seq
1487080559     gbinv757.seq
  48852926     gbinv758.seq
1449894789     gbinv759.seq
 867076088     gbinv76.seq
1395302798     gbinv760.seq
 253522578     gbinv761.seq
1486157289     gbinv762.seq
 696173833     gbinv763.seq
1458416908     gbinv764.seq
 814939774     gbinv765.seq
1479062801     gbinv766.seq
 738037935     gbinv767.seq
1217976463     gbinv768.seq
1046588527     gbinv769.seq
1495747298     gbinv77.seq
1422565381     gbinv770.seq
 980137269     gbinv771.seq
1479037894     gbinv772.seq
1017570522     gbinv773.seq
1489307606     gbinv774.seq
 980324643     gbinv775.seq
1483121377     gbinv776.seq
 506324386     gbinv777.seq
1338271714     gbinv778.seq
 670841568     gbinv779.seq
 854906901     gbinv78.seq
1451740301     gbinv780.seq
 488926617     gbinv781.seq
1460298086     gbinv782.seq
 663465644     gbinv783.seq
1445208000     gbinv784.seq
 699506754     gbinv785.seq
1479519514     gbinv786.seq
 678461699     gbinv787.seq
1477356782     gbinv788.seq
 774075524     gbinv789.seq
1488751864     gbinv79.seq
1498154189     gbinv790.seq
1033186830     gbinv791.seq
 685164990     gbinv792.seq
1438661071     gbinv793.seq
1489193064     gbinv794.seq
 450968981     gbinv795.seq
1488632788     gbinv796.seq
 712610593     gbinv797.seq
1477656292     gbinv798.seq
 785779795     gbinv799.seq
 918439794     gbinv8.seq
 819265355     gbinv80.seq
1425379516     gbinv800.seq
 787269807     gbinv801.seq
1474254297     gbinv802.seq
1437961059     gbinv803.seq
 256713283     gbinv804.seq
1484529176     gbinv805.seq
 625639021     gbinv806.seq
1494007341     gbinv807.seq
 862604065     gbinv808.seq
1469080509     gbinv809.seq
1492563121     gbinv81.seq
1221427361     gbinv810.seq
1447358318     gbinv811.seq
1267036515     gbinv812.seq
 641221432     gbinv813.seq
1437902242     gbinv814.seq
 882000540     gbinv815.seq
1149657667     gbinv816.seq
1212500670     gbinv817.seq
1061903042     gbinv818.seq
1279027406     gbinv819.seq
 271764939     gbinv82.seq
1488412066     gbinv820.seq
 946772983     gbinv821.seq
1469421448     gbinv822.seq
 408517361     gbinv823.seq
1488068921     gbinv824.seq
1074331561     gbinv825.seq
1471446714     gbinv826.seq
1089245394     gbinv827.seq
1496624861     gbinv828.seq
 363003470     gbinv829.seq
1499996709     gbinv83.seq
1486563514     gbinv830.seq
 412890780     gbinv831.seq
1494065365     gbinv832.seq
 418733099     gbinv833.seq
1475737261     gbinv834.seq
 340704941     gbinv835.seq
1485085997     gbinv836.seq
1049160877     gbinv837.seq
1171084260     gbinv838.seq
 339697667     gbinv839.seq
 101558798     gbinv84.seq
1444118018     gbinv840.seq
 591016312     gbinv841.seq
1496010311     gbinv842.seq
 124374618     gbinv843.seq
1477313812     gbinv844.seq
1483445786     gbinv845.seq
  91128417     gbinv846.seq
1338370292     gbinv847.seq
 733987331     gbinv848.seq
1471879735     gbinv849.seq
1406802219     gbinv85.seq
1053677687     gbinv850.seq
 671628694     gbinv851.seq
1388129956     gbinv852.seq
 295588391     gbinv853.seq
1433770265     gbinv854.seq
 476835269     gbinv855.seq
1433410472     gbinv856.seq
 438228696     gbinv857.seq
1250726673     gbinv858.seq
 611825037     gbinv859.seq
1182695720     gbinv86.seq
1493699074     gbinv860.seq
 525660640     gbinv861.seq
1486072334     gbinv862.seq
 322132118     gbinv863.seq
1402544732     gbinv864.seq
 423016322     gbinv865.seq
1475530293     gbinv866.seq
1499027380     gbinv867.seq
1396587458     gbinv868.seq
1394302822     gbinv869.seq
1126276629     gbinv87.seq
 528217521     gbinv870.seq
1466230627     gbinv871.seq
1343924683     gbinv872.seq
 774782659     gbinv873.seq
1401591455     gbinv874.seq
1155865188     gbinv875.seq
 837350261     gbinv876.seq
1441258603     gbinv877.seq
1462770311     gbinv878.seq
 572595067     gbinv879.seq
1153105469     gbinv88.seq
1382009986     gbinv880.seq
 608028412     gbinv881.seq
1380331263     gbinv882.seq
 438520090     gbinv883.seq
1470077879     gbinv884.seq
 783762965     gbinv885.seq
1176366200     gbinv886.seq
 608322919     gbinv887.seq
1205408689     gbinv888.seq
1104142746     gbinv889.seq
1157048235     gbinv89.seq
1036632038     gbinv890.seq
 923782898     gbinv891.seq
1217966648     gbinv892.seq
1082974717     gbinv893.seq
1128407176     gbinv894.seq
 731766010     gbinv895.seq
1443670782     gbinv896.seq
 922178852     gbinv897.seq
1347794179     gbinv898.seq
 747649030     gbinv899.seq
1493251903     gbinv9.seq
1191511440     gbinv90.seq
1460306287     gbinv900.seq
 900427213     gbinv901.seq
1477710109     gbinv902.seq
 792551859     gbinv903.seq
1409054861     gbinv904.seq
 896382991     gbinv905.seq
1269865578     gbinv906.seq
1301155539     gbinv907.seq
 943349247     gbinv908.seq
 878734428     gbinv909.seq
1247541920     gbinv91.seq
 874599051     gbinv910.seq
 872525010     gbinv911.seq
 810605264     gbinv912.seq
 791733648     gbinv913.seq
 789407447     gbinv914.seq
 782472280     gbinv915.seq
1478877159     gbinv916.seq
1425054466     gbinv917.seq
1232428257     gbinv918.seq
1159914346     gbinv919.seq
1499997818     gbinv92.seq
1489477121     gbinv920.seq
 427244069     gbinv921.seq
1497897156     gbinv922.seq
 548539976     gbinv923.seq
1436968217     gbinv924.seq
 933768365     gbinv925.seq
1491275346     gbinv926.seq
 869474520     gbinv927.seq
1450231548     gbinv928.seq
1342340551     gbinv929.seq
 681259685     gbinv93.seq
1451776732     gbinv930.seq
 540560242     gbinv931.seq
1476017219     gbinv932.seq
 983921298     gbinv933.seq
1447912985     gbinv934.seq
1437245729     gbinv935.seq
1480916438     gbinv936.seq
 561131412     gbinv937.seq
1477416158     gbinv938.seq
 815721365     gbinv939.seq
 955572480     gbinv94.seq
1489540966     gbinv940.seq
 649631068     gbinv941.seq
1486418220     gbinv942.seq
1485766453     gbinv943.seq
 299017541     gbinv944.seq
1447293450     gbinv945.seq
1424436854     gbinv946.seq
 555359826     gbinv947.seq
1490369912     gbinv948.seq
1454124707     gbinv949.seq
 289059083     gbinv95.seq
 236657036     gbinv950.seq
1410657895     gbinv951.seq
1499881679     gbinv952.seq
 352677392     gbinv953.seq
1494772634     gbinv954.seq
 688582722     gbinv955.seq
1499431451     gbinv956.seq
 805871519     gbinv957.seq
1453297195     gbinv958.seq
 773837307     gbinv959.seq
  54983086     gbinv96.seq
1335852192     gbinv960.seq
 527825304     gbinv961.seq
1476565583     gbinv962.seq
 680958925     gbinv963.seq
1463772379     gbinv964.seq
 562324008     gbinv965.seq
1496442964     gbinv966.seq
 559742644     gbinv967.seq
1479845810     gbinv968.seq
 358265933     gbinv969.seq
  52942590     gbinv97.seq
1445692355     gbinv970.seq
 591239914     gbinv971.seq
1409906324     gbinv972.seq
 564609714     gbinv973.seq
1375758712     gbinv974.seq
 814258094     gbinv975.seq
1465790531     gbinv976.seq
 710509361     gbinv977.seq
1332386478     gbinv978.seq
1007465375     gbinv979.seq
 157078175     gbinv98.seq
1483491452     gbinv980.seq
1218171606     gbinv981.seq
1446948614     gbinv982.seq
1107260814     gbinv983.seq
1488515265     gbinv984.seq
1090427935     gbinv985.seq
1473901953     gbinv986.seq
1041928661     gbinv987.seq
1441427152     gbinv988.seq
1386697076     gbinv989.seq
 768189501     gbinv99.seq
 608783665     gbinv990.seq
1499618036     gbinv991.seq
 297893234     gbinv992.seq
1476443088     gbinv993.seq
 573065947     gbinv994.seq
1191529685     gbinv995.seq
1176457428     gbinv996.seq
1118724487     gbinv997.seq
1448943866     gbinv998.seq
 374045261     gbinv999.seq
1299915269     gbmam1.seq
 417714201     gbmam10.seq
1453876757     gbmam100.seq
1208505762     gbmam101.seq
1376302879     gbmam102.seq
1359500385     gbmam103.seq
 238286100     gbmam104.seq
1395204913     gbmam105.seq
1360844519     gbmam106.seq
1426041019     gbmam107.seq
 981344570     gbmam108.seq
1452412349     gbmam109.seq
1454600951     gbmam11.seq
1422874419     gbmam110.seq
 408481718     gbmam111.seq
1493203952     gbmam112.seq
 306899300     gbmam113.seq
1348484898     gbmam114.seq
 529814629     gbmam115.seq
1479589965     gbmam116.seq
1003077901     gbmam117.seq
1442404259     gbmam118.seq
 834292000     gbmam119.seq
1491732579     gbmam12.seq
1482830562     gbmam120.seq
1108515895     gbmam121.seq
1356418005     gbmam122.seq
1450451476     gbmam123.seq
 198338337     gbmam124.seq
1472637635     gbmam125.seq
1481463696     gbmam126.seq
 142270519     gbmam127.seq
1405794202     gbmam128.seq
1483682369     gbmam129.seq
 132948661     gbmam13.seq
 277715394     gbmam130.seq
1432986514     gbmam131.seq
 919898592     gbmam132.seq
1355826661     gbmam133.seq
1012666587     gbmam134.seq
1492187184     gbmam135.seq
 927075547     gbmam136.seq
1474648453     gbmam137.seq
 442335081     gbmam138.seq
1494089828     gbmam139.seq
1443615542     gbmam14.seq
 503907043     gbmam140.seq
1318911633     gbmam141.seq
 610345039     gbmam142.seq
1338335661     gbmam143.seq
 731448449     gbmam144.seq
1387099171     gbmam145.seq
 546743394     gbmam146.seq
1323529426     gbmam147.seq
 713158415     gbmam148.seq
1443855143     gbmam149.seq
 531711770     gbmam15.seq
 570951834     gbmam150.seq
1265660771     gbmam151.seq
 845102809     gbmam152.seq
1479725176     gbmam153.seq
 768765653     gbmam154.seq
1499323699     gbmam155.seq
 993450991     gbmam156.seq
1492397698     gbmam157.seq
 933948278     gbmam158.seq
1395293696     gbmam159.seq
1417477477     gbmam16.seq
1410692302     gbmam160.seq
 560290656     gbmam17.seq
1491564169     gbmam18.seq
 313468224     gbmam19.seq
 477148353     gbmam2.seq
1499406394     gbmam20.seq
1062035477     gbmam21.seq
1485199324     gbmam22.seq
1304037351     gbmam23.seq
  33997170     gbmam24.seq
   9943311     gbmam25.seq
  43988539     gbmam26.seq
  91321391     gbmam27.seq
  88809559     gbmam28.seq
   6368091     gbmam29.seq
1469194323     gbmam3.seq
  21014407     gbmam30.seq
 449670982     gbmam31.seq
1459771977     gbmam32.seq
1181085315     gbmam33.seq
1499997204     gbmam34.seq
 925707953     gbmam35.seq
 839494897     gbmam36.seq
 774395849     gbmam37.seq
1382131671     gbmam38.seq
1055303580     gbmam39.seq
 505262074     gbmam4.seq
1486708589     gbmam40.seq
 801027075     gbmam41.seq
1455155074     gbmam42.seq
 830552794     gbmam43.seq
1430736721     gbmam44.seq
 988623453     gbmam45.seq
1463225227     gbmam46.seq
1040235734     gbmam47.seq
1494406931     gbmam48.seq
1375647073     gbmam49.seq
  82858357     gbmam5.seq
1383327549     gbmam50.seq
1473290653     gbmam51.seq
 427109587     gbmam52.seq
1378869423     gbmam53.seq
1482299281     gbmam54.seq
 326072158     gbmam55.seq
1427810688     gbmam56.seq
1423540895     gbmam57.seq
 408291238     gbmam58.seq
1416530939     gbmam59.seq
  71296832     gbmam6.seq
1476987068     gbmam60.seq
 508139671     gbmam61.seq
1363509726     gbmam62.seq
 287465617     gbmam63.seq
1433940672     gbmam64.seq
 390298771     gbmam65.seq
1374324242     gbmam66.seq
 733536654     gbmam67.seq
1468553408     gbmam68.seq
 405323312     gbmam69.seq
  22560540     gbmam7.seq
1426269234     gbmam70.seq
 733331809     gbmam71.seq
1407233551     gbmam72.seq
 980079942     gbmam73.seq
1443508442     gbmam74.seq
 780606100     gbmam75.seq
1424198150     gbmam76.seq
 345212223     gbmam77.seq
1483991847     gbmam78.seq
 394044617     gbmam79.seq
   1268287     gbmam8.seq
1407365695     gbmam80.seq
 225944986     gbmam81.seq
1441479785     gbmam82.seq
 469953642     gbmam83.seq
1344156069     gbmam84.seq
 375382416     gbmam85.seq
1405793836     gbmam86.seq
 329856861     gbmam87.seq
1451013217     gbmam88.seq
 268468304     gbmam89.seq
1344982518     gbmam9.seq
1414660891     gbmam90.seq
 465828460     gbmam91.seq
1456302791     gbmam92.seq
 544855283     gbmam93.seq
1316003894     gbmam94.seq
 825457176     gbmam95.seq
1465506656     gbmam96.seq
 834197259     gbmam97.seq
1442051765     gbmam98.seq
 821884488     gbmam99.seq
   4852556     gbnew.txt
1061257253     gbpat1.seq
 666881621     gbpat10.seq
1499998960     gbpat100.seq
 187733203     gbpat101.seq
1481546501     gbpat102.seq
1385155853     gbpat103.seq
1435129832     gbpat104.seq
1107869813     gbpat105.seq
1163545267     gbpat106.seq
1415198367     gbpat107.seq
1499993135     gbpat108.seq
 256684826     gbpat109.seq
1213212603     gbpat11.seq
 906229344     gbpat12.seq
1126662943     gbpat13.seq
1500000073     gbpat14.seq
 140158506     gbpat15.seq
1499513380     gbpat16.seq
 638473861     gbpat17.seq
1499999263     gbpat18.seq
  87884373     gbpat19.seq
1419247207     gbpat2.seq
1499999022     gbpat20.seq
 130974440     gbpat21.seq
1185008925     gbpat22.seq
1137264062     gbpat23.seq
1429497634     gbpat24.seq
 821477812     gbpat25.seq
1306528109     gbpat26.seq
1144915269     gbpat27.seq
 726234433     gbpat28.seq
1309498169     gbpat29.seq
1317353015     gbpat3.seq
1259593484     gbpat30.seq
1036781105     gbpat31.seq
 974766108     gbpat32.seq
 831709767     gbpat33.seq
 812347725     gbpat34.seq
1499998610     gbpat35.seq
 205998958     gbpat36.seq
 955869012     gbpat37.seq
 752680082     gbpat38.seq
1083033126     gbpat39.seq
1179042848     gbpat4.seq
 998235851     gbpat40.seq
1499998334     gbpat41.seq
 228716814     gbpat42.seq
1499999586     gbpat43.seq
 335512964     gbpat44.seq
1210705682     gbpat45.seq
1174066991     gbpat46.seq
1499994102     gbpat47.seq
   8881342     gbpat48.seq
 882583557     gbpat49.seq
1062753836     gbpat5.seq
1499991636     gbpat50.seq
 556648641     gbpat51.seq
1208428269     gbpat52.seq
1059360857     gbpat53.seq
1488851256     gbpat54.seq
1028329766     gbpat55.seq
 885160478     gbpat56.seq
1148512936     gbpat57.seq
 814549393     gbpat58.seq
1409506237     gbpat59.seq
1422338371     gbpat6.seq
1125979685     gbpat60.seq
1499995298     gbpat61.seq
 669882508     gbpat62.seq
 926362020     gbpat63.seq
1499969755     gbpat64.seq
 353671289     gbpat65.seq
1291260619     gbpat66.seq
1499999221     gbpat67.seq
 102925314     gbpat68.seq
1499996917     gbpat69.seq
1499999663     gbpat7.seq
 801705817     gbpat70.seq
1499999478     gbpat71.seq
 319789165     gbpat72.seq
1500000152     gbpat73.seq
  13001800     gbpat74.seq
1499998093     gbpat75.seq
  84107819     gbpat76.seq
1499999641     gbpat77.seq
  39679778     gbpat78.seq
1499999591     gbpat79.seq
 347876060     gbpat8.seq
 595878571     gbpat80.seq
1500000234     gbpat81.seq
 590173332     gbpat82.seq
1499995529     gbpat83.seq
 504087653     gbpat84.seq
1499998928     gbpat85.seq
 478202128     gbpat86.seq
1321704167     gbpat87.seq
1350590572     gbpat88.seq
1418827872     gbpat89.seq
1499558017     gbpat9.seq
1335688240     gbpat90.seq
1499999385     gbpat91.seq
 361475056     gbpat92.seq
1336382704     gbpat93.seq
1366896121     gbpat94.seq
1388591258     gbpat95.seq
1498667620     gbpat96.seq
1021954216     gbpat97.seq
1499998729     gbpat98.seq
 988150300     gbpat99.seq
1500000000     gbphg1.seq
1499964240     gbphg2.seq
 382368236     gbphg3.seq
1499915935     gbpln1.seq
1065209035     gbpln10.seq
1490746088     gbpln100.seq
 771195581     gbpln1000.se
1452626437     gbpln1001.se
1452862185     gbpln1002.se
 666670554     gbpln1003.se
 841954477     gbpln1004.se
 801058908     gbpln1005.se
 777293273     gbpln1006.se
1485779606     gbpln1007.se
1452913123     gbpln1008.se
 836617455     gbpln1009.se
 928539912     gbpln101.seq
 790837080     gbpln1010.se
 777459211     gbpln1011.se
 747254822     gbpln1012.se
 706272554     gbpln1013.se
1454781570     gbpln1014.se
 839842771     gbpln1015.se
 793797446     gbpln1016.se
 776363695     gbpln1017.se
1456772382     gbpln1018.se
1466569984     gbpln1019.se
1454921806     gbpln102.seq
 845148876     gbpln1020.se
 804833075     gbpln1021.se
 778470840     gbpln1022.se
1481006671     gbpln1023.se
1474068833     gbpln1024.se
 794180240     gbpln1025.se
 774312133     gbpln1026.se
1457303715     gbpln1027.se
 835115958     gbpln1028.se
1457626965     gbpln1029.se
 838249670     gbpln103.seq
 836718376     gbpln1030.se
 801816184     gbpln1031.se
 780710757     gbpln1032.se
 754364739     gbpln1033.se
 733491153     gbpln1034.se
1468374098     gbpln1035.se
 835020955     gbpln1036.se
 794498288     gbpln1037.se
 775035874     gbpln1038.se
1474921682     gbpln1039.se
1492027099     gbpln104.seq
1459702205     gbpln1040.se
 836763144     gbpln1041.se
 794319485     gbpln1042.se
 771563218     gbpln1043.se
1442336042     gbpln1044.se
 796083444     gbpln1045.se
 665841375     gbpln1046.se
 835744193     gbpln1047.se
 793808494     gbpln1048.se
 775366859     gbpln1049.se
 456902623     gbpln105.seq
 744449290     gbpln1050.se
 708201546     gbpln1051.se
1461461120     gbpln1052.se
 839340148     gbpln1053.se
 793588555     gbpln1054.se
 778845059     gbpln1055.se
1471514124     gbpln1056.se
1460672453     gbpln1057.se
 847689175     gbpln1058.se
 797030463     gbpln1059.se
1464211798     gbpln106.seq
 776617524     gbpln1060.se
1450233858     gbpln1061.se
1469651463     gbpln1062.se
 834034797     gbpln1063.se
 795540701     gbpln1064.se
 776376885     gbpln1065.se
1448905128     gbpln1066.se
1457656304     gbpln1067.se
 833009352     gbpln1068.se
 797524540     gbpln1069.se
1007418262     gbpln107.seq
 773297930     gbpln1070.se
1451244889     gbpln1071.se
1454193216     gbpln1072.se
 830169429     gbpln1073.se
 793310457     gbpln1074.se
 773560290     gbpln1075.se
1446231891     gbpln1076.se
1450937303     gbpln1077.se
 835938341     gbpln1078.se
 795056321     gbpln1079.se
1496233196     gbpln108.seq
 770765157     gbpln1080.se
1475561524     gbpln1081.se
1466579245     gbpln1082.se
 829099164     gbpln1083.se
 790989379     gbpln1084.se
 773398673     gbpln1085.se
1462046272     gbpln1086.se
1449910042     gbpln1087.se
 837413052     gbpln1088.se
 790648527     gbpln1089.se
 626279429     gbpln109.seq
 772176401     gbpln1090.se
1460620041     gbpln1091.se
1455765886     gbpln1092.se
 833059054     gbpln1093.se
 794545184     gbpln1094.se
 774083177     gbpln1095.se
1448946753     gbpln1096.se
1458559584     gbpln1097.se
 835451342     gbpln1098.se
 794577233     gbpln1099.se
1329547562     gbpln11.seq
 818536598     gbpln110.seq
 775251446     gbpln1100.se
1454531761     gbpln1101.se
1463618989     gbpln1102.se
 836809812     gbpln1103.se
 806584862     gbpln1104.se
 776084155     gbpln1105.se
1485075661     gbpln1106.se
1448852265     gbpln1107.se
 836125457     gbpln1108.se
 794049612     gbpln1109.se
 744339771     gbpln111.seq
 769729355     gbpln1110.se
 742587081     gbpln1111.se
 727014800     gbpln1112.se
1458361301     gbpln1113.se
 840008504     gbpln1114.se
 794029694     gbpln1115.se
 769623341     gbpln1116.se
1477482614     gbpln1117.se
1456549528     gbpln1118.se
 836931236     gbpln1119.se
 840483636     gbpln112.seq
 792455888     gbpln1120.se
 768695354     gbpln1121.se
 749845408     gbpln1122.se
1496378667     gbpln1123.se
 659612022     gbpln1124.se
 835570197     gbpln1125.se
 798619346     gbpln1126.se
 776375847     gbpln1127.se
 751020200     gbpln1128.se
 717192214     gbpln1129.se
1482268558     gbpln113.seq
 803740372     gbpln1130.se
1492235450     gbpln1131.se
 793920035     gbpln1132.se
 773324985     gbpln1133.se
1443647684     gbpln1134.se
 793436257     gbpln1135.se
 665530976     gbpln1136.se
 834886228     gbpln1137.se
 792465315     gbpln1138.se
 766375549     gbpln1139.se
1445216054     gbpln114.seq
1449349195     gbpln1140.se
1457671779     gbpln1141.se
 836173230     gbpln1142.se
 792990723     gbpln1143.se
 774691916     gbpln1144.se
1452432506     gbpln1145.se
 797342703     gbpln1146.se
1496638015     gbpln1147.se
 804070482     gbpln1148.se
 777569920     gbpln1149.se
 372631992     gbpln115.seq
1461158646     gbpln1150.se
1466754128     gbpln1151.se
 830451601     gbpln1152.se
 798616435     gbpln1153.se
 774880678     gbpln1154.se
1455218535     gbpln1155.se
1460523331     gbpln1156.se
 837230145     gbpln1157.se
 796560308     gbpln1158.se
 777015504     gbpln1159.se
1467625507     gbpln116.seq
 751686997     gbpln1160.se
 703906948     gbpln1161.se
1455711383     gbpln1162.se
 838785071     gbpln1163.se
 791233293     gbpln1164.se
 770014685     gbpln1165.se
1450013191     gbpln1166.se
 795356170     gbpln1167.se
1495631000     gbpln1168.se
 793372574     gbpln1169.se
 401299113     gbpln117.seq
 769401747     gbpln1170.se
1456544663     gbpln1171.se
1465313453     gbpln1172.se
 839230685     gbpln1173.se
 803963907     gbpln1174.se
 778586682     gbpln1175.se
1463130395     gbpln1176.se
1457728697     gbpln1177.se
 832496071     gbpln1178.se
 797513192     gbpln1179.se
1462820325     gbpln118.seq
 776551156     gbpln1180.se
1449845840     gbpln1181.se
1460493739     gbpln1182.se
 839860091     gbpln1183.se
 789840368     gbpln1184.se
 776969912     gbpln1185.se
1450486337     gbpln1186.se
1014429015     gbpln1187.se
1476253038     gbpln1188.se
1108449375     gbpln1189.se
1144623389     gbpln119.seq
1352500221     gbpln1190.se
1271576965     gbpln1191.se
 575997766     gbpln1192.se
1111693114     gbpln1193.se
 480735429     gbpln1194.se
1499799432     gbpln1195.se
 287261970     gbpln1196.se
 903265270     gbpln1197.se
 659287868     gbpln1198.se
 830295693     gbpln1199.se
 339200186     gbpln12.seq
1461834256     gbpln120.seq
 794035728     gbpln1200.se
 766241777     gbpln1201.se
 750933536     gbpln1202.se
 701025885     gbpln1203.se
1460262157     gbpln1204.se
 800420442     gbpln1205.se
 807100878     gbpln1206.se
 813165275     gbpln1207.se
1489858794     gbpln1208.se
1463645427     gbpln1209.se
1282208769     gbpln121.seq
 836403024     gbpln1210.se
 797704105     gbpln1211.se
 771673145     gbpln1212.se
1489073756     gbpln1213.se
 803038467     gbpln1214.se
1494983263     gbpln1215.se
 794511021     gbpln1216.se
 765022116     gbpln1217.se
1450430027     gbpln1218.se
1446394679     gbpln1219.se
1487472399     gbpln122.seq
 837987830     gbpln1220.se
 795104781     gbpln1221.se
 772053911     gbpln1222.se
 744822794     gbpln1223.se
 709518859     gbpln1224.se
1471789737     gbpln1225.se
 159962507     gbpln1226.se
1451442059     gbpln1227.se
 474894144     gbpln1228.se
 820639220     gbpln1229.se
1238608963     gbpln123.seq
 834487583     gbpln1230.se
1438167305     gbpln1231.se
 942730875     gbpln1232.se
1413074394     gbpln1233.se
1271934713     gbpln1234.se
1485567802     gbpln1235.se
1184860474     gbpln1236.se
 756169196     gbpln1237.se
1245067321     gbpln1238.se
1442415305     gbpln1239.se
1498823682     gbpln124.seq
 498525119     gbpln1240.se
1480508801     gbpln1241.se
 251935681     gbpln1242.se
1489873164     gbpln1243.se
 669405908     gbpln1244.se
1003550591     gbpln1245.se
 818534977     gbpln1246.se
 744338029     gbpln1247.se
 840481828     gbpln1248.se
1482265733     gbpln1249.se
 450493017     gbpln125.seq
 867339882     gbpln1250.se
 665178568     gbpln1251.se
 840478319     gbpln1252.se
 804862544     gbpln1253.se
 775136193     gbpln1254.se
1456887584     gbpln1255.se
1470716689     gbpln1256.se
 836948259     gbpln1257.se
 794972859     gbpln1258.se
 775455598     gbpln1259.se
1415728346     gbpln126.seq
1463119445     gbpln1260.se
 794996206     gbpln1261.se
 656305255     gbpln1262.se
 852997313     gbpln1263.se
 798187575     gbpln1264.se
 776406263     gbpln1265.se
1458385249     gbpln1266.se
1463826120     gbpln1267.se
 833048862     gbpln1268.se
 794071582     gbpln1269.se
 488652574     gbpln127.seq
 772684697     gbpln1270.se
1454827832     gbpln1271.se
 793225130     gbpln1272.se
1497588685     gbpln1273.se
 798464996     gbpln1274.se
 775710033     gbpln1275.se
 744924658     gbpln1276.se
 719062576     gbpln1277.se
1455516963     gbpln1278.se
 827472017     gbpln1279.se
1121159029     gbpln128.seq
 799696373     gbpln1280.se
 771541363     gbpln1281.se
1456098533     gbpln1282.se
1450468258     gbpln1283.se
 830011447     gbpln1284.se
 803324869     gbpln1285.se
 778613518     gbpln1286.se
 757477427     gbpln1287.se
 728058413     gbpln1288.se
1460285834     gbpln1289.se
 565589051     gbpln129.seq
 834396522     gbpln1290.se
 793156442     gbpln1291.se
 771664945     gbpln1292.se
1460976066     gbpln1293.se
1472747650     gbpln1294.se
 831402033     gbpln1295.se
 788227480     gbpln1296.se
 773608315     gbpln1297.se
 756195357     gbpln1298.se
 703056123     gbpln1299.se
1220877249     gbpln13.seq
1249639254     gbpln130.seq
1457115869     gbpln1300.se
 833114761     gbpln1301.se
 791988363     gbpln1302.se
 773778680     gbpln1303.se
1439338108     gbpln1304.se
 798246923     gbpln1305.se
1494014271     gbpln1306.se
 790630518     gbpln1307.se
 774554078     gbpln1308.se
1459431387     gbpln1309.se
 920959563     gbpln131.seq
1462622889     gbpln1310.se
 841885928     gbpln1311.se
 814740283     gbpln1312.se
 781686950     gbpln1313.se
1470777020     gbpln1314.se
 817350531     gbpln1315.se
1493108072     gbpln1316.se
 803943397     gbpln1317.se
 776352617     gbpln1318.se
1461742228     gbpln1319.se
1225587576     gbpln132.seq
1468260082     gbpln1320.se
 833628952     gbpln1321.se
 800337028     gbpln1322.se
 775679569     gbpln1323.se
1485372410     gbpln1324.se
1470684487     gbpln1325.se
 837791026     gbpln1326.se
 805450455     gbpln1327.se
 782697461     gbpln1328.se
1462403294     gbpln1329.se
 946518369     gbpln133.seq
 810098655     gbpln1330.se
 661446766     gbpln1331.se
 844251896     gbpln1332.se
 800661389     gbpln1333.se
 770104661     gbpln1334.se
1486820730     gbpln1335.se
1437673274     gbpln1336.se
1239300617     gbpln1337.se
1472688110     gbpln1338.se
 542516421     gbpln1339.se
1120694900     gbpln134.seq
1497781051     gbpln1340.se
1000301686     gbpln1341.se
1474391497     gbpln1342.se
 880465505     gbpln1343.se
1479642284     gbpln1344.se
 390210590     gbpln1345.se
1475783456     gbpln1346.se
 386638564     gbpln1347.se
1494082682     gbpln1348.se
 920369574     gbpln1349.se
1163541839     gbpln135.seq
1451245782     gbpln1350.se
 432601888     gbpln1351.se
1496254118     gbpln1352.se
1375887719     gbpln1353.se
1252557046     gbpln1354.se
1083691486     gbpln1355.se
1421898882     gbpln1356.se
 731360424     gbpln1357.se
2734223096     gbpln1358.se
2727931901     gbpln1359.se
 650965042     gbpln136.seq
2720692598     gbpln1360.se
2732441076     gbpln1361.se
2733260927     gbpln1362.se
 157556535     gbpln1363.se
2694271430     gbpln1364.se
2735442486     gbpln1365.se
2720859722     gbpln1366.se
2732011308     gbpln1367.se
2383529845     gbpln1368.se
2723191931     gbpln1369.se
1492041796     gbpln137.seq
2689474086     gbpln1370.se
2737751830     gbpln1371.se
2700210160     gbpln1372.se
2006289519     gbpln1373.se
2636141786     gbpln1374.se
2722875815     gbpln1375.se
2725415454     gbpln1376.se
2730393002     gbpln1377.se
1948886785     gbpln1378.se
2738131093     gbpln1379.se
1445294745     gbpln138.seq
2727379378     gbpln1380.se
2679871098     gbpln1381.se
2737685310     gbpln1382.se
 786720890     gbpln1383.se
2727907345     gbpln1384.se
2657432129     gbpln1385.se
2735229991     gbpln1386.se
2728645371     gbpln1387.se
 218791011     gbpln1388.se
2719617838     gbpln1389.se
 419639997     gbpln139.seq
2721885171     gbpln1390.se
2721092581     gbpln1391.se
2679558604     gbpln1392.se
 181580803     gbpln1393.se
2722179116     gbpln1394.se
2736369220     gbpln1395.se
2726783046     gbpln1396.se
2440060122     gbpln1397.se
2736724965     gbpln1398.se
2696541624     gbpln1399.se
 492842184     gbpln14.seq
1427470803     gbpln140.seq
 422496617     gbpln1400.se
2731302183     gbpln1401.se
2702984894     gbpln1402.se
2732485324     gbpln1403.se
1906858977     gbpln1404.se
1333776538     gbpln1405.se
 366349995     gbpln1406.se
1478630796     gbpln1407.se
1339182106     gbpln1408.se
1431604314     gbpln1409.se
1155687559     gbpln141.seq
1278608219     gbpln1410.se
1257873412     gbpln1411.se
1295731353     gbpln1412.se
 718233528     gbpln1413.se
1291263007     gbpln1414.se
1286241557     gbpln1415.se
1294607816     gbpln1416.se
 682550439     gbpln1417.se
1244306965     gbpln1418.se
1229287067     gbpln1419.se
1457505595     gbpln142.seq
1239215741     gbpln1420.se
 658635449     gbpln1421.se
1227045645     gbpln1422.se
1241387178     gbpln1423.se
 568398582     gbpln1424.se
1451146676     gbpln1425.se
 608730243     gbpln1426.se
1194598426     gbpln1427.se
1267961203     gbpln1428.se
1465598311     gbpln1429.se
 672317516     gbpln143.seq
 605904859     gbpln1430.se
1211807832     gbpln1431.se
1270318273     gbpln1432.se
1429873158     gbpln1433.se
 642562848     gbpln1434.se
1201259963     gbpln1435.se
1114385426     gbpln1436.se
1428292861     gbpln1437.se
 617624847     gbpln1438.se
1189205804     gbpln1439.se
1473831455     gbpln144.seq
1121198560     gbpln1440.se
 691947282     gbpln1441.se
1193254570     gbpln1442.se
 623008870     gbpln1443.se
1169793616     gbpln1444.se
1196787416     gbpln1445.se
1107335684     gbpln1446.se
1110445392     gbpln1447.se
1215984046     gbpln1448.se
1274875612     gbpln1449.se
 390992687     gbpln145.seq
1168979121     gbpln1450.se
 533030891     gbpln1451.se
1179251584     gbpln1452.se
1319824235     gbpln1453.se
1194499724     gbpln1454.se
1150884296     gbpln1455.se
1260272463     gbpln1456.se
1277796253     gbpln1457.se
1077009674     gbpln1458.se
 596414735     gbpln1459.se
1444300010     gbpln146.seq
1259716685     gbpln1460.se
1082028871     gbpln1461.se
1156068258     gbpln1462.se
1092988656     gbpln1463.se
1294048234     gbpln1464.se
1076722872     gbpln1465.se
 465690537     gbpln1466.se
1155398206     gbpln1467.se
 700947969     gbpln1468.se
1224815553     gbpln1469.se
1464348225     gbpln147.seq
1109978919     gbpln1470.se
 549436340     gbpln1471.se
1263097017     gbpln1472.se
 665776881     gbpln1473.se
1235574924     gbpln1474.se
1264341710     gbpln1475.se
 673868938     gbpln1476.se
1263623363     gbpln1477.se
 633286407     gbpln1478.se
1197205337     gbpln1479.se
1497386714     gbpln148.seq
1237679873     gbpln1480.se
1312659113     gbpln1481.se
 604892488     gbpln1482.se
1400966271     gbpln1483.se
1382372150     gbpln1484.se
1176735774     gbpln1485.se
 693282470     gbpln1486.se
1202343442     gbpln1487.se
1264869868     gbpln1488.se
1017777200     gbpln1489.se
 351776026     gbpln149.seq
1203792449     gbpln1490.se
1383213588     gbpln1491.se
1260660216     gbpln1492.se
1233634175     gbpln1493.se
 563260621     gbpln1494.se
1296551517     gbpln1495.se
1158563945     gbpln1496.se
1059918971     gbpln1497.se
 548217914     gbpln1498.se
1341167222     gbpln1499.se
1490330698     gbpln15.seq
1495030508     gbpln150.seq
1178297011     gbpln1500.se
 504851755     gbpln1501.se
1193454949     gbpln1502.se
 618979127     gbpln1503.se
1165155999     gbpln1504.se
1145365869     gbpln1505.se
 594649456     gbpln1506.se
1136283639     gbpln1507.se
 675038822     gbpln1508.se
1200907806     gbpln1509.se
 746896982     gbpln151.seq
1185642826     gbpln1510.se
 552386546     gbpln1511.se
1388485833     gbpln1512.se
 600740349     gbpln1513.se
1103058291     gbpln1514.se
1122948167     gbpln1515.se
1380211962     gbpln1516.se
 519573430     gbpln1517.se
1132007157     gbpln1518.se
1452163021     gbpln1519.se
1490380028     gbpln152.seq
1048521841     gbpln1520.se
1038155649     gbpln1521.se
 833369914     gbpln1522.se
 931292853     gbpln1523.se
 811379776     gbpln1524.se
1077992421     gbpln1525.se
 812614241     gbpln1526.se
1052276437     gbpln1527.se
1035793500     gbpln1528.se
 832863065     gbpln1529.se
 666076470     gbpln153.seq
 922247149     gbpln1530.se
 807661511     gbpln1531.se
1066166792     gbpln1532.se
 997697986     gbpln1533.se
 693641164     gbpln1534.se
1177445344     gbpln1535.se
1163060695     gbpln1536.se
1021882786     gbpln1537.se
1191242602     gbpln1538.se
 609801478     gbpln1539.se
1394326143     gbpln154.seq
1205643923     gbpln1540.se
 554031927     gbpln1541.se
1342568934     gbpln1542.se
1163523207     gbpln1543.se
 500443859     gbpln1544.se
1226448377     gbpln1545.se
1349517074     gbpln1546.se
1175767295     gbpln1547.se
 532052842     gbpln1548.se
1427698294     gbpln1549.se
1109798895     gbpln155.seq
 239752932     gbpln1550.se
1480686507     gbpln1551.se
 506996792     gbpln1552.se
1474130957     gbpln1553.se
 308615956     gbpln1554.se
1480513773     gbpln1555.se
1404650425     gbpln1556.se
1478010619     gbpln1557.se
1498434279     gbpln1558.se
 317320398     gbpln1559.se
1468090063     gbpln156.seq
1420113065     gbpln1560.se
 627724928     gbpln1561.se
1493522663     gbpln1562.se
1483610634     gbpln1563.se
 246413329     gbpln1564.se
1471156732     gbpln1565.se
1011943977     gbpln1566.se
 574061324     gbpln1567.se
 221798426     gbpln1568.se
1908341558     gbpln1569.se
 498960662     gbpln157.seq
1899626925     gbpln1570.se
1507440270     gbpln1571.se
1195338085     gbpln1572.se
1471685919     gbpln1573.se
 859088214     gbpln1574.se
1423584097     gbpln1575.se
1398057021     gbpln1576.se
1481929547     gbpln1577.se
 256996209     gbpln1578.se
1487433542     gbpln1579.se
1465862621     gbpln158.seq
1109679772     gbpln1580.se
 627032043     gbpln1581.se
 971627123     gbpln1582.se
 850272715     gbpln1583.se
 849609082     gbpln1584.se
 850190924     gbpln1585.se
 976829654     gbpln1586.se
 814643125     gbpln1587.se
 879514342     gbpln1588.se
 812317704     gbpln1589.se
 614149015     gbpln159.seq
1488237027     gbpln1590.se
 944480603     gbpln1591.se
1488070952     gbpln1592.se
 187314210     gbpln1593.se
1498423603     gbpln1594.se
 218416733     gbpln1595.se
1441440428     gbpln1596.se
 383768559     gbpln1597.se
1224504777     gbpln1598.se
 349681340     gbpln1599.se
 915123308     gbpln16.seq
1465730149     gbpln160.seq
1305247057     gbpln1600.se
 762473956     gbpln1601.se
1323225071     gbpln1602.se
1230459038     gbpln1603.se
1375467830     gbpln1604.se
1483298713     gbpln1605.se
 525018335     gbpln1606.se
1362927202     gbpln1607.se
1281553921     gbpln1608.se
 811996967     gbpln1609.se
 303487869     gbpln161.seq
1463852108     gbpln1610.se
1495551316     gbpln1611.se
 286829600     gbpln1612.se
1499535913     gbpln1613.se
 183623567     gbpln1614.se
 756041908     gbpln1615.se
1225077527     gbpln1616.se
 720006493     gbpln1617.se
 919172194     gbpln1618.se
 874099561     gbpln1619.se
1497288212     gbpln162.seq
 897784196     gbpln1620.se
 876816853     gbpln1621.se
 928190368     gbpln1622.se
 951802003     gbpln1623.se
 824940722     gbpln1624.se
1489306195     gbpln1625.se
1440059389     gbpln1626.se
1482809012     gbpln1627.se
 443596730     gbpln1628.se
1400150852     gbpln1629.se
1299907776     gbpln163.seq
 375114024     gbpln1630.se
1310386197     gbpln1631.se
1497352310     gbpln1632.se
 236596443     gbpln1633.se
1465441436     gbpln1634.se
1028990160     gbpln1635.se
1498394092     gbpln1636.se
 298447868     gbpln1637.se
1495699389     gbpln1638.se
 581540409     gbpln1639.se
 319271409     gbpln164.seq
1485211048     gbpln1640.se
 585500235     gbpln1641.se
1497068016     gbpln1642.se
 614807024     gbpln1643.se
1262770835     gbpln1644.se
 813125990     gbpln1645.se
1474381949     gbpln1646.se
 701582413     gbpln1647.se
1461709979     gbpln1648.se
1149761834     gbpln1649.se
1226543968     gbpln165.seq
1483546710     gbpln1650.se
 930193039     gbpln1651.se
1489781091     gbpln1652.se
 926396631     gbpln1653.se
1495960818     gbpln1654.se
 871854711     gbpln1655.se
1473418344     gbpln1656.se
1020374305     gbpln1657.se
1424815452     gbpln1658.se
1106391649     gbpln1659.se
 472201904     gbpln166.seq
1431808111     gbpln1660.se
 974172538     gbpln1661.se
1488020108     gbpln167.seq
 474707598     gbpln168.seq
1462560050     gbpln169.seq
 346195412     gbpln17.seq
1465045969     gbpln170.seq
  45376924     gbpln171.seq
1471011602     gbpln172.seq
1406572096     gbpln173.seq
1497917594     gbpln174.seq
 937502730     gbpln175.seq
1471338906     gbpln176.seq
1082634808     gbpln177.seq
1466368251     gbpln178.seq
1045538877     gbpln179.seq
 385021070     gbpln18.seq
1485205323     gbpln180.seq
 565755694     gbpln181.seq
1455836211     gbpln182.seq
 702008865     gbpln183.seq
1480976754     gbpln184.seq
 464336268     gbpln185.seq
1354222615     gbpln186.seq
 930875701     gbpln187.seq
1373508522     gbpln188.seq
 650922585     gbpln189.seq
 205693142     gbpln19.seq
1430360286     gbpln190.seq
 715204913     gbpln191.seq
1486817696     gbpln192.seq
 714902212     gbpln193.seq
1499652750     gbpln194.seq
1283327779     gbpln195.seq
     86418     gbpln196.seq
    361751     gbpln197.seq
 164981114     gbpln198.seq
  40089681     gbpln199.seq
 980461152     gbpln2.seq
  85942797     gbpln20.seq
  74918158     gbpln200.seq
 858166549     gbpln201.seq
1144419662     gbpln202.seq
1499995811     gbpln203.seq
 291098370     gbpln204.seq
 298901980     gbpln205.seq
 211513289     gbpln206.seq
 248674469     gbpln207.seq
1239599702     gbpln208.seq
1434095839     gbpln209.seq
1499912583     gbpln21.seq
 636195341     gbpln210.seq
1474382844     gbpln211.seq
 609356119     gbpln212.seq
 786074578     gbpln213.seq
 733167229     gbpln214.seq
1427815214     gbpln215.seq
1497769109     gbpln216.seq
 785186374     gbpln217.seq
 566714479     gbpln218.seq
1272845370     gbpln219.seq
 300458283     gbpln22.seq
1094507719     gbpln220.seq
 985319455     gbpln221.seq
 921889621     gbpln222.seq
 891692884     gbpln223.seq
1499996563     gbpln224.seq
  73336356     gbpln225.seq
1424135934     gbpln226.seq
1500000262     gbpln227.seq
 583840990     gbpln228.seq
1394280993     gbpln229.seq
1498951977     gbpln23.seq
 951399156     gbpln230.seq
 719212512     gbpln231.seq
 981097867     gbpln232.seq
 860028189     gbpln233.seq
 800605872     gbpln234.seq
 794469115     gbpln235.seq
1492903391     gbpln236.seq
1017587669     gbpln237.seq
 924325157     gbpln238.seq
1201978654     gbpln239.seq
 100249219     gbpln24.seq
1227268207     gbpln240.seq
1152253241     gbpln241.seq
1115248374     gbpln242.seq
1125506105     gbpln243.seq
1145303472     gbpln244.seq
1479141773     gbpln245.seq
 324547157     gbpln246.seq
1477277107     gbpln247.seq
 407347304     gbpln248.seq
 117077962     gbpln249.seq
1359301073     gbpln25.seq
1328532546     gbpln250.seq
 887561680     gbpln251.seq
 834970472     gbpln252.seq
 826391913     gbpln253.seq
 792513917     gbpln254.seq
 743209872     gbpln255.seq
1498927742     gbpln256.seq
 860028189     gbpln257.seq
 800605872     gbpln258.seq
 794469115     gbpln259.seq
1435397000     gbpln26.seq
1492903391     gbpln260.seq
 997390720     gbpln261.seq
 663098252     gbpln262.seq
 855592604     gbpln263.seq
 807031053     gbpln264.seq
 793905039     gbpln265.seq
1491456147     gbpln266.seq
1466632070     gbpln267.seq
 840180304     gbpln268.seq
 796430245     gbpln269.seq
1467916505     gbpln27.seq
 779180715     gbpln270.seq
1486604510     gbpln271.seq
1445385427     gbpln272.seq
 831209396     gbpln273.seq
 783682955     gbpln274.seq
 775938782     gbpln275.seq
1442399440     gbpln276.seq
1471877377     gbpln277.seq
 872662143     gbpln278.seq
 815663229     gbpln279.seq
1035036640     gbpln28.seq
 813528167     gbpln280.seq
 780491844     gbpln281.seq
 734904793     gbpln282.seq
 816941948     gbpln283.seq
1459223663     gbpln284.seq
 768070182     gbpln285.seq
1491145948     gbpln286.seq
 706311232     gbpln287.seq
1417708310     gbpln288.seq
 830082304     gbpln289.seq
1478161497     gbpln29.seq
 783385752     gbpln290.seq
 770520351     gbpln291.seq
 753421970     gbpln292.seq
1483888921     gbpln293.seq
 702337808     gbpln294.seq
 906907390     gbpln295.seq
 844110716     gbpln296.seq
 841780855     gbpln297.seq
 805270043     gbpln298.seq
 764396863     gbpln299.seq
1226308330     gbpln3.seq
 718759820     gbpln30.seq
 841492595     gbpln300.seq
 714482811     gbpln301.seq
 916127997     gbpln302.seq
 858459407     gbpln303.seq
 848936990     gbpln304.seq
 813129213     gbpln305.seq
 765593150     gbpln306.seq
 862731158     gbpln307.seq
 665885634     gbpln308.seq
 854365265     gbpln309.seq
 172902778     gbpln31.seq
 802776346     gbpln310.seq
 793295912     gbpln311.seq
 769246240     gbpln312.seq
 710912919     gbpln313.seq
1429544600     gbpln314.seq
 814320946     gbpln315.seq
 759349720     gbpln316.seq
 762512207     gbpln317.seq
1404327068     gbpln318.seq
1468493398     gbpln319.seq
1415084627     gbpln32.seq
 873292213     gbpln320.seq
 827422505     gbpln321.seq
 815925825     gbpln322.seq
 779009585     gbpln323.seq
 739747654     gbpln324.seq
1498046242     gbpln325.seq
 849628701     gbpln326.seq
 803882830     gbpln327.seq
 794420470     gbpln328.seq
 760127459     gbpln329.seq
 555810468     gbpln33.seq
 714663802     gbpln330.seq
1469965572     gbpln331.seq
 854770002     gbpln332.seq
 805931576     gbpln333.seq
 798923954     gbpln334.seq
1489544894     gbpln335.seq
1467528130     gbpln336.seq
 854339916     gbpln337.seq
 803900400     gbpln338.seq
 791449620     gbpln339.seq
1497609858     gbpln34.seq
1476207543     gbpln340.seq
1475343864     gbpln341.seq
 870939392     gbpln342.seq
 809408813     gbpln343.seq
 801514137     gbpln344.seq
1492438448     gbpln345.seq
1476330312     gbpln346.seq
 846934671     gbpln347.seq
 794708793     gbpln348.seq
 789781753     gbpln349.seq
 695384158     gbpln35.seq
1475691254     gbpln350.seq
1489470879     gbpln351.seq
 888406351     gbpln352.seq
 835271741     gbpln353.seq
 823533989     gbpln354.seq
 787819193     gbpln355.seq
 748786657     gbpln356.seq
1483648703     gbpln357.seq
 283001912     gbpln358.seq
 914557940     gbpln359.seq
1495430424     gbpln36.seq
 898446949     gbpln360.seq
 628489896     gbpln361.seq
1024113089     gbpln362.seq
1032878661     gbpln363.seq
 858694781     gbpln364.seq
 960391204     gbpln365.seq
1090094606     gbpln366.seq
 781959143     gbpln367.seq
 946995961     gbpln368.seq
 857542781     gbpln369.seq
 489283076     gbpln37.seq
 656405285     gbpln370.seq
 907889097     gbpln371.seq
 896386890     gbpln372.seq
 726432335     gbpln373.seq
 798296822     gbpln374.seq
 918393750     gbpln375.seq
 584961784     gbpln376.seq
 948865971     gbpln377.seq
 954536271     gbpln378.seq
 819735731     gbpln379.seq
1488044778     gbpln38.seq
 756588093     gbpln380.seq
 876067119     gbpln381.seq
 625446321     gbpln382.seq
 977801494     gbpln383.seq
 854357980     gbpln384.seq
 807732556     gbpln385.seq
 947696453     gbpln386.seq
1067629605     gbpln387.seq
 822222048     gbpln388.seq
 950272996     gbpln389.seq
1179553878     gbpln39.seq
1488985571     gbpln390.seq
 894745096     gbpln391.seq
 893352134     gbpln392.seq
1498806035     gbpln393.seq
1491810166     gbpln394.seq
 933986451     gbpln395.seq
 939527664     gbpln396.seq
 810117922     gbpln397.seq
 765938558     gbpln398.seq
 886537018     gbpln399.seq
 769118105     gbpln4.seq
1445386724     gbpln40.seq
 623519964     gbpln400.seq
 996940649     gbpln401.seq
1030190034     gbpln402.seq
 832828033     gbpln403.seq
 956342979     gbpln404.seq
1134286144     gbpln405.seq
 790513299     gbpln406.seq
 944161893     gbpln407.seq
 860035788     gbpln408.seq
 647268685     gbpln409.seq
1421332480     gbpln41.seq
 902239623     gbpln410.seq
1345936752     gbpln411.seq
 787834228     gbpln412.seq
 910724363     gbpln413.seq
 606016896     gbpln414.seq
 961485234     gbpln415.seq
1242775191     gbpln416.seq
1453328788     gbpln417.seq
 818591771     gbpln418.seq
 766580884     gbpln419.seq
 966355920     gbpln42.seq
 752100829     gbpln420.seq
1415475376     gbpln421.seq
 769738288     gbpln422.seq
 750738544     gbpln423.seq
1496665003     gbpln424.seq
 995069022     gbpln425.seq
1012956234     gbpln426.seq
 827074347     gbpln427.seq
 940621783     gbpln428.seq
1079418810     gbpln429.seq
1256255782     gbpln43.seq
 776922106     gbpln430.seq
 938380968     gbpln431.seq
1492330319     gbpln432.seq
 891714442     gbpln433.seq
 878638403     gbpln434.seq
 721632671     gbpln435.seq
 779156122     gbpln436.seq
 895553446     gbpln437.seq
 604678568     gbpln438.seq
 931006295     gbpln439.seq
 376172115     gbpln44.seq
 933660027     gbpln440.seq
 810459540     gbpln441.seq
 761872100     gbpln442.seq
 878702815     gbpln443.seq
 627081460     gbpln444.seq
 994320235     gbpln445.seq
 999434327     gbpln446.seq
 823789349     gbpln447.seq
 945629782     gbpln448.seq
1062113821     gbpln449.seq
1469659294     gbpln45.seq
 792298939     gbpln450.seq
 941851700     gbpln451.seq
 850142413     gbpln452.seq
 656955691     gbpln453.seq
 904094753     gbpln454.seq
 900193903     gbpln455.seq
1470079206     gbpln456.seq
1497721340     gbpln457.seq
 937117048     gbpln458.seq
 936021119     gbpln459.seq
 320290805     gbpln46.seq
 812696702     gbpln460.seq
 746628212     gbpln461.seq
 897168807     gbpln462.seq
 626698501     gbpln463.seq
1007072101     gbpln464.seq
1000831797     gbpln465.seq
 841918855     gbpln466.seq
 963426816     gbpln467.seq
1093654114     gbpln468.seq
 791118382     gbpln469.seq
1485324492     gbpln47.seq
 959940756     gbpln470.seq
 853263842     gbpln471.seq
 648051398     gbpln472.seq
 901282075     gbpln473.seq
 923491092     gbpln474.seq
 732477869     gbpln475.seq
 789987733     gbpln476.seq
 926022053     gbpln477.seq
 610840579     gbpln478.seq
 949759032     gbpln479.seq
 199854535     gbpln48.seq
 955444559     gbpln480.seq
 818480442     gbpln481.seq
 752251380     gbpln482.seq
 897893149     gbpln483.seq
 631111272     gbpln484.seq
1022032953     gbpln485.seq
1006306956     gbpln486.seq
 837035085     gbpln487.seq
 966140819     gbpln488.seq
1090560006     gbpln489.seq
1499992872     gbpln49.seq
 800164754     gbpln490.seq
 959884028     gbpln491.seq
 886916735     gbpln492.seq
 641540050     gbpln493.seq
 910168783     gbpln494.seq
 908785549     gbpln495.seq
 729527181     gbpln496.seq
 797552105     gbpln497.seq
 910975470     gbpln498.seq
 616026199     gbpln499.seq
1468706571     gbpln5.seq
 647179239     gbpln50.seq
 945685366     gbpln500.seq
 953145956     gbpln501.seq
 820081609     gbpln502.seq
 763165947     gbpln503.seq
1489098826     gbpln504.seq
1009123187     gbpln505.seq
1016689515     gbpln506.seq
 832912303     gbpln507.seq
 952656374     gbpln508.seq
1065835283     gbpln509.seq
1361184932     gbpln51.seq
 776075044     gbpln510.seq
 935940025     gbpln511.seq
1488231655     gbpln512.seq
1487557825     gbpln513.seq
 720169483     gbpln514.seq
 780564861     gbpln515.seq
1499144496     gbpln516.seq
 934713391     gbpln517.seq
1233388213     gbpln518.seq
 807542511     gbpln519.seq
1015832925     gbpln52.seq
 757881986     gbpln520.seq
 889760627     gbpln521.seq
 635890046     gbpln522.seq
1007873898     gbpln523.seq
1015524558     gbpln524.seq
 836625022     gbpln525.seq
 959076059     gbpln526.seq
1077416379     gbpln527.seq
 789416089     gbpln528.seq
 958430056     gbpln529.seq
1424618977     gbpln53.seq
 877922843     gbpln530.seq
 648665455     gbpln531.seq
 907513209     gbpln532.seq
 904978028     gbpln533.seq
 727024880     gbpln534.seq
 789120540     gbpln535.seq
 898507915     gbpln536.seq
 617229811     gbpln537.seq
 942711764     gbpln538.seq
 964780021     gbpln539.seq
 833282640     gbpln54.seq
 818917331     gbpln540.seq
 755294557     gbpln541.seq
 882064051     gbpln542.seq
 627203691     gbpln543.seq
 993595919     gbpln544.seq
1021497440     gbpln545.seq
 827286497     gbpln546.seq
 962451301     gbpln547.seq
1082256067     gbpln548.seq
 781463827     gbpln549.seq
1497082726     gbpln55.seq
 919665368     gbpln550.seq
1497522046     gbpln551.seq
 905574854     gbpln552.seq
 906714977     gbpln553.seq
 718743537     gbpln554.seq
 787529633     gbpln555.seq
 910251919     gbpln556.seq
 608518276     gbpln557.seq
 934541265     gbpln558.seq
 954054955     gbpln559.seq
 319206973     gbpln56.seq
 806443717     gbpln560.seq
1009766480     gbpln561.seq
1318260463     gbpln562.seq
1253136609     gbpln563.seq
1066198175     gbpln564.seq
1119572655     gbpln565.seq
1040217505     gbpln566.seq
1310077288     gbpln567.seq
 955690374     gbpln568.seq
1230684440     gbpln569.seq
1498927430     gbpln57.seq
1179787958     gbpln570.seq
1125383520     gbpln571.seq
1051194518     gbpln572.seq
 965656648     gbpln573.seq
1110314387     gbpln574.seq
 907449503     gbpln575.seq
 843080362     gbpln576.seq
 787261705     gbpln577.seq
 773098599     gbpln578.seq
1456694585     gbpln579.seq
 931856203     gbpln58.seq
 801494093     gbpln580.seq
1340425536     gbpln581.seq
 507333599     gbpln582.seq
1445293885     gbpln583.seq
1219201533     gbpln584.seq
1281941476     gbpln585.seq
1465910871     gbpln586.seq
   9838016     gbpln587.seq
1332978268     gbpln588.seq
 756143249     gbpln589.seq
1495942547     gbpln59.seq
 878426054     gbpln590.seq
 631056251     gbpln591.seq
 993852367     gbpln592.seq
1020132695     gbpln593.seq
 830166807     gbpln594.seq
 955723315     gbpln595.seq
1057964328     gbpln596.seq
 784007552     gbpln597.seq
 947940191     gbpln598.seq
 857511193     gbpln599.seq
 170607031     gbpln6.seq
 581614185     gbpln60.seq
 649137171     gbpln600.seq
 903393879     gbpln601.seq
 908180396     gbpln602.seq
 721135945     gbpln603.seq
 786739709     gbpln604.seq
 918070756     gbpln605.seq
 603192844     gbpln606.seq
 938102555     gbpln607.seq
 955978436     gbpln608.seq
1498148500     gbpln609.seq
1498805571     gbpln61.seq
 423921521     gbpln610.seq
1018937144     gbpln611.seq
 768159651     gbpln612.seq
 891261263     gbpln613.seq
1017239134     gbpln614.seq
1036737053     gbpln615.seq
 980587319     gbpln616.seq
1096962209     gbpln617.seq
 964715275     gbpln618.seq
 883795567     gbpln619.seq
 278927988     gbpln62.seq
 879409471     gbpln620.seq
 922242639     gbpln621.seq
 805484043     gbpln622.seq
 912391541     gbpln623.seq
 954577618     gbpln624.seq
 974130060     gbpln625.seq
 404912674     gbpln626.seq
1489898484     gbpln627.seq
1499999910     gbpln628.seq
  91112872     gbpln629.seq
1456636282     gbpln63.seq
1500000091     gbpln630.seq
 327590835     gbpln631.seq
1499734759     gbpln632.seq
  32988398     gbpln633.seq
1499814238     gbpln634.seq
 184016614     gbpln635.seq
1499903673     gbpln636.seq
1185292418     gbpln637.seq
1499990433     gbpln638.seq
 413111434     gbpln639.seq
 934573330     gbpln64.seq
1499995531     gbpln640.seq
 602482667     gbpln641.seq
1499994875     gbpln642.seq
 373411427     gbpln643.seq
1499990931     gbpln644.seq
 914715139     gbpln645.seq
 674055631     gbpln646.seq
 865045961     gbpln647.seq
 815791689     gbpln648.seq
 802718902     gbpln649.seq
1473698497     gbpln65.seq
 776304595     gbpln650.seq
 721531499     gbpln651.seq
1489200818     gbpln652.seq
 873797632     gbpln653.seq
 820367220     gbpln654.seq
 806296382     gbpln655.seq
 775209384     gbpln656.seq
 744231520     gbpln657.seq
 817156402     gbpln658.seq
 771380170     gbpln659.seq
 405522101     gbpln66.seq
 913253142     gbpln660.seq
 634934982     gbpln661.seq
1019175188     gbpln662.seq
1023638564     gbpln663.seq
 822225605     gbpln664.seq
 961290952     gbpln665.seq
1090804562     gbpln666.seq
 813694518     gbpln667.seq
 962545328     gbpln668.seq
 873725319     gbpln669.seq
1495859265     gbpln67.seq
 673190932     gbpln670.seq
 905064826     gbpln671.seq
 908590682     gbpln672.seq
 742712720     gbpln673.seq
 793279946     gbpln674.seq
 934932909     gbpln675.seq
 640700840     gbpln676.seq
 961568346     gbpln677.seq
 952066709     gbpln678.seq
1470907411     gbpln679.seq
 603645746     gbpln68.seq
1315696038     gbpln680.seq
1451561486     gbpln681.seq
1409767917     gbpln682.seq
 605149309     gbpln683.seq
1109188510     gbpln684.seq
1170981868     gbpln685.seq
 609718059     gbpln686.seq
1136119548     gbpln687.seq
1284507799     gbpln688.seq
1122567296     gbpln689.seq
1498515316     gbpln69.seq
1192074506     gbpln690.seq
1181896740     gbpln691.seq
 692441980     gbpln692.seq
 738372777     gbpln693.seq
 858786663     gbpln694.seq
1482575758     gbpln695.seq
1256005171     gbpln696.seq
1249214474     gbpln697.seq
1164522681     gbpln698.seq
1002097666     gbpln699.seq
1484572601     gbpln7.seq
1308695072     gbpln70.seq
1300955592     gbpln700.seq
1317957634     gbpln701.seq
1148040939     gbpln702.seq
1403417765     gbpln703.seq
1375754075     gbpln704.seq
 745221978     gbpln705.seq
1286273263     gbpln706.seq
1222805283     gbpln707.seq
 738102834     gbpln708.seq
1300107704     gbpln709.seq
1356426063     gbpln71.seq
1290738490     gbpln710.seq
 682607984     gbpln711.seq
 777312364     gbpln712.seq
1006352199     gbpln713.seq
 962815279     gbpln714.seq
 975138624     gbpln715.seq
 906550423     gbpln716.seq
 790269619     gbpln717.seq
 956926034     gbpln718.seq
 908369814     gbpln719.seq
1479480118     gbpln72.seq
1035806383     gbpln720.seq
1095241384     gbpln721.seq
 889046375     gbpln722.seq
 920177986     gbpln723.seq
 934896187     gbpln724.seq
 972756494     gbpln725.seq
 639243888     gbpln726.seq
 839211114     gbpln727.seq
1479400215     gbpln728.seq
1382640922     gbpln729.seq
1319684527     gbpln73.seq
1372701817     gbpln730.seq
 738741167     gbpln731.seq
1194847682     gbpln732.seq
 449429603     gbpln733.seq
1408878447     gbpln734.seq
1491657383     gbpln735.seq
 271440721     gbpln736.seq
1477932248     gbpln737.seq
1257530871     gbpln738.seq
1466995802     gbpln739.seq
 451516766     gbpln74.seq
1437909873     gbpln740.seq
1307026425     gbpln741.seq
1462620068     gbpln742.seq
1087730235     gbpln743.seq
1451936168     gbpln744.seq
 890586335     gbpln745.seq
 628166165     gbpln746.seq
1008494769     gbpln747.seq
 987228439     gbpln748.seq
 843057145     gbpln749.seq
1499422292     gbpln75.seq
 959088226     gbpln750.seq
1080118899     gbpln751.seq
 790032688     gbpln752.seq
 943744807     gbpln753.seq
 858758922     gbpln754.seq
 664109823     gbpln755.seq
 920678547     gbpln756.seq
 888501596     gbpln757.seq
 739915903     gbpln758.seq
 788736235     gbpln759.seq
1070174241     gbpln76.seq
 944601114     gbpln760.seq
 621465898     gbpln761.seq
 948555730     gbpln762.seq
 954911742     gbpln763.seq
 854893508     gbpln764.seq
 752395251     gbpln765.seq
 890282441     gbpln766.seq
 626588937     gbpln767.seq
1004358313     gbpln768.seq
1028945402     gbpln769.seq
1477754554     gbpln77.seq
 838465030     gbpln770.seq
 950517847     gbpln771.seq
1082441570     gbpln772.seq
 789583361     gbpln773.seq
 950035125     gbpln774.seq
 853507173     gbpln775.seq
 659807142     gbpln776.seq
 902654821     gbpln777.seq
 890952839     gbpln778.seq
 721824594     gbpln779.seq
1446433546     gbpln78.seq
 785634142     gbpln780.seq
 909002040     gbpln781.seq
 625532225     gbpln782.seq
 945667284     gbpln783.seq
 953425672     gbpln784.seq
 871481257     gbpln785.seq
1254084023     gbpln786.seq
1125916060     gbpln787.seq
 614750080     gbpln788.seq
1193223709     gbpln789.seq
1426285617     gbpln79.seq
1332440485     gbpln790.seq
 808684469     gbpln791.seq
 907082918     gbpln792.seq
 776688264     gbpln793.seq
1492098096     gbpln794.seq
1287386861     gbpln795.seq
 609236734     gbpln796.seq
1209159954     gbpln797.seq
 377507568     gbpln798.seq
1484585650     gbpln799.seq
 984218119     gbpln8.seq
 455557137     gbpln80.seq
 946681452     gbpln800.seq
 950480218     gbpln801.seq
 890282441     gbpln802.seq
 626588937     gbpln803.seq
1004358313     gbpln804.seq
1028945402     gbpln805.seq
 838465030     gbpln806.seq
 950517847     gbpln807.seq
1082441570     gbpln808.seq
 789583361     gbpln809.seq
1494370167     gbpln81.seq
 950035125     gbpln810.seq
 853507173     gbpln811.seq
 659807142     gbpln812.seq
 902654821     gbpln813.seq
 890952839     gbpln814.seq
 721824594     gbpln815.seq
 785634142     gbpln816.seq
 909002040     gbpln817.seq
 625532225     gbpln818.seq
 945667284     gbpln819.seq
1362784512     gbpln82.seq
 953425672     gbpln820.seq
1496388051     gbpln821.seq
 660322138     gbpln822.seq
 841140962     gbpln823.seq
1479991498     gbpln824.seq
1471774772     gbpln825.seq
 801426109     gbpln826.seq
1497825120     gbpln827.seq
1107189955     gbpln828.seq
1490655990     gbpln829.seq
 537903618     gbpln83.seq
1128106750     gbpln830.seq
1466437965     gbpln831.seq
1161000777     gbpln832.seq
1423880580     gbpln833.seq
1214063491     gbpln834.seq
1451396326     gbpln835.seq
 534355433     gbpln836.seq
1473756313     gbpln837.seq
 937650337     gbpln838.seq
1409268379     gbpln839.seq
1396494473     gbpln84.seq
1413747761     gbpln840.seq
 509646630     gbpln841.seq
1495475780     gbpln842.seq
 527957373     gbpln843.seq
1476847011     gbpln844.seq
 399440753     gbpln845.seq
1368729073     gbpln846.seq
 555294430     gbpln847.seq
1450863217     gbpln848.seq
1426917875     gbpln849.seq
 684881209     gbpln85.seq
 310654352     gbpln850.seq
1384718199     gbpln851.seq
 535518402     gbpln852.seq
1476837338     gbpln853.seq
 723858950     gbpln854.seq
 759028695     gbpln855.seq
 898515506     gbpln856.seq
 632797874     gbpln857.seq
1008257523     gbpln858.seq
1024893589     gbpln859.seq
1255396237     gbpln86.seq
 849343329     gbpln860.seq
 961475028     gbpln861.seq
1105697901     gbpln862.seq
 806976002     gbpln863.seq
 970149905     gbpln864.seq
 872154954     gbpln865.seq
 676154112     gbpln866.seq
 905516393     gbpln867.seq
 922918521     gbpln868.seq
 742368603     gbpln869.seq
 644937327     gbpln87.seq
 788401116     gbpln870.seq
 929538621     gbpln871.seq
 641895628     gbpln872.seq
 961976136     gbpln873.seq
 973033369     gbpln874.seq
 834845237     gbpln875.seq
1096228945     gbpln876.seq
1065747701     gbpln877.seq
 978382753     gbpln878.seq
 970377845     gbpln879.seq
1477669894     gbpln88.seq
 932157797     gbpln880.seq
 878151180     gbpln881.seq
 874085481     gbpln882.seq
 829265282     gbpln883.seq
 863296712     gbpln884.seq
 823515696     gbpln885.seq
 815413878     gbpln886.seq
1384284611     gbpln887.seq
 669344398     gbpln888.seq
1299578188     gbpln889.seq
1486392850     gbpln89.seq
 613278883     gbpln890.seq
 541733671     gbpln891.seq
2012725364     gbpln892.seq
2313576156     gbpln893.seq
2199353950     gbpln894.seq
2096617948     gbpln895.seq
2106642320     gbpln896.seq
1745413839     gbpln897.seq
1943630373     gbpln898.seq
  43805281     gbpln899.seq
1467665665     gbpln9.seq
 149356615     gbpln90.seq
1052364780     gbpln900.seq
 836152673     gbpln901.seq
 790234194     gbpln902.seq
 768134126     gbpln903.seq
1464177021     gbpln904.seq
 794343594     gbpln905.seq
1499805858     gbpln906.seq
 794136795     gbpln907.seq
 777214951     gbpln908.seq
 750731320     gbpln909.seq
1263909550     gbpln91.seq
 709232632     gbpln910.seq
1453910479     gbpln911.seq
 831555004     gbpln912.seq
 787385081     gbpln913.seq
 774061568     gbpln914.seq
1444041489     gbpln915.seq
1462025010     gbpln916.seq
 837904862     gbpln917.seq
 793009108     gbpln918.seq
 770582515     gbpln919.seq
 753151985     gbpln92.seq
1458992600     gbpln920.seq
 809917662     gbpln921.seq
 662753084     gbpln922.seq
 837974598     gbpln923.seq
 802983165     gbpln924.seq
 776399714     gbpln925.seq
 749269997     gbpln926.seq
1498103845     gbpln927.seq
 672385034     gbpln928.seq
 841987686     gbpln929.seq
1488086519     gbpln93.seq
 800255273     gbpln930.seq
 776782162     gbpln931.seq
 765490377     gbpln932.seq
 737409430     gbpln933.seq
1467554404     gbpln934.seq
 838067528     gbpln935.seq
 794050154     gbpln936.seq
 769006556     gbpln937.seq
1456537014     gbpln938.seq
1456423618     gbpln939.seq
1407723759     gbpln94.seq
 831709069     gbpln940.seq
 788018841     gbpln941.seq
 776335168     gbpln942.seq
1447227789     gbpln943.seq
1462058949     gbpln944.seq
 831948387     gbpln945.seq
 792155197     gbpln946.seq
 764395261     gbpln947.seq
1469026352     gbpln948.seq
1457035184     gbpln949.seq
1494162414     gbpln95.seq
 832913530     gbpln950.seq
 783381752     gbpln951.seq
 777226067     gbpln952.seq
1449010172     gbpln953.seq
 800066152     gbpln954.seq
 659967909     gbpln955.seq
 856583955     gbpln956.seq
 800941651     gbpln957.seq
 764839741     gbpln958.seq
1463437686     gbpln959.seq
 651907412     gbpln96.seq
1457211427     gbpln960.seq
 838548262     gbpln961.seq
 802434968     gbpln962.seq
 775426579     gbpln963.seq
 752476250     gbpln964.seq
 715776002     gbpln965.seq
1456996279     gbpln966.seq
 836584180     gbpln967.seq
 794556423     gbpln968.seq
 763379902     gbpln969.seq
1490193530     gbpln97.seq
1472540375     gbpln970.seq
1467456048     gbpln971.seq
 841588737     gbpln972.seq
 793586133     gbpln973.seq
 774193866     gbpln974.seq
1483592340     gbpln975.seq
 810458179     gbpln976.seq
1487039738     gbpln977.seq
 787519847     gbpln978.seq
 773580778     gbpln979.seq
1492751091     gbpln98.seq
 746701675     gbpln980.seq
 707267127     gbpln981.seq
1458876981     gbpln982.seq
 836647345     gbpln983.seq
 804025438     gbpln984.seq
 780287537     gbpln985.seq
1456910351     gbpln986.seq
1461116471     gbpln987.seq
 847868245     gbpln988.seq
 799503371     gbpln989.seq
 277490570     gbpln99.seq
 769858205     gbpln990.seq
1451384310     gbpln991.seq
1448178188     gbpln992.seq
 841182040     gbpln993.seq
 790643457     gbpln994.seq
 771991395     gbpln995.seq
1449905950     gbpln996.seq
 799948093     gbpln997.seq
 836052022     gbpln998.seq
 791807902     gbpln999.seq
 148381699     gbpri1.seq
1365064130     gbpri10.seq
1336019423     gbpri11.seq
1499996596     gbpri12.seq
 227230043     gbpri13.seq
1495617045     gbpri14.seq
1488562552     gbpri15.seq
1255994844     gbpri16.seq
1152821312     gbpri17.seq
1461558373     gbpri18.seq
1327599283     gbpri19.seq
1499938288     gbpri2.seq
1368003079     gbpri20.seq
1248234868     gbpri21.seq
1458591714     gbpri22.seq
1406973230     gbpri23.seq
 353371961     gbpri24.seq
1457966298     gbpri25.seq
1499973379     gbpri26.seq
 247223946     gbpri27.seq
1316571434     gbpri28.seq
1329314577     gbpri29.seq
 892961995     gbpri3.seq
1499965390     gbpri30.seq
 131268192     gbpri31.seq
1499583412     gbpri32.seq
 540250595     gbpri33.seq
1484623677     gbpri34.seq
1155514979     gbpri35.seq
1499754625     gbpri4.seq
1248674023     gbpri5.seq
 852828719     gbpri6.seq
 162657269     gbpri7.seq
 494738393     gbpri8.seq
1499996495     gbpri9.seq
    752048     gbrel.txt
1499895051     gbrod1.seq
1364606089     gbrod10.seq
 720172269     gbrod100.seq
1339278647     gbrod101.seq
 611593151     gbrod102.seq
1419645093     gbrod103.seq
1209757347     gbrod104.seq
1441818101     gbrod105.seq
1396178967     gbrod106.seq
1351873160     gbrod107.seq
 846383607     gbrod108.seq
1433880689     gbrod109.seq
 967058320     gbrod11.seq
 874097174     gbrod110.seq
1465720088     gbrod111.seq
 771726132     gbrod112.seq
1452944377     gbrod113.seq
 895279721     gbrod114.seq
1452029513     gbrod115.seq
1391575060     gbrod116.seq
 254113502     gbrod117.seq
1384329105     gbrod118.seq
1452389530     gbrod119.seq
1478819696     gbrod12.seq
 301613693     gbrod120.seq
1164340164     gbrod13.seq
1365976721     gbrod14.seq
 782037687     gbrod15.seq
1432583977     gbrod16.seq
 672937827     gbrod17.seq
1471007422     gbrod18.seq
 701368584     gbrod19.seq
1079954021     gbrod2.seq
1485666339     gbrod20.seq
1039515850     gbrod21.seq
1390188394     gbrod22.seq
1351534647     gbrod23.seq
1379133925     gbrod24.seq
1090402714     gbrod25.seq
1351547492     gbrod26.seq
1434496523     gbrod27.seq
1387638765     gbrod28.seq
 774513298     gbrod29.seq
1499842037     gbrod3.seq
1483025748     gbrod30.seq
1275849540     gbrod31.seq
1443775129     gbrod32.seq
1396087823     gbrod33.seq
1464212638     gbrod34.seq
1390894064     gbrod35.seq
1457113534     gbrod36.seq
1483189817     gbrod37.seq
1493035007     gbrod38.seq
1319919002     gbrod39.seq
 505728660     gbrod4.seq
 424097301     gbrod40.seq
1403617701     gbrod41.seq
1477924977     gbrod42.seq
 199611565     gbrod43.seq
1401494568     gbrod44.seq
1388903637     gbrod45.seq
 310706546     gbrod46.seq
1400027325     gbrod47.seq
1461603649     gbrod48.seq
 225065456     gbrod49.seq
 703742986     gbrod5.seq
1424745702     gbrod50.seq
1284962968     gbrod51.seq
 469102684     gbrod52.seq
1438575392     gbrod53.seq
 867442690     gbrod54.seq
1454936442     gbrod55.seq
 850383541     gbrod56.seq
1281522937     gbrod57.seq
1040847553     gbrod58.seq
1451446756     gbrod59.seq
1499996287     gbrod6.seq
 938452301     gbrod60.seq
1372874755     gbrod61.seq
1447005896     gbrod62.seq
 185502754     gbrod63.seq
1457502126     gbrod64.seq
1386330563     gbrod65.seq
 341028443     gbrod66.seq
1460394982     gbrod67.seq
 732581516     gbrod68.seq
1350711034     gbrod69.seq
 296690848     gbrod7.seq
1110791481     gbrod70.seq
1458676727     gbrod71.seq
 822767134     gbrod72.seq
1418746662     gbrod73.seq
1300599839     gbrod74.seq
 238222177     gbrod75.seq
1488562555     gbrod76.seq
 883469325     gbrod77.seq
1313917093     gbrod78.seq
1160876670     gbrod79.seq
1350754791     gbrod8.seq
1439974119     gbrod80.seq
 959839077     gbrod81.seq
1372051537     gbrod82.seq
1349923280     gbrod83.seq
 233816573     gbrod84.seq
1371052535     gbrod85.seq
1330597820     gbrod86.seq
1444437216     gbrod87.seq
1290357211     gbrod88.seq
1392442820     gbrod89.seq
 947353795     gbrod9.seq
1226020574     gbrod90.seq
1330212561     gbrod91.seq
1447730182     gbrod92.seq
1312689954     gbrod93.seq
1236107954     gbrod94.seq
1474471846     gbrod95.seq
1348543734     gbrod96.seq
1432083992     gbrod97.seq
 665823558     gbrod98.seq
1411009597     gbrod99.seq
1038336576     gbsts1.seq
1456721579     gbsts2.seq
1021007768     gbsts3.seq
 933647742     gbsts4.seq
1434571525     gbsyn1.seq
1499997326     gbsyn10.seq
 730697061     gbsyn11.seq
 529690086     gbsyn2.seq
1300574768     gbsyn3.seq
1146591620     gbsyn4.seq
1474499579     gbsyn5.seq
 976985325     gbsyn6.seq
1363478755     gbsyn7.seq
1492035277     gbsyn8.seq
 541839153     gbsyn9.seq
1148637248     gbtsa1.seq
 284915211     gbtsa10.seq
1078282558     gbtsa11.seq
1160611678     gbtsa12.seq
1499998892     gbtsa13.seq
 493076220     gbtsa14.seq
1499998876     gbtsa15.seq
 229221287     gbtsa16.seq
1499999292     gbtsa17.seq
 177771736     gbtsa18.seq
1356238486     gbtsa19.seq
1058521133     gbtsa2.seq
1298590575     gbtsa20.seq
1403398524     gbtsa21.seq
1499999131     gbtsa22.seq
 344163063     gbtsa23.seq
1499998699     gbtsa24.seq
 227020694     gbtsa25.seq
1261844914     gbtsa26.seq
 964262293     gbtsa27.seq
1499995706     gbtsa28.seq
 169680885     gbtsa29.seq
1275208228     gbtsa3.seq
1499998595     gbtsa30.seq
   4102913     gbtsa31.seq
1131896222     gbtsa32.seq
1034997215     gbtsa33.seq
1499999757     gbtsa34.seq
 548834050     gbtsa35.seq
1499999929     gbtsa36.seq
  83124167     gbtsa37.seq
 890368532     gbtsa38.seq
1499999968     gbtsa39.seq
1280573016     gbtsa4.seq
 208341348     gbtsa40.seq
1499998117     gbtsa41.seq
 231644928     gbtsa42.seq
1499995826     gbtsa43.seq
 406136180     gbtsa44.seq
1499995959     gbtsa45.seq
 474066476     gbtsa46.seq
1233496619     gbtsa47.seq
1499996137     gbtsa48.seq
 534143574     gbtsa49.seq
1161955992     gbtsa5.seq
1500000002     gbtsa50.seq
 470649008     gbtsa51.seq
1499998760     gbtsa52.seq
 280311424     gbtsa53.seq
1499999355     gbtsa54.seq
 423253259     gbtsa55.seq
1261020148     gbtsa6.seq
1499998007     gbtsa7.seq
  72685185     gbtsa8.seq
1499998599     gbtsa9.seq
   7316644     gbuna1.seq
1499972869     gbvrl1.seq
1374031896     gbvrl10.seq
1499956387     gbvrl100.seq
 784230616     gbvrl101.seq
1499943782     gbvrl102.seq
 774917773     gbvrl103.seq
1499996638     gbvrl104.seq
 739586433     gbvrl105.seq
1499974852     gbvrl106.seq
 763256824     gbvrl107.seq
1499956856     gbvrl108.seq
 764467458     gbvrl109.seq
1318312705     gbvrl11.seq
1499950792     gbvrl110.seq
 764064131     gbvrl111.seq
1499988184     gbvrl112.seq
 137582072     gbvrl113.seq
1499958490     gbvrl114.seq
 146322924     gbvrl115.seq
1499944532     gbvrl116.seq
1499969120     gbvrl117.seq
 245878149     gbvrl118.seq
1499962279     gbvrl119.seq
1499999186     gbvrl12.seq
 754826231     gbvrl120.seq
1499958816     gbvrl121.seq
 763064638     gbvrl122.seq
1499973914     gbvrl123.seq
 921483555     gbvrl124.seq
1499941348     gbvrl125.seq
 167053039     gbvrl126.seq
1499941965     gbvrl127.seq
 228344970     gbvrl128.seq
1499988353     gbvrl129.seq
 416100239     gbvrl13.seq
 309551076     gbvrl130.seq
1499991245     gbvrl131.seq
 269288128     gbvrl132.seq
1499959169     gbvrl133.seq
 373017560     gbvrl134.seq
1499946131     gbvrl135.seq
 386450782     gbvrl136.seq
1499962479     gbvrl137.seq
 525408469     gbvrl138.seq
1499997446     gbvrl139.seq
1436667659     gbvrl14.seq
 270359990     gbvrl140.seq
1499980637     gbvrl141.seq
 249012039     gbvrl142.seq
1499945415     gbvrl143.seq
 165359318     gbvrl144.seq
1499967129     gbvrl145.seq
 570784150     gbvrl146.seq
1499940482     gbvrl147.seq
 464760354     gbvrl148.seq
1499998229     gbvrl149.seq
1435288207     gbvrl15.seq
 502381004     gbvrl150.seq
1499994701     gbvrl151.seq
 648046180     gbvrl152.seq
1499952381     gbvrl153.seq
 191163816     gbvrl154.seq
1499985211     gbvrl155.seq
 452085105     gbvrl156.seq
1499962656     gbvrl157.seq
 223109312     gbvrl158.seq
1499987662     gbvrl159.seq
1499986292     gbvrl16.seq
 361442169     gbvrl160.seq
1499937262     gbvrl161.seq
 655384208     gbvrl162.seq
1499962332     gbvrl163.seq
 495975290     gbvrl164.seq
1499955419     gbvrl165.seq
 498051686     gbvrl166.seq
1499937105     gbvrl167.seq
 278911011     gbvrl168.seq
1499958021     gbvrl169.seq
 334815546     gbvrl17.seq
 261340197     gbvrl170.seq
1499981182     gbvrl171.seq
 239707552     gbvrl172.seq
1499967248     gbvrl173.seq
 300056043     gbvrl174.seq
1499939398     gbvrl175.seq
 223610739     gbvrl176.seq
1499995995     gbvrl177.seq
 164214667     gbvrl178.seq
1499986849     gbvrl179.seq
1499995006     gbvrl18.seq
 233364533     gbvrl180.seq
1499992495     gbvrl181.seq
 459808474     gbvrl182.seq
1499976436     gbvrl183.seq
 417550138     gbvrl184.seq
1499992890     gbvrl185.seq
 189792762     gbvrl186.seq
1499980672     gbvrl187.seq
 243814598     gbvrl188.seq
1499941610     gbvrl189.seq
 301836999     gbvrl19.seq
 210895978     gbvrl190.seq
1499963296     gbvrl191.seq
 406126416     gbvrl192.seq
1499934513     gbvrl193.seq
 298751931     gbvrl194.seq
1499985175     gbvrl195.seq
 381620369     gbvrl196.seq
1499935879     gbvrl197.seq
 622752384     gbvrl198.seq
1499949659     gbvrl199.seq
 535797065     gbvrl2.seq
1499936982     gbvrl20.seq
 215553455     gbvrl200.seq
1499978717     gbvrl201.seq
1405198099     gbvrl202.seq
1499995868     gbvrl203.seq
 283709215     gbvrl204.seq
1499956347     gbvrl205.seq
 167704961     gbvrl206.seq
1499979324     gbvrl207.seq
 383556220     gbvrl208.seq
1499953035     gbvrl209.seq
 358751916     gbvrl21.seq
 777343110     gbvrl210.seq
1499989134     gbvrl211.seq
 278072833     gbvrl212.seq
1499970592     gbvrl213.seq
 342474845     gbvrl214.seq
1499993771     gbvrl215.seq
 279422593     gbvrl216.seq
1499952368     gbvrl217.seq
 288958711     gbvrl218.seq
1499952978     gbvrl219.seq
1499933574     gbvrl22.seq
 457024583     gbvrl220.seq
1499960381     gbvrl221.seq
 467815243     gbvrl222.seq
1499975215     gbvrl223.seq
1499938259     gbvrl224.seq
 237994416     gbvrl225.seq
1499932941     gbvrl226.seq
 765724077     gbvrl227.seq
1499940045     gbvrl228.seq
 276311007     gbvrl229.seq
 293556839     gbvrl23.seq
1499968238     gbvrl230.seq
 191755804     gbvrl231.seq
1499996834     gbvrl232.seq
 223767174     gbvrl233.seq
1499994776     gbvrl234.seq
 236592953     gbvrl235.seq
1499935098     gbvrl236.seq
 835913851     gbvrl237.seq
1499971388     gbvrl238.seq
 837655478     gbvrl239.seq
1499946469     gbvrl24.seq
1499988939     gbvrl240.seq
 936561372     gbvrl241.seq
1499938309     gbvrl242.seq
 313999778     gbvrl243.seq
1499937379     gbvrl244.seq
 352317805     gbvrl245.seq
1499973274     gbvrl246.seq
 682367521     gbvrl247.seq
1499945446     gbvrl248.seq
 230298392     gbvrl249.seq
 698157165     gbvrl25.seq
1499936975     gbvrl250.seq
 313202628     gbvrl251.seq
1499947348     gbvrl252.seq
 222386425     gbvrl253.seq
1499957211     gbvrl254.seq
 208397307     gbvrl255.seq
1499953889     gbvrl256.seq
 170515506     gbvrl257.seq
1499978791     gbvrl258.seq
 205467032     gbvrl259.seq
1499949076     gbvrl26.seq
1499920938     gbvrl260.seq
 295912593     gbvrl261.seq
1499957249     gbvrl262.seq
 384405916     gbvrl263.seq
1499966112     gbvrl264.seq
 201609631     gbvrl265.seq
1499961204     gbvrl266.seq
 411345203     gbvrl267.seq
1499942435     gbvrl268.seq
 518960910     gbvrl269.seq
 686814632     gbvrl27.seq
1499997615     gbvrl270.seq
 187761331     gbvrl271.seq
1499996166     gbvrl272.seq
 416166652     gbvrl273.seq
1499938316     gbvrl274.seq
 522218047     gbvrl275.seq
1499974275     gbvrl276.seq
 604774286     gbvrl277.seq
1499978033     gbvrl278.seq
 142731307     gbvrl279.seq
1499997709     gbvrl28.seq
1499993210     gbvrl280.seq
 211326852     gbvrl281.seq
1499934751     gbvrl282.seq
 197111211     gbvrl283.seq
1499939360     gbvrl284.seq
 159213285     gbvrl285.seq
1499977662     gbvrl286.seq
 190018967     gbvrl287.seq
1499978964     gbvrl288.seq
 651781641     gbvrl289.seq
 654803096     gbvrl29.seq
 492800055     gbvrl290.seq
 753935354     gbvrl291.seq
  76825365     gbvrl292.seq
1499968382     gbvrl293.seq
 252527616     gbvrl294.seq
1499987019     gbvrl295.seq
 280831626     gbvrl296.seq
1499997074     gbvrl297.seq
 175476247     gbvrl298.seq
1499976226     gbvrl299.seq
1499997090     gbvrl3.seq
1499975493     gbvrl30.seq
 148058589     gbvrl300.seq
1499985376     gbvrl301.seq
 259854867     gbvrl302.seq
1499990215     gbvrl303.seq
 141897533     gbvrl304.seq
1499995644     gbvrl305.seq
 120013980     gbvrl306.seq
 146315654     gbvrl307.seq
1499993952     gbvrl308.seq
 126535326     gbvrl309.seq
 411279220     gbvrl31.seq
1499971350     gbvrl310.seq
 471575154     gbvrl311.seq
1499987042     gbvrl312.seq
 148346202     gbvrl313.seq
1499967337     gbvrl314.seq
 363563831     gbvrl315.seq
1499977098     gbvrl316.seq
 781877443     gbvrl317.seq
1499987655     gbvrl318.seq
 556571433     gbvrl319.seq
1499976625     gbvrl32.seq
1499976345     gbvrl320.seq
 404383849     gbvrl321.seq
1499963477     gbvrl322.seq
 358758043     gbvrl323.seq
1499966120     gbvrl324.seq
 247590173     gbvrl325.seq
1499997788     gbvrl326.seq
 314795368     gbvrl327.seq
1499994504     gbvrl328.seq
 288183038     gbvrl329.seq
 362805364     gbvrl33.seq
1499972760     gbvrl330.seq
 285376689     gbvrl331.seq
1499969778     gbvrl332.seq
 291838016     gbvrl333.seq
1499983232     gbvrl334.seq
 289334857     gbvrl335.seq
1499991956     gbvrl336.seq
 280267919     gbvrl337.seq
1499960850     gbvrl338.seq
 638243646     gbvrl339.seq
1499935466     gbvrl34.seq
1499972202     gbvrl340.seq
 578918054     gbvrl341.seq
1499998481     gbvrl342.seq
 599138466     gbvrl343.seq
1499994978     gbvrl344.seq
 118761927     gbvrl345.seq
1499999702     gbvrl346.seq
 129130663     gbvrl347.seq
1499997643     gbvrl348.seq
 129754504     gbvrl349.seq
 326770670     gbvrl35.seq
1499987113     gbvrl350.seq
 655335361     gbvrl351.seq
1499990003     gbvrl352.seq
 260182883     gbvrl353.seq
1499979856     gbvrl354.seq
 815755206     gbvrl355.seq
1499985185     gbvrl356.seq
 400260625     gbvrl357.seq
1499985087     gbvrl358.seq
1499964474     gbvrl359.seq
1499955014     gbvrl36.seq
 128304707     gbvrl360.seq
1499989406     gbvrl361.seq
1478628474     gbvrl362.seq
1499965079     gbvrl363.seq
 892375602     gbvrl364.seq
1499976291     gbvrl365.seq
 581292052     gbvrl366.seq
1499988415     gbvrl367.seq
1327170446     gbvrl368.seq
1499991156     gbvrl369.seq
  45156819     gbvrl37.seq
 868341669     gbvrl370.seq
1499965843     gbvrl371.seq
 524215476     gbvrl372.seq
1499964968     gbvrl373.seq
 522803565     gbvrl374.seq
1499965688     gbvrl375.seq
 547042821     gbvrl376.seq
1499981956     gbvrl377.seq
 511154172     gbvrl378.seq
1499965124     gbvrl379.seq
1499940966     gbvrl38.seq
 243185008     gbvrl380.seq
1499984722     gbvrl381.seq
 552412285     gbvrl382.seq
1499961229     gbvrl383.seq
 560280642     gbvrl384.seq
1499987446     gbvrl385.seq
 191450535     gbvrl386.seq
1499980989     gbvrl387.seq
 187245107     gbvrl388.seq
1499992062     gbvrl389.seq
 185184459     gbvrl39.seq
 194261819     gbvrl390.seq
1499970778     gbvrl391.seq
 224025621     gbvrl392.seq
1499984761     gbvrl393.seq
 224558133     gbvrl394.seq
1499976504     gbvrl395.seq
 192196591     gbvrl396.seq
1499989468     gbvrl397.seq
 197533841     gbvrl398.seq
1499963161     gbvrl399.seq
 817228338     gbvrl4.seq
1499982463     gbvrl40.seq
1211006043     gbvrl400.seq
1499988072     gbvrl401.seq
 373548019     gbvrl402.seq
1499997878     gbvrl403.seq
 117986944     gbvrl404.seq
1499997720     gbvrl405.seq
 307441580     gbvrl406.seq
1499988566     gbvrl407.seq
1499988609     gbvrl408.seq
  79414913     gbvrl409.seq
 193684707     gbvrl41.seq
1499981020     gbvrl410.seq
 286893252     gbvrl411.seq
1499994169     gbvrl412.seq
 690991766     gbvrl413.seq
1499970869     gbvrl414.seq
 648355058     gbvrl415.seq
1499972443     gbvrl416.seq
1002053522     gbvrl417.seq
1499998892     gbvrl418.seq
 422344526     gbvrl419.seq
1499991329     gbvrl42.seq
1499993517     gbvrl420.seq
 199555483     gbvrl421.seq
1499996742     gbvrl422.seq
 156641592     gbvrl423.seq
1499982100     gbvrl424.seq
 900553679     gbvrl425.seq
1499986807     gbvrl426.seq
 845069940     gbvrl427.seq
1499960583     gbvrl428.seq
 266973321     gbvrl429.seq
 230283124     gbvrl43.seq
1499993266     gbvrl430.seq
 155092128     gbvrl431.seq
1499967295     gbvrl432.seq
1499992263     gbvrl433.seq
 111811288     gbvrl434.seq
1499996409     gbvrl435.seq
1499998216     gbvrl436.seq
 110488005     gbvrl437.seq
1499974697     gbvrl438.seq
1499990602     gbvrl439.seq
1499959971     gbvrl44.seq
 166973995     gbvrl440.seq
1499983908     gbvrl441.seq
 834156653     gbvrl442.seq
1499993731     gbvrl443.seq
 818954404     gbvrl444.seq
1499964915     gbvrl445.seq
 981968618     gbvrl446.seq
1499993856     gbvrl447.seq
 548472018     gbvrl448.seq
1499968322     gbvrl449.seq
 202630988     gbvrl45.seq
 154308129     gbvrl450.seq
1499982622     gbvrl451.seq
 339429957     gbvrl452.seq
1499976116     gbvrl453.seq
 275099037     gbvrl454.seq
1499999775     gbvrl455.seq
 433510706     gbvrl456.seq
1499967919     gbvrl457.seq
 583697439     gbvrl458.seq
1499986013     gbvrl459.seq
1499996109     gbvrl46.seq
 602096993     gbvrl460.seq
1499979751     gbvrl461.seq
 369501821     gbvrl462.seq
1499999388     gbvrl463.seq
 660264765     gbvrl464.seq
1499992123     gbvrl465.seq
1104098075     gbvrl466.seq
1499984463     gbvrl467.seq
 807624966     gbvrl468.seq
1499979791     gbvrl469.seq
 252233489     gbvrl47.seq
 324543448     gbvrl470.seq
1499979070     gbvrl471.seq
1178264328     gbvrl472.seq
1499966549     gbvrl473.seq
 186174121     gbvrl474.seq
1499961445     gbvrl475.seq
 936015222     gbvrl476.seq
1499989000     gbvrl477.seq
 767653214     gbvrl478.seq
1499966991     gbvrl479.seq
1499957625     gbvrl48.seq
1099967316     gbvrl480.seq
1499989687     gbvrl481.seq
 169077838     gbvrl482.seq
1499984643     gbvrl483.seq
 167845153     gbvrl484.seq
1499994760     gbvrl485.seq
 894202903     gbvrl486.seq
1499984151     gbvrl487.seq
 393211781     gbvrl488.seq
1499934959     gbvrl489.seq
 447617169     gbvrl49.seq
 271496953     gbvrl490.seq
1499971341     gbvrl491.seq
 140541163     gbvrl492.seq
1499948169     gbvrl493.seq
 158431107     gbvrl494.seq
1499968516     gbvrl495.seq
 155293767     gbvrl496.seq
1499992934     gbvrl497.seq
 175272813     gbvrl498.seq
1499993120     gbvrl499.seq
1499993608     gbvrl5.seq
1499974053     gbvrl50.seq
 329998573     gbvrl500.seq
 147269138     gbvrl51.seq
1499983714     gbvrl52.seq
 511776083     gbvrl53.seq
1499973777     gbvrl54.seq
 261163675     gbvrl55.seq
1499944982     gbvrl56.seq
 510777836     gbvrl57.seq
1499995174     gbvrl58.seq
 817415523     gbvrl59.seq
 169170507     gbvrl6.seq
1499980013     gbvrl60.seq
1230490022     gbvrl61.seq
1499971382     gbvrl62.seq
 325763725     gbvrl63.seq
1499980028     gbvrl64.seq
 301367589     gbvrl65.seq
1499969226     gbvrl66.seq
 188123676     gbvrl67.seq
1499949587     gbvrl68.seq
 763759112     gbvrl69.seq
1138254563     gbvrl7.seq
1499988754     gbvrl70.seq
 240163427     gbvrl71.seq
1499956644     gbvrl72.seq
 768489646     gbvrl73.seq
1499966095     gbvrl74.seq
 730324025     gbvrl75.seq
1499947675     gbvrl76.seq
 338621284     gbvrl77.seq
1499983032     gbvrl78.seq
 135739427     gbvrl79.seq
1322695540     gbvrl8.seq
1499962296     gbvrl80.seq
 154500299     gbvrl81.seq
1499961171     gbvrl82.seq
 493282298     gbvrl83.seq
1499933943     gbvrl84.seq
 507522902     gbvrl85.seq
1500000150     gbvrl86.seq
 177157762     gbvrl87.seq
1499983292     gbvrl88.seq
 768363177     gbvrl89.seq
1349996715     gbvrl9.seq
1499983227     gbvrl90.seq
 782881658     gbvrl91.seq
1499989858     gbvrl92.seq
 813540773     gbvrl93.seq
1499993376     gbvrl94.seq
 786967571     gbvrl95.seq
1499940913     gbvrl96.seq
 771088012     gbvrl97.seq
1499991668     gbvrl98.seq
 784499923     gbvrl99.seq
1468058265     gbvrt1.seq
  36035214     gbvrt10.seq
1485729464     gbvrt100.seq
 364224646     gbvrt101.seq
1454173384     gbvrt102.seq
 502254939     gbvrt103.seq
1486134171     gbvrt104.seq
 517506322     gbvrt105.seq
1480727556     gbvrt106.seq
 529300923     gbvrt107.seq
1459332513     gbvrt108.seq
 519249086     gbvrt109.seq
  18509260     gbvrt11.seq
1412269603     gbvrt110.seq
 909200691     gbvrt111.seq
1459032465     gbvrt112.seq
 536522478     gbvrt113.seq
1495454402     gbvrt114.seq
1299521924     gbvrt115.seq
1068402516     gbvrt116.seq
1067356333     gbvrt117.seq
 896844819     gbvrt118.seq
 805318347     gbvrt119.seq
1476200942     gbvrt12.seq
1275607078     gbvrt120.seq
1208361644     gbvrt121.seq
 874873715     gbvrt122.seq
1313422787     gbvrt123.seq
 610271897     gbvrt124.seq
1339215836     gbvrt125.seq
 979774749     gbvrt126.seq
1497240842     gbvrt127.seq
 618693600     gbvrt128.seq
1499998028     gbvrt129.seq
 400795564     gbvrt13.seq
  31406482     gbvrt130.seq
1499999976     gbvrt131.seq
 315477455     gbvrt132.seq
1482267392     gbvrt133.seq
 261184260     gbvrt134.seq
1499143791     gbvrt135.seq
 307973844     gbvrt136.seq
1496470195     gbvrt137.seq
 318409279     gbvrt138.seq
1387287611     gbvrt139.seq
1477671221     gbvrt14.seq
 440417012     gbvrt140.seq
1462502954     gbvrt141.seq
 397305085     gbvrt142.seq
1452249458     gbvrt143.seq
 304334214     gbvrt144.seq
1499843291     gbvrt145.seq
 379444472     gbvrt146.seq
1455454267     gbvrt147.seq
 638926262     gbvrt148.seq
1347300249     gbvrt149.seq
1470893574     gbvrt15.seq
1090722360     gbvrt150.seq
1424049174     gbvrt151.seq
1131671891     gbvrt152.seq
1475422119     gbvrt153.seq
 669038893     gbvrt154.seq
1423634438     gbvrt155.seq
 610507108     gbvrt156.seq
1499738673     gbvrt157.seq
 396058162     gbvrt158.seq
1465167303     gbvrt159.seq
  31730937     gbvrt16.seq
1318097988     gbvrt160.seq
1411652468     gbvrt161.seq
 830773125     gbvrt162.seq
1475965361     gbvrt163.seq
 455697611     gbvrt164.seq
1323020998     gbvrt165.seq
 551278929     gbvrt166.seq
1434907616     gbvrt167.seq
 935652816     gbvrt168.seq
1471350912     gbvrt169.seq
1452402811     gbvrt17.seq
 428120730     gbvrt170.seq
1491982996     gbvrt171.seq
 399691693     gbvrt172.seq
1435928990     gbvrt173.seq
1247981644     gbvrt174.seq
1387198395     gbvrt175.seq
 213511428     gbvrt176.seq
1489745725     gbvrt177.seq
 759478599     gbvrt178.seq
1468623321     gbvrt179.seq
1092242590     gbvrt18.seq
 460358961     gbvrt180.seq
1467172079     gbvrt181.seq
1345676885     gbvrt182.seq
1486880208     gbvrt183.seq
1122413695     gbvrt184.seq
1476213975     gbvrt185.seq
 397154674     gbvrt186.seq
1467952250     gbvrt187.seq
 389233192     gbvrt188.seq
1426124383     gbvrt189.seq
1316531590     gbvrt19.seq
 405994817     gbvrt190.seq
1469721309     gbvrt191.seq
 383609506     gbvrt192.seq
1381550111     gbvrt193.seq
 561205445     gbvrt194.seq
1492011964     gbvrt195.seq
 653049694     gbvrt196.seq
1450733084     gbvrt197.seq
1067206529     gbvrt198.seq
1459743522     gbvrt199.seq
 179100385     gbvrt2.seq
 499274320     gbvrt20.seq
 364192132     gbvrt200.seq
1486440147     gbvrt201.seq
 653832483     gbvrt202.seq
1493363852     gbvrt203.seq
 916878857     gbvrt204.seq
1460465244     gbvrt205.seq
 684468901     gbvrt206.seq
1448879046     gbvrt207.seq
1487906509     gbvrt208.seq
 434374845     gbvrt209.seq
1481126296     gbvrt21.seq
1488705693     gbvrt210.seq
1478032480     gbvrt211.seq
 278515425     gbvrt212.seq
1469979030     gbvrt213.seq
 961949486     gbvrt214.seq
1483460944     gbvrt215.seq
 677455821     gbvrt216.seq
1498270326     gbvrt217.seq
 718453633     gbvrt218.seq
1437008966     gbvrt219.seq
 940986949     gbvrt22.seq
 957293922     gbvrt220.seq
1476461444     gbvrt221.seq
 272371816     gbvrt222.seq
1485679392     gbvrt223.seq
1256408466     gbvrt224.seq
 614199771     gbvrt225.seq
1395355507     gbvrt226.seq
 696592317     gbvrt227.seq
1290299260     gbvrt228.seq
 277305730     gbvrt229.seq
1487830536     gbvrt23.seq
1490466987     gbvrt230.seq
 655125810     gbvrt231.seq
1446091140     gbvrt232.seq
 932987741     gbvrt233.seq
1479165845     gbvrt234.seq
 363696268     gbvrt235.seq
1492170807     gbvrt236.seq
 923218703     gbvrt237.seq
1483460584     gbvrt238.seq
 229681564     gbvrt239.seq
 986318196     gbvrt24.seq
1492440393     gbvrt240.seq
1284017470     gbvrt241.seq
1394001431     gbvrt242.seq
 673363046     gbvrt243.seq
1488473559     gbvrt244.seq
 407893020     gbvrt245.seq
1473520932     gbvrt246.seq
 654301981     gbvrt247.seq
1469440727     gbvrt248.seq
 934642922     gbvrt249.seq
  14152653     gbvrt25.seq
1460398956     gbvrt250.seq
1493793319     gbvrt251.seq
 374388369     gbvrt252.seq
1484677935     gbvrt253.seq
1009171480     gbvrt254.seq
1403476973     gbvrt255.seq
1346978043     gbvrt256.seq
1441967866     gbvrt257.seq
1400238976     gbvrt258.seq
1431868899     gbvrt259.seq
  21384662     gbvrt26.seq
1313620902     gbvrt260.seq
1468693257     gbvrt261.seq
1479203621     gbvrt262.seq
  90973101     gbvrt27.seq
1499997742     gbvrt28.seq
  56321478     gbvrt29.seq
1480634500     gbvrt3.seq
1460195792     gbvrt30.seq
 572961549     gbvrt31.seq
 621765140     gbvrt32.seq
 949053871     gbvrt33.seq
 529548188     gbvrt34.seq
 444750187     gbvrt35.seq
 889393177     gbvrt36.seq
 780127735     gbvrt37.seq
1485235339     gbvrt38.seq
1479243859     gbvrt39.seq
1457482237     gbvrt4.seq
 202128841     gbvrt40.seq
 123737443     gbvrt41.seq
1498565199     gbvrt42.seq
 763182343     gbvrt43.seq
1488184704     gbvrt44.seq
 819078271     gbvrt45.seq
1499445183     gbvrt46.seq
 296243230     gbvrt47.seq
1143508697     gbvrt48.seq
1296370380     gbvrt49.seq
 263925679     gbvrt5.seq
 746782204     gbvrt50.seq
1457234622     gbvrt51.seq
 393840973     gbvrt52.seq
1494590474     gbvrt53.seq
 435867530     gbvrt54.seq
1485692216     gbvrt55.seq
 404627914     gbvrt56.seq
1063697372     gbvrt57.seq
1045817455     gbvrt58.seq
1371630420     gbvrt59.seq
 290137511     gbvrt6.seq
 960934801     gbvrt60.seq
1493316628     gbvrt61.seq
1475293258     gbvrt62.seq
  58362561     gbvrt63.seq
1482158915     gbvrt64.seq
 639394801     gbvrt65.seq
1498842847     gbvrt66.seq
  33970348     gbvrt67.seq
 979125220     gbvrt68.seq
 838606763     gbvrt69.seq
  87351605     gbvrt7.seq
1154852032     gbvrt70.seq
 461393140     gbvrt71.seq
1435965547     gbvrt72.seq
1109806300     gbvrt73.seq
1468553589     gbvrt74.seq
 102870006     gbvrt75.seq
1493447786     gbvrt76.seq
  82391381     gbvrt77.seq
1481005359     gbvrt78.seq
 135038714     gbvrt79.seq
 784474650     gbvrt8.seq
 957165421     gbvrt80.seq
 366785399     gbvrt81.seq
1174207210     gbvrt82.seq
1368170987     gbvrt83.seq
1282827292     gbvrt84.seq
 580591240     gbvrt85.seq
1496410569     gbvrt86.seq
1024127150     gbvrt87.seq
1427163403     gbvrt88.seq
 309141780     gbvrt89.seq
  15637436     gbvrt9.seq
1177165187     gbvrt90.seq
 397267012     gbvrt91.seq
1323824839     gbvrt92.seq
 807815425     gbvrt93.seq
1330262106     gbvrt94.seq
 539530879     gbvrt95.seq
1447265202     gbvrt96.seq
 467059616     gbvrt97.seq
1496966168     gbvrt98.seq
 241197913     gbvrt99.seq

2.2.6 Per-Division Statistics

  The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.

CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.

Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:

   ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
   ftp://ftp.ncbi.nih.gov/genbank/wgs

rather than being incorporated within the GenBank release distribution.

Division     Entries    Bases

BCT1         139664     536999694
BCT10        390        694003146
BCT100       313        686008328
BCT101       86         186554933
BCT102       315        673356486
BCT103       71         266229652
BCT104       359        707464119
BCT105       185        331548218
BCT106       540        723201010
BCT107       49         79557253
BCT108       259        685328142
BCT109       144        305110474
BCT11        247        282188724
BCT110       268        670236543
BCT111       114        281252692
BCT112       329        738947741
BCT113       158        230327834
BCT114       283        703675834
BCT115       77         201962351
BCT116       305        767929105
BCT117       319        584205223
BCT118       296        766696863
BCT119       59         208789717
BCT12        384        664743830
BCT120       334        692270779
BCT121       91         253364550
BCT122       288        651858869
BCT123       370        693488277
BCT124       157        354462091
BCT125       284        672223242
BCT126       97         183022758
BCT127       266        694640215
BCT128       105        213496548
BCT129       446        656193558
BCT13        316        481274184
BCT130       163        250866080
BCT131       377        706151574
BCT132       126        282249302
BCT133       327        670812957
BCT134       424        659426410
BCT135       113        172260629
BCT136       320        674859435
BCT137       189        404428216
BCT138       281        697681585
BCT139       140        403171025
BCT14        276        687623374
BCT140       369        669036164
BCT141       243        448139257
BCT142       316        699744804
BCT143       150        407349061
BCT144       478        699871534
BCT145       288        497943859
BCT146       477        746353925
BCT147       150        337823520
BCT148       959        699342382
BCT149       480        455342118
BCT15        166        297846171
BCT150       338        656362787
BCT151       545        674775711
BCT152       203        383021913
BCT153       429        667148863
BCT154       370        704497346
BCT155       57         119601929
BCT156       390        687378593
BCT157       239        472807144
BCT158       329        685145659
BCT159       199        664697068
BCT16        275        683359919
BCT160       179        240675893
BCT161       441        712261572
BCT162       289        330907991
BCT163       251        706167886
BCT164       71         284878415
BCT165       315        670872955
BCT166       428        701304051
BCT167       173        335960774
BCT168       667        730615224
BCT169       396        712058429
BCT17        301        480749119
BCT170       119        241943416
BCT171       291        674466192
BCT172       332        587815415
BCT173       319        670045139
BCT174       367        846250492
BCT175       61         146044509
BCT176       370        670602954
BCT177       369        678296218
BCT178       201        316231094
BCT179       424        675491536
BCT18        435        753272469
BCT180       311        490137761
BCT181       415        679490372
BCT182       192        437447487
BCT183       330        787716437
BCT184       187        349442111
BCT185       341        657762164
BCT186       168        445528624
BCT187       342        666061591
BCT188       163        298189685
BCT189       406        689598288
BCT19        158        290062141
BCT190       169        218145337
BCT191       472        652378164
BCT192       312        665745608
BCT193       361        692387575
BCT194       249        666682460
BCT195       80         144086040
BCT196       400        666252680
BCT197       143        254983835
BCT198       376        661814324
BCT199       315        201951674
BCT2         41290      139250707
BCT20        598        677730064
BCT200       628        644873273
BCT201       481        651195160
BCT202       70         94940965
BCT203       439        636051606
BCT204       418        612731900
BCT205       437        637962908
BCT206       220        328677699
BCT207       500        698086729
BCT208       127        251573754
BCT209       372        682660814
BCT21        139        188791496
BCT210       227        341377866
BCT211       316        688661747
BCT212       299        752239060
BCT213       68         130665359
BCT214       441        675656916
BCT215       434        667598041
BCT216       144        227879512
BCT217       334        695180798
BCT218       193        289978125
BCT219       338        660371791
BCT22        462        674392358
BCT220       260        306897426
BCT221       426        827844024
BCT222       386        727585125
BCT223       142        309990352
BCT224       304        678101365
BCT225       372        654818872
BCT226       54         66684327
BCT227       392        667048801
BCT228       470        522271952
BCT229       321        686558904
BCT23        342        372212662
BCT230       483        644375735
BCT231       75         90645632
BCT232       413        677931216
BCT233       254        367362629
BCT234       440        693114727
BCT235       350        646825420
BCT236       485        707552806
BCT237       249        529154963
BCT238       415        688842497
BCT239       210        471765803
BCT24        357        677414549
BCT240       358        671094502
BCT241       319        675028021
BCT242       46         122532076
BCT243       440        668226425
BCT244       381        644602548
BCT245       504        684756018
BCT246       335        667187177
BCT247       166        193072369
BCT248       238        646470162
BCT249       305        580249948
BCT25        294        671349427
BCT250       345        672014255
BCT251       258        420886518
BCT252       214        658347488
BCT253       232        376629222
BCT254       300        659307445
BCT255       143        216424498
BCT256       307        653479585
BCT257       180        260037147
BCT258       345        686074346
BCT259       173        296775957
BCT26        613        305747273
BCT260       377        666927692
BCT261       264        782239457
BCT262       365        747173659
BCT263       247        418943060
BCT264       437        651796745
BCT265       375        616496247
BCT266       309        667222417
BCT267       182        302230052
BCT268       438        679546578
BCT269       424        460180827
BCT27        5200       7533877
BCT270       387        699745129
BCT271       325        501491124
BCT272       416        644538422
BCT273       193        253356878
BCT274       386        691663821
BCT275       263        402417581
BCT276       443        694583877
BCT277       260        466472220
BCT278       459        693247317
BCT279       213        639323632
BCT28        10402      13141863
BCT280       292        654469081
BCT281       171        432101955
BCT282       651        649602723
BCT283       318        698634113
BCT284       175        280721442
BCT285       272        658369384
BCT286       314        485994414
BCT287       396        646216098
BCT288       176        390471586
BCT289       293        688048690
BCT29        54209      648763156
BCT290       369        671728286
BCT291       100        168361190
BCT292       333        667080044
BCT293       193        338774227
BCT294       303        664019838
BCT295       231        324037067
BCT296       344        647185266
BCT297       405        677626684
BCT298       59         98012374
BCT299       235        643472315
BCT3         20642      162919204
BCT30        121        222525681
BCT300       353        629473515
BCT301       292        640635194
BCT302       224        327193062
BCT303       405        646629552
BCT304       209        334314959
BCT305       573        674380587
BCT306       378        725714435
BCT307       6          18483781
BCT308       281        633821805
BCT309       360        654202900
BCT31        358        671327540
BCT310       147        285619086
BCT311       361        665544683
BCT312       378        627905296
BCT313       383        627347667
BCT314       266        468400974
BCT315       325        644847333
BCT316       451        673555186
BCT317       359        658952122
BCT318       424        686296793
BCT319       89         130404807
BCT32        419        594405189
BCT320       330        650007272
BCT321       105        284506479
BCT322       440        656174607
BCT323       94         265503770
BCT324       340        672439014
BCT325       206        275447558
BCT326       332        639067171
BCT327       249        499515028
BCT328       377        628733950
BCT329       215        415878255
BCT33        456        674092197
BCT330       312        678427785
BCT331       485        750363917
BCT332       4          11912114
BCT333       167        636678640
BCT334       97         631099143
BCT335       127        646036009
BCT336       57         345887642
BCT337       143        645379470
BCT338       78         433650689
BCT339       160        653226107
BCT34        372        603078315
BCT340       115        443663645
BCT341       152        648947181
BCT342       55         241628868
BCT343       121        646195308
BCT344       47         253146779
BCT345       147        647737870
BCT346       120        584084839
BCT347       134        643229316
BCT348       230        525310286
BCT349       355        705963651
BCT35        379        664089429
BCT350       183        402530142
BCT351       358        635267831
BCT352       353        525187528
BCT353       316        664994926
BCT354       226        525190349
BCT355       508        682664960
BCT356       94         269059838
BCT357       222        628005525
BCT358       135        261140776
BCT359       449        671128167
BCT36        367        677624510
BCT360       300        446674917
BCT361       473        640454650
BCT362       282        630968580
BCT363       44         49365259
BCT364       373        683809415
BCT365       279        614360383
BCT366       403        694618320
BCT367       310        518741606
BCT368       452        676362373
BCT369       125        232240613
BCT37        39         56943508
BCT370       292        654884521
BCT371       110        239102413
BCT372       386        670241512
BCT373       198        396321805
BCT374       548        676307930
BCT375       527        670975754
BCT376       192        305310552
BCT377       531        623574336
BCT378       293        611016427
BCT379       441        627143876
BCT38        374        694325818
BCT380       295        645959753
BCT381       26         104761867
BCT382       265        639847347
BCT383       379        630615010
BCT384       51         126960548
BCT385       363        628726174
BCT386       295        478775852
BCT387       262        648835144
BCT388       190        273071906
BCT389       391        632570770
BCT39        396        693357627
BCT390       262        391233747
BCT391       360        714288715
BCT392       179        585563825
BCT393       563        828720015
BCT394       408        672794166
BCT395       316        656280184
BCT396       186        370748899
BCT397       262        626371585
BCT398       405        621215565
BCT399       419        656442490
BCT4         2600       37759883
BCT40        52         118148953
BCT400       223        340394746
BCT401       333        688078851
BCT402       241        481078224
BCT403       356        669330897
BCT404       170        266451857
BCT405       265        642518397
BCT406       379        466847110
BCT407       342        655545292
BCT408       260        475834607
BCT409       358        624707174
BCT41        796        696617075
BCT410       345        605314708
BCT411       358        648866058
BCT412       255        406734626
BCT413       198        647369504
BCT414       222        618744647
BCT415       313        378730428
BCT416       378        649040273
BCT417       196        375266335
BCT418       369        617220774
BCT419       302        555938604
BCT42        230        431440059
BCT420       459        642351978
BCT421       316        679961213
BCT422       82         211624112
BCT423       452        610935467
BCT424       264        299500250
BCT425       354        625049936
BCT426       321        625554114
BCT427       15         34865413
BCT428       260        622052673
BCT429       39         243603559
BCT43        311        684059725
BCT430       188        652035629
BCT431       147        308264255
BCT432       438        648097510
BCT433       169        311815034
BCT434       195        623758807
BCT435       120        306928912
BCT436       343        622013639
BCT437       123        244628988
BCT438       392        624795532
BCT439       347        567459897
BCT44        154        357666507
BCT440       528        115589384
BCT441       1589       2511957
BCT442       3172       5268484
BCT443       6338       7796395
BCT444       12613      14997690
BCT445       25523      27672494
BCT446       50566      54072396
BCT447       166383     556300215
BCT448       12332      675554497
BCT449       37482      37185396
BCT45        144        637189325
BCT450       92237      583946925
BCT451       161671     250146338
BCT452       233740     245046478
BCT453       170493     176666222
BCT454       164080     211249352
BCT455       124079     195539297
BCT456       33016      54145060
BCT457       50525      600609271
BCT458       10328      728421317
BCT459       230        653821350
BCT46        160        545984007
BCT460       33         131631016
BCT461       1323       754705553
BCT462       315        83741870
BCT463       2127       810456341
BCT464       1183       371759925
BCT465       4193       886697155
BCT466       334        232684475
BCT467       1043       1030649457
BCT468       1955       264372364
BCT469       3187       696028611
BCT47        340        704704839
BCT470       1230       124242115
BCT471       1505       751257121
BCT472       3124       318518660
BCT473       2788       828576046
BCT474       3023       263078339
BCT475       11940      19905115
BCT476       25214      42009480
BCT477       325442     547532258
BCT478       271470     689171700
BCT479       226206     617625598
BCT48        146        405372370
BCT480       722        688004891
BCT481       577        618768312
BCT482       38         55093914
BCT483       607        618099506
BCT484       210        257204804
BCT485       792        654368007
BCT486       887        213393379
BCT487       1341       819372934
BCT488       11201      995713321
BCT489       63426      107588223
BCT49        259        690725478
BCT5         1310       133308362
BCT50        63         136095527
BCT51        279        702765807
BCT52        26         40531428
BCT53        343        697338437
BCT54        58         110998566
BCT55        301        660722517
BCT56        127        223764756
BCT57        453        673424782
BCT58        101        303664097
BCT59        242        671563340
BCT6         430        725555801
BCT60        82         227377851
BCT61        268        664367513
BCT62        56         148271596
BCT63        291        670664321
BCT64        86         227081335
BCT65        323        663992349
BCT66        333        679448001
BCT67        86         182409315
BCT68        369        662183874
BCT69        84         205444414
BCT7         316        516242823
BCT70        294        658701110
BCT71        233        500919777
BCT72        422        664297264
BCT73        223        395380525
BCT74        370        666003289
BCT75        348        636504855
BCT76        297        678329572
BCT77        343        668224512
BCT78        38         75313317
BCT79        358        673377884
BCT8         514        732280603
BCT80        94         214484227
BCT81        351        683940273
BCT82        87         223229033
BCT83        336        686119856
BCT84        103        304051498
BCT85        343        675434425
BCT86        80         115502557
BCT87        379        669168323
BCT88        88         131589933
BCT89        353        663579784
BCT9         245        283828224
BCT90        96         256891944
BCT91        356        677675082
BCT92        266        577177478
BCT93        333        670989602
BCT94        180        339695403
BCT95        366        714952072
BCT96        228        331655967
BCT97        327        660101032
BCT98        207        439418004
BCT99        293        679294620
ENV1         404937     506709341
ENV10        183059     146776383
ENV11        492910     245408708
ENV12        680883     353491833
ENV13        27923      26140362
ENV14        421694     313470755
ENV15        519063     426099006
ENV16        11751      16006918
ENV17        476491     288515159
ENV18        375200     290695381
ENV19        517433     393056635
ENV2         73         11613513
ENV20        508906     314719962
ENV21        472263     319402089
ENV22        525525     295738808
ENV23        537294     220329109
ENV24        592004     283001775
ENV25        563389     321632351
ENV26        57594      45328618
ENV27        587688     414964512
ENV28        97889      45161922
ENV29        393209     417752053
ENV3         319        731777883
ENV30        259174     548708870
ENV31        256533     729077554
ENV32        3949       384415056
ENV33        2493       1171029364
ENV34        1068       442962284
ENV35        1934       1180770225
ENV36        1128       437186186
ENV37        1768       1180613371
ENV38        21582      1111488901
ENV4         89         278074983
ENV5         284        677335420
ENV6         53756      635327021
ENV7         185739     146290752
ENV8         414918     279534879
ENV9         599249     400800118
EST1         465976     174308005
EST10        481577     252082320
EST100       158125     88082990
EST101       493158     275046361
EST102       154890     85087468
EST103       547240     296212967
EST104       168391     100328981
EST105       556373     329214741
EST106       185081     121000246
EST107       580225     336391510
EST108       545191     308142191
EST109       130519     94474032
EST11        429853     128221438
EST110       508888     301384258
EST111       109023     112354717
EST112       437565     290689053
EST113       220901     102175098
EST114       398624     285019381
EST115       130884     92539409
EST116       389716     266775573
EST117       36548      26163923
EST118       382032     252083001
EST119       161574     125946930
EST12        221159     94063393
EST120       420167     313727282
EST121       184919     116539761
EST122       462840     311430957
EST123       139788     105468049
EST124       534831     299248386
EST125       170989     73028342
EST126       571281     236570929
EST127       491989     310884819
EST128       151591     111297674
EST129       528274     304798138
EST13        574138     276186829
EST130       161308     106026732
EST131       677540     334207567
EST132       151098     28711854
EST133       559655     299741791
EST134       160224     95384731
EST135       490023     306480012
EST136       577340     193413119
EST137       188946     104628264
EST138       510403     321445357
EST139       165963     109744354
EST14        149561     63750999
EST140       414706     231859589
EST141       169139     109591947
EST142       657323     144220515
EST143       152251     98608210
EST144       534506     235415684
EST145       189664     85842442
EST146       332806     200909185
EST147       491183     305564747
EST148       155779     102526376
EST149       523254     308142252
EST15        474688     201018521
EST150       178669     59729954
EST151       587308     221970686
EST152       134728     70211808
EST153       473592     299055057
EST154       127497     99641733
EST155       459728     278586225
EST156       180967     110916687
EST157       45656      24624838
EST158       451350     303422918
EST159       183083     135579620
EST16        160842     65992054
EST160       464644     313067864
EST161       189159     129985144
EST162       407887     274749429
EST163       198569     138310610
EST164       452689     254020495
EST165       144187     103733981
EST166       425868     264733543
EST167       20620      12734823
EST168       426763     236830374
EST169       143889     94550330
EST17        306608     95571642
EST170       398052     240332689
EST171       240908     95386887
EST172       486689     279364963
EST173       138149     89269660
EST174       445456     288763289
EST175       182155     105268865
EST176       422937     273024480
EST177       103805     57906829
EST178       219943     129375172
EST179       435862     117125271
EST18        138052     41387053
EST180       190950     95121038
EST181       659096     332056302
EST182       127130     74522588
EST183       352989     223093653
EST184       493815     223270384
EST185       567683     329791022
EST186       442902     240433889
EST187       451830     310350657
EST188       381549     264729283
EST189       387238     232559712
EST19        299436     115813634
EST190       431548     239746327
EST191       424495     267800387
EST192       606518     384619438
EST193       189550     147652903
EST194       557182     367467313
EST195       188651     95531952
EST196       53496      4381716
EST197       451133     55157858
EST198       156807     31263509
EST199       460623     211506156
EST2         142972     56362966
EST20        176929     85502574
EST200       181098     124632758
EST201       445100     290099564
EST202       158052     106518489
EST203       465818     306521320
EST204       177702     52775394
EST205       457921     239013622
EST206       192739     124166988
EST207       471666     292757095
EST208       53584      36369591
EST209       419056     265466533
EST21        496958     246043309
EST210       200883     108404595
EST211       475990     286007102
EST212       152337     94448802
EST213       276286     196489423
EST214       180678     101734904
EST215       389182     240021351
EST216       198580     118458430
EST217       460276     275110831
EST218       184427     97103782
EST219       52576      18674859
EST22        154879     80580954
EST220       357770     195914248
EST221       403737     237446972
EST222       440714     284713365
EST223       154782     104219075
EST224       556630     237259583
EST225       198957     81989254
EST226       533110     305456743
EST227       172256     103855394
EST228       561980     312437493
EST229       148085     94327161
EST23        264609     135994557
EST230       601018     359923809
EST231       242717     139214337
EST232       508900     312904166
EST233       142528     105405842
EST234       476833     262183573
EST235       163063     89048145
EST236       499874     289251350
EST237       179145     110564956
EST238       483704     314410532
EST239       393878     233972777
EST24        460293     266124960
EST240       499671     220317300
EST241       576113     283373013
EST242       254793     94532453
EST25        150042     69979263
EST26        455064     225720289
EST27        144592     70134537
EST28        460797     281792175
EST29        160342     95675829
EST3         492128     195350244
EST30        484284     271250504
EST31        142359     77840949
EST32        445721     260790103
EST33        153889     89395075
EST34        29919      18235506
EST35        569214     308978499
EST36        182131     105121512
EST37        500261     278248543
EST38        139297     68362338
EST39        435073     255829231
EST4         161030     67846589
EST40        154788     96890584
EST41        589975     319712521
EST42        192052     90422854
EST43        487450     258619427
EST44        158965     76792507
EST45        9280       6073374
EST46        442741     260798718
EST47        156607     97637854
EST48        421050     306171448
EST49        138671     96437559
EST5         488671     205649453
EST50        507078     302238437
EST51        243574     145747084
EST52        601118     323929605
EST53        5247       4072427
EST54        469569     317285388
EST55        22061      15459633
EST56        250340     125936906
EST57        202081     76928243
EST58        250503     102943876
EST59        98585      38868261
EST6         150866     64812329
EST60        427303     216191888
EST61        175185     110572580
EST62        446633     263401687
EST63        190475     97972920
EST64        441422     236190066
EST65        167652     90599708
EST66        527277     302758122
EST67        102221     51075084
EST68        432405     247335621
EST69        175123     90970490
EST7         291441     131311477
EST70        543445     284379853
EST71        164437     89153404
EST72        420400     254373177
EST73        167129     91197766
EST74        355879     177143441
EST75        150529     60061844
EST76        413719     180471295
EST77        196862     91090078
EST78        311172     203722989
EST79        526471     312854441
EST8         501115     299793017
EST80        145000     99007544
EST81        433492     246106113
EST82        174266     99089757
EST83        478062     282295953
EST84        145514     81294923
EST85        459859     254721587
EST86        155832     96738108
EST87        450591     259794432
EST88        178255     102925741
EST89        5847       2580354
EST9         439351     285544455
EST90        369514     213693507
EST91        415229     292637772
EST92        419069     250971251
EST93        375416     191054939
EST94        436842     262952057
EST95        165131     96826677
EST96        439190     281516638
EST97        153002     94469004
EST98        301149     203641357
EST99        490758     268052654
GSS1         483479     349296758
GSS10        391683     194341709
GSS100       2274       1542283
GSS101       776374     133025642
GSS102       122799     38229406
GSS103       624800     195033669
GSS104       154284     118424343
GSS105       496563     436607634
GSS106       175118     110480586
GSS107       665326     198163607
GSS108       119552     74878565
GSS109       462006     285653804
GSS11        155367     79661762
GSS110       166240     155187647
GSS111       112668     95722541
GSS112       555202     399341861
GSS113       188219     120281085
GSS114       482468     298773687
GSS115       217825     157511758
GSS116       543320     316118332
GSS117       207632     160972255
GSS118       590057     423851163
GSS119       850        586793
GSS12        457196     238008904
GSS120       616159     297779103
GSS121       177796     157191723
GSS122       638931     402352079
GSS13        175144     90548059
GSS14        537019     298986355
GSS15        173003     102201943
GSS16        513089     314581178
GSS17        177549     111653998
GSS18        418012     267632244
GSS19        521973     393446021
GSS2         152811     121962910
GSS20        139684     92497595
GSS21        568921     363541416
GSS22        185578     99457730
GSS23        620985     349129033
GSS24        158242     124831479
GSS25        554090     298950468
GSS26        157711     106164335
GSS27        23373      13575160
GSS28        505039     370708561
GSS29        172261     112292009
GSS3         500646     345235457
GSS30        565436     375245186
GSS31        188389     112239236
GSS32        605466     430616003
GSS33        173702     107612445
GSS34        501724     284079029
GSS35        10996      7014618
GSS36        491030     309073818
GSS37        170755     109403665
GSS38        538043     353403523
GSS39        166078     107995492
GSS4         157003     133271684
GSS40        536737     340172826
GSS41        202632     111594409
GSS42        653734     335593144
GSS43        183488     92579192
GSS44        94686      37020965
GSS45        585911     321398749
GSS46        172776     150369921
GSS47        482732     359484724
GSS48        152735     105716923
GSS49        479141     374150005
GSS5         536920     294702650
GSS50        203415     126254195
GSS51        606791     347773427
GSS52        87651      57041080
GSS53        462295     351756795
GSS54        200794     128380249
GSS55        534833     304211555
GSS56        173044     78313504
GSS57        550605     311726285
GSS58        168220     79987296
GSS59        399167     307814698
GSS6         175736     90330569
GSS60        140506     112006346
GSS61        191812     159136714
GSS62        411776     338336075
GSS63        142406     112405669
GSS64        403234     325962624
GSS65        142862     120117095
GSS66        413177     335229827
GSS67        137857     113114394
GSS68        404638     324868198
GSS69        140643     117810168
GSS7         483637     250948919
GSS70        127182     92203837
GSS71        520909     323743563
GSS72        177517     102495279
GSS73        597632     395661030
GSS74        181036     126546097
GSS75        591119     414687777
GSS76        174298     134353538
GSS77        447818     251319701
GSS78        130317     57968536
GSS79        414776     307467555
GSS8         153561     95947803
GSS80        416891     261940117
GSS81        540328     348413356
GSS82        200211     139979325
GSS83        556164     409599797
GSS84        234505     111781688
GSS85        389319     246454652
GSS86        404418     350493972
GSS87        167924     158457537
GSS88        450647     353725576
GSS89        194833     131985347
GSS9         260253     131851340
GSS90        546343     347113850
GSS91        172839     121730031
GSS92        400359     246403089
GSS93        634003     413022963
GSS94        166388     136382073
GSS95        471133     373509240
GSS96        159807     141640417
GSS97        483856     431439713
GSS98        161900     124659678
GSS99        510919     344605321
HTC1         105590     213533747
HTC2         84852      50689748
HTC3         254863     284399082
HTC4         206260     192647591
HTG1         11398      1117560132
HTG10        4244       750053411
HTG11        5182       963529330
HTG12        5229       925700078
HTG13        5872       951465002
HTG14        5905       911954351
HTG15        5640       947566428
HTG16        5581       924865237
HTG17        5746       923702884
HTG18        5508       921042016
HTG19        5000       887751861
HTG2         5247       745343076
HTG20        5175       952063066
HTG21        7803       1147337632
HTG22        884        128257683
HTG23        8962       1119670148
HTG24        2952       336739408
HTG25        9544       1078904075
HTG26        7886       1058117822
HTG27        7154       1044981329
HTG28        6001       1063213749
HTG29        7669       1153930410
HTG3         5409       1144201139
HTG30        7331       990967405
HTG4         4824       728956388
HTG5         5091       1147003877
HTG6         3585       742321238
HTG7         5371       1144980645
HTG8         4025       736493117
HTG9         7138       1137709550
INV1         273516     651614746
INV10        2          74198017
INV100       255703     649137730
INV100       4          1094538185
INV100       224        467055727
INV100       48         1166873382
INV100       21         419145863
INV100       10         1154316587
INV100       49         1174737284
INV100       11         250196730
INV100       20         1127362232
INV100       6          591094294
INV100       39         1141924266
INV101       222476     930556764
INV101       10         392380997
INV101       36         1105816193
INV101       23         571175258
INV101       45         1121486358
INV101       17         612733718
INV101       40         1064976727
INV101       33         1183844491
INV101       3          21130809
INV101       14         1084968185
INV101       11         662670929
INV102       1014       103805595
INV102       34         1128073524
INV102       20         403806215
INV102       100        1183840214
INV102       70         225455574
INV102       42         1175039788
INV102       22         672550724
INV102       33         1114017454
INV102       27         741444754
INV102       20         1083179547
INV102       5          697761154
INV103       2061       424665927
INV103       9          1116821197
INV103       7          750167178
INV103       12         1121422029
INV103       40         1171870097
INV103       11         238542910
INV103       17         1161248546
INV103       2          191692686
INV103       19         1173452168
INV103       24         407364221
INV103       32         1139788145
INV104       1574       1167661346
INV104       5          317015352
INV104       40         1170289079
INV104       5          299724091
INV104       17         1161369887
INV104       5          495153017
INV104       6          1171254399
INV104       4          421752461
INV104       9          1160693900
INV104       6          643828914
INV104       13         1136352092
INV105       7          402809636
INV105       7          500547226
INV105       31         1165681365
INV105       24         545470219
INV105       57         1141878549
INV105       12         462839149
INV105       14         1101295629
INV105       6          557036769
INV105       12         1131940251
INV105       14         1169448537
INV105       37         1183354478
INV106       10436      1116731609
INV106       10         1182355777
INV106       5          1083758359
INV106       25         1168117365
INV106       10         181623502
INV106       47         1141906326
INV106       18         1147336069
INV106       2          162799272
INV106       51         1174106778
INV106       104        966217903
INV106       4          1071596713
INV107       251        1062752027
INV107       9          1107536877
INV107       5          517746926
INV107       23         885371414
INV107       4          1079695977
INV107       4          541647735
INV107       10         1104188691
INV107       25442      1137854245
INV107       47809      91383485
INV108       18         224818646
INV109       554        692519150
INV11        76         1113171912
INV110       62285      1082080139
INV111       58         1003563937
INV112       83         1168097044
INV113       69         1057913150
INV114       80         1184050445
INV115       77         1049714291
INV116       42         1154779406
INV117       67         1092815201
INV118       85         1182280362
INV119       38         1033117817
INV12        91         471131477
INV120       75         1168447512
INV121       66         1070706122
INV122       63         1156639442
INV123       39         1062673391
INV124       68         1171356706
INV125       24         559740797
INV126       785        1168458093
INV127       38         867568161
INV128       1919       1155913703
INV129       49794      902867470
INV13        46         1171530708
INV130       386266     249047695
INV131       363946     255814468
INV132       388713     316361870
INV133       398483     366419100
INV134       389738     423370768
INV135       5111       646124011
INV136       375072     804114761
INV137       134726     1035626041
INV138       2738       196899005
INV139       191524     1022067857
INV14        80         1150944302
INV140       20756      153351994
INV141       293970     959751037
INV142       92482      210061842
INV143       581300     685904658
INV144       51170      774722748
INV145       515288     826074612
INV146       36248      408630776
INV147       303451     944797132
INV148       175942     749886502
INV149       565831     756340788
INV15        3          198694494
INV150       157721     1044896654
INV151       71786      24058474
INV152       310460     153115693
INV153       216087     85640137
INV154       344964     222009909
INV155       18161      14795422
INV156       421377     401149956
INV157       27093      480314221
INV158       22         974588403
INV159       4          890328438
INV16        11         1112643067
INV160       6          1081490781
INV161       30         811260112
INV162       66         1177591105
INV163       848        1169005163
INV164       57         1127636884
INV165       7          619986524
INV166       907        1171565747
INV167       46         750275070
INV168       74         1181479878
INV169       51         636905406
INV17        3          372536295
INV170       43         1179274307
INV171       23         676016352
INV172       71         1180229579
INV173       41         655310157
INV174       49         1154534586
INV175       25         717723274
INV176       52         1181888300
INV177       15         748459715
INV178       39         922230747
INV179       3          790776823
INV18        15         1153719157
INV180       55         1171906377
INV181       37         646464974
INV182       43         1077704944
INV183       3          518178978
INV184       8          1160095586
INV185       12         240338361
INV186       87         1156736911
INV187       8          257485661
INV188       52         1169774643
INV189       11         221047174
INV19        3          301970333
INV190       46         1153427693
INV191       35         286756574
INV192       128        1172709580
INV193       23         388833300
INV194       354        1171116774
INV195       7          91837211
INV196       78         1180820375
INV197       50         1027942734
INV198       68         1180107650
INV199       16         971455017
INV2         47261      945904953
INV20        58         1137115496
INV200       17         1165496987
INV201       20         350566973
INV202       24         1164459467
INV203       22         376361857
INV204       45         1182545330
INV205       205        1178290897
INV206       1          24136152
INV207       44         1183135012
INV208       43         1175092098
INV209       20         1145496549
INV21        74         370878243
INV210       31         1131526231
INV211       3          207382734
INV212       31         1177639892
INV213       19         451973159
INV214       69         1173407387
INV215       111        1153874644
INV216       49         1176483557
INV217       50         889122035
INV218       20         1144896249
INV219       24         1041963359
INV22        67         1151272942
INV220       4          1063536830
INV221       36         1180705104
INV222       5          332665299
INV223       34         1160207731
INV224       14         877876842
INV225       23         1156975077
INV226       15         423920453
INV227       31         1093958113
INV228       9          519441565
INV229       7          1139607402
INV23        22         843961302
INV230       63         1109671322
INV231       1          24908900
INV232       72         1151148414
INV233       36         1083051682
INV234       1          56992732
INV235       91         1182900759
INV236       63         903773652
INV237       65         905149830
INV238       5          818528617
INV239       1          429819325
INV24        10         1140548361
INV240       40         1136402179
INV241       24         1116534048
INV242       1          170575982
INV243       9          1164226515
INV244       6          365455225
INV245       117        1090567798
INV246       17         429990184
INV247       46         1172555234
INV248       21         1143550249
INV249       1          80753270
INV25        16         1149011874
INV250       35         1175867064
INV251       26         404720046
INV252       45         1092334003
INV253       3          271412684
INV254       49         1145824106
INV255       20         289723219
INV256       58         1183115041
INV257       18         419967033
INV258       36         1147123421
INV259       8          226290514
INV26        9          105123921
INV260       16         991169918
INV261       4          406800201
INV262       48         1172507997
INV263       14         854745958
INV264       25         1137368323
INV265       29         897524208
INV266       54         1180751072
INV267       12         758994876
INV268       8          1175209336
INV269       34         332964705
INV27        84         1121876247
INV270       27         1119084587
INV271       8          496368814
INV272       16         1180264612
INV273       16         444300333
INV274       15         1056245864
INV275       1          249620899
INV276       55         1168335732
INV277       13         420235976
INV278       15         1113905915
INV279       1          283143227
INV28        2          147220534
INV280       39         1128793024
INV281       4          404991268
INV282       22         1175706978
INV283       29         264157869
INV284       43         1178393287
INV285       27         362849337
INV286       73         1175149957
INV287       18         260465922
INV288       45         1182897844
INV289       50         578151589
INV29        273        1150778041
INV290       58         1136451976
INV291       31         676305088
INV292       40         1179394077
INV293       27         588929304
INV294       18         1153312885
INV295       6          656072283
INV296       47         1116444780
INV297       6          586961391
INV298       56         1139073482
INV299       9          815123865
INV3         182        1100986300
INV30        21         329075431
INV300       34         1143915167
INV301       34         616015109
INV302       7          1087036404
INV303       2          274114667
INV304       45         1097657805
INV305       21         257681977
INV306       44         1157371711
INV307       11         223039194
INV308       37         1169310417
INV309       3          203917285
INV31        96         1147375643
INV310       50         1008179751
INV311       1          253604678
INV312       6          1093677472
INV313       75         1080810493
INV314       1          280788551
INV315       6          1053198803
INV316       27         1160643322
INV317       9          402123374
INV318       19         1171895459
INV319       41         1072590683
INV32        87         331766739
INV320       9          246954501
INV321       61         1122234529
INV322       19         1165153296
INV323       10         278909029
INV324       47         1171770266
INV325       195        1175346174
INV326       1          98076447
INV327       14         1067550412
INV328       3          344572339
INV329       40         1181305379
INV33        59         1173456559
INV330       20         563360984
INV331       7          1135518446
INV332       47         945010083
INV333       26         1180724142
INV334       1          156731404
INV335       10         1129383166
INV336       33         868693962
INV337       30         1178102174
INV338       11         463097241
INV339       58         1161408728
INV34        9          185353717
INV340       33         1128854507
INV341       7          273110839
INV342       13         1138496972
INV343       20         1142259793
INV344       7          326451249
INV345       25         1109360043
INV346       34         505527850
INV347       23         979005798
INV348       7          650668978
INV349       47         1182856260
INV35        53         1181383201
INV350       8          428612167
INV351       36         1177609778
INV352       353        327501291
INV353       91         1111219876
INV354       2          395222208
INV355       32         1139499635
INV356       14         531893343
INV357       22         1168290851
INV358       20         920703115
INV359       24         1005476694
INV36        8          161061672
INV360       24         1075280211
INV361       24         1073193819
INV362       19         887662773
INV363       1          277791574
INV364       10         1140178047
INV365       8          305088483
INV366       12         1117452242
INV367       5          475109860
INV368       15         1056280104
INV369       13         677526847
INV37        54         1166920299
INV370       60         1126302065
INV371       6          694475755
INV372       15         1149400217
INV373       75         1172827857
INV374       1          111445931
INV375       21         1162514942
INV376       100        1137918226
INV377       1          49454665
INV378       16         1023275082
INV379       9          1058545407
INV38        10         218960568
INV380       2          199741241
INV381       48         1162240956
INV382       36         917259041
INV383       44         1181158046
INV384       61         897316651
INV385       52         1066888213
INV386       10         957238398
INV387       19         1167563966
INV388       31         1015110779
INV389       14         1103227811
INV39        54         1165175634
INV390       14         775609698
INV391       23         1161823502
INV392       28         1160290406
INV393       47         1176465275
INV394       50         899789306
INV395       44         1152337180
INV396       44         1110359249
INV397       3          236174852
INV398       19         1136968481
INV399       5          501056419
INV4         4          353796308
INV40        9          190916564
INV400       29         1165109564
INV401       20         460840775
INV402       57         1136284839
INV403       6          466441095
INV404       14         686304428
INV405       1          2140038457
INV406       1          1533311695
INV407       1          991394496
INV408       1          709211797
INV409       1          559013835
INV41        53         1176815245
INV410       2          1015231349
INV411       2          680734533
INV412       5          1139385694
INV413       9          387512797
INV414       38         1149151781
INV415       7          228551836
INV416       88         1181686129
INV417       27         316005074
INV418       42         1171516152
INV419       10         185290783
INV42        9          195418297
INV420       290        1181201554
INV421       10         173472662
INV422       42         1162946064
INV423       7          197461381
INV424       68         1176382137
INV425       7          193747225
INV426       8          1122120635
INV427       6          307813224
INV428       79         1149752287
INV429       5          262281928
INV43        57         1170845875
INV430       26         1180308804
INV431       12         255298002
INV432       75         1176675281
INV433       14         248327593
INV434       53         1172445280
INV435       22         384497843
INV436       8          1166380755
INV437       29         486152035
INV438       40         1178655921
INV439       17         418976310
INV44        10         195634974
INV440       70         1182031322
INV441       18         392152070
INV442       39         1095903520
INV443       4          302073392
INV444       8          1087090309
INV445       3          367875611
INV446       41         1173135983
INV447       17         272434458
INV448       66         1172783125
INV449       10         293162809
INV45        55         1147619569
INV450       66         1176229568
INV451       1          228165927
INV452       37         1127666342
INV453       11         364644469
INV454       19         1149393244
INV455       4          99463677
INV456       11         1168395548
INV457       17         520438381
INV458       45         1171051397
INV459       29         462890848
INV46        5          243308800
INV460       26         1132569772
INV461       18         520942289
INV462       92         1172843032
INV463       15         476627646
INV464       42         1168099605
INV465       26         446630606
INV466       67         1179117010
INV467       23         469119615
INV468       83         1154955445
INV469       30         758714569
INV47        70         1009927878
INV470       39         1159304171
INV471       10         241001718
INV472       51         1176823337
INV473       34         691532969
INV474       61         1172625068
INV475       30         682406867
INV476       61         1177272705
INV477       13         684254481
INV478       10         1058561635
INV479       26         1182289903
INV48        3          813113944
INV480       11         204132428
INV481       55         1177502155
INV482       18         333480790
INV483       16         1160054366
INV484       21         460474657
INV485       48         1163269519
INV486       20         404668265
INV487       61         1172247240
INV488       28         374991644
INV489       27         1152466269
INV49        4          1008855096
INV490       4          379512269
INV491       90         1119944238
INV492       2          445736338
INV493       52         1161767093
INV494       15         431557338
INV495       32         1155774498
INV496       210        1174645524
INV497       2          26385650
INV498       88         1170537753
INV499       67         1176827893
INV5         34         1183526385
INV50        4          513393835
INV500       6          71363600
INV501       54         1165537031
INV502       19         379601315
INV503       44         1155919506
INV504       237        1056358889
INV505       2          378921420
INV506       32         1181647471
INV507       7          270001607
INV508       21         1171629453
INV509       14         461010674
INV51        38         1167088645
INV510       39         1171071737
INV511       14         342166681
INV512       55         1182543996
INV513       19         687804564
INV514       46         1163466471
INV515       44         726113674
INV516       68         1172006473
INV517       25         660741114
INV518       37         1164238669
INV519       37         767043879
INV52        144        307543456
INV520       69         1174894340
INV521       23         780407278
INV522       56         1179305319
INV523       39         1056010852
INV524       39         1170436008
INV525       349        1099604861
INV526       27         1170787413
INV527       51         1063483092
INV528       17         1097419755
INV529       5          589296853
INV53        21         1182740529
INV530       8          1109183115
INV531       2          387387157
INV532       292        1180288671
INV533       29         491164617
INV534       50         1166566430
INV535       14         349281667
INV536       18         1180940926
INV537       15         543636569
INV538       86         1160906063
INV539       22         580569362
INV54        12         635433843
INV540       54         1165239523
INV541       17         532351739
INV542       53         1162873867
INV543       28         547508741
INV544       59         1174117998
INV545       12         275890767
INV546       56         1176591424
INV547       11         282091255
INV548       37         1176450817
INV549       3          300075750
INV55        69         1175995880
INV550       17         1170398473
INV551       10         366145546
INV552       15         1183808923
INV553       29         692214430
INV554       68         1176081176
INV555       35         694701543
INV556       15         1170602412
INV557       68         1140944349
INV558       11         318389619
INV559       16         1125800549
INV56        153048     323208290
INV560       57         1181357371
INV561       11         176643969
INV562       284        1170549510
INV563       59         1163463453
INV564       49         1161552391
INV565       8          219178196
INV566       39         1176853398
INV567       5          184919638
INV568       16         1103067893
INV569       2          202273058
INV57        293975     246630288
INV570       7          1157443359
INV571       21         1168831763
INV572       1          281865375
INV573       37         1107189921
INV574       3          329372380
INV575       18         1166415167
INV576       10         401689523
INV577       55         1170958356
INV578       11         242378568
INV579       98         1169276834
INV58        39960      1040714467
INV580       13         234291481
INV581       23         1173442542
INV582       8          235471396
INV583       38         1059108018
INV584       6          313828708
INV585       64         1115037913
INV586       7          266485410
INV587       37         1173211015
INV588       14         224821814
INV589       46         1163337646
INV59        28         430019538
INV590       8          239800496
INV591       28         1169424257
INV592       56         1178676774
INV593       6          147326465
INV594       54         1163647121
INV595       28         1149969800
INV596       10         1017199002
INV597       1          210654766
INV598       7          1148462765
INV599       2          472390081
INV6         19         297443214
INV60        78         1183112976
INV600       46         1157706722
INV601       13         349630037
INV602       54         1149819012
INV603       10         355608178
INV604       58         1091215982
INV605       11         1035200436
INV606       268        1159772212
INV607       38         1113515607
INV608       1          136390895
INV609       46         1164437507
INV61        21         476524808
INV610       40         826957687
INV611       58         1179315760
INV612       6          1042444597
INV613       7          1073935065
INV614       3          433618882
INV615       40         1131808525
INV616       5          602836935
INV617       33         1172252413
INV618       11         302594749
INV619       35         1181281402
INV62        51         1168013818
INV620       73         1109484795
INV621       3          222808546
INV622       46         1175005023
INV623       13         110326208
INV624       45         1173155884
INV625       90         1180518783
INV626       2          158346272
INV627       50         1076844844
INV628       7          1132104668
INV629       2          359154098
INV63        27         491070241
INV630       10         1126653575
INV631       49         1155057985
INV632       16         1148926863
INV633       12         479432118
INV634       46         1150819712
INV635       11         309050588
INV636       66         1178761552
INV637       18         320380910
INV638       64         1179620404
INV639       25         708995082
INV64        102        1179177240
INV640       52         1182802979
INV641       20         331581745
INV642       57         1174098934
INV643       62         1073493620
INV644       40         1141758017
INV645       5          328685949
INV646       33         1174621744
INV647       30         491303488
INV648       35         1050226528
INV649       11         616512980
INV65        56         1117926882
INV650       19         1179887530
INV651       7          283887005
INV652       26         1180576662
INV653       5          576348716
INV654       11         696616259
INV655       4          1098480882
INV656       4          247410792
INV657       23         1164742126
INV658       33         804514616
INV659       30         1161344665
INV66        1          94407144
INV660       13         782319430
INV661       35         1181577893
INV662       46         723533343
INV663       22         1048373506
INV664       12         1020694987
INV665       53         1174510426
INV666       36         835900437
INV667       8          1038095140
INV668       13         1180329439
INV669       16         457486952
INV67        70         1177732067
INV670       9          1057568269
INV671       14         816084135
INV672       15         1140373678
INV673       3          399837115
INV674       24         1129639943
INV675       36         1174157392
INV676       12         148689426
INV677       20         1172698862
INV678       75         1176515731
INV679       10         113467994
INV68        221447     689503442
INV680       77         1168430039
INV681       87         1149071185
INV682       18         1128928755
INV683       22         1177260315
INV684       14         443398168
INV685       23         1115796990
INV686       13         1159346242
INV687       43         1181378857
INV688       26         707439366
INV689       30         1148523519
INV69        57903      1055436434
INV690       13         346240109
INV691       21         1105128801
INV692       12         524632913
INV693       50         1168023395
INV694       34         457025247
INV695       79         1143758856
INV696       10         506376177
INV697       55         1166742844
INV698       27         494226509
INV699       65         1165986797
INV7         74         1181961575
INV70        31         641837690
INV700       20         545455033
INV701       42         1180405673
INV702       18         421482089
INV703       29         1076309014
INV704       2          526950202
INV705       7          1014602742
INV706       3          348958771
INV707       10         1136361044
INV708       71         975019307
INV709       38         1149622989
INV71        129        1172100674
INV710       6          941961830
INV711       23         1036981527
INV712       1          195322241
INV713       46         1183891356
INV714       115        318736649
INV715       22         1176694479
INV716       4          197954523
INV717       55         1166415842
INV718       25         431770977
INV719       15         1153744291
INV72        41         759510965
INV720       18         599941963
INV721       58         1133439408
INV722       25         1172100353
INV723       4          287023245
INV724       20         1177928500
INV725       6          289987563
INV726       63         1183668969
INV727       22         871804317
INV728       10         1178565949
INV729       83         959294373
INV73        80         1177018882
INV730       84         1173318646
INV731       32         983614572
INV732       17         984681430
INV733       5          1160167511
INV734       4          968383396
INV735       5          1031138611
INV736       1          173785391
INV737       9          1175857115
INV738       12         1071919900
INV739       57         1112765851
INV74        160        732432812
INV740       3          285907573
INV741       33         1172526206
INV742       20         387866850
INV743       209        1157696720
INV744       55         951167692
INV745       51         1183206605
INV746       33         287912197
INV747       81         1166057898
INV748       5          333567415
INV749       7          1157771555
INV75        64         1183132455
INV750       2          282252146
INV751       22         1159672490
INV752       78         1146550131
INV753       34         1171027121
INV754       24         1078182774
INV755       1          141120907
INV756       31         1175918517
INV757       60         1173881038
INV758       1          38566108
INV759       32         1144571011
INV76        29         649840505
INV760       40         1101227863
INV761       2          200113839
INV762       15         1173091833
INV763       3          549536089
INV764       11         1151234513
INV765       20         643334565
INV766       66         1167559863
INV767       30         582603137
INV768       56         961445692
INV769       4          826129831
INV77        80         1180694422
INV770       7          1122891217
INV771       6          773654805
INV772       47         1167507163
INV773       37         803146093
INV774       26         1175621680
INV775       29         773698835
INV776       12         1170789341
INV777       24         399325876
INV778       21         1055389927
INV779       4          529490845
INV78        48         674849506
INV780       10         1145847553
INV781       4          385903968
INV782       14         1152569863
INV783       13         523646868
INV784       52         1140818398
INV785       8          552177835
INV786       38         1167924385
INV787       13         535556260
INV788       58         1166124907
INV789       32         610996274
INV79        70         1175199456
INV790       35         1182656851
INV791       30         815614629
INV792       1          540902015
INV793       5          1135738023
INV794       46         1175547441
INV795       9          355981500
INV796       26         1175124510
INV797       4          562554156
INV798       201        1166190476
INV799       16         620203581
INV8         37339      619526371
INV80        50         646679960
INV800       34         1125184633
INV801       9          621148114
INV802       26         1163552733
INV803       20         1135116210
INV804       5          202644379
INV805       29         1171916326
INV806       19         493858152
INV807       22         1179258290
INV808       14         680932278
INV809       9          1159699274
INV81        66         1178213441
INV810       12         964112763
INV811       40         1142294771
INV812       7          1000175726
INV813       2          506163426
INV814       37         1135047917
INV815       41         696194464
INV816       45         907408615
INV817       25         957087174
INV818       13         837980818
INV819       16         1009224553
INV82        17         214525417
INV820       53         1174974874
INV821       45         747358929
INV822       44         1159975558
INV823       11         322493981
INV824       48         1174245902
INV825       26         847474578
INV826       57         1161546715
INV827       28         859874329
INV828       56         1181449801
INV829       18         286553490
INV83        193867     816205312
INV830       29         1173501732
INV831       5          325923863
INV832       58         1179409688
INV833       27         330554813
INV834       49         1164814455
INV835       17         268867432
INV836       54         1172339728
INV837       15         828226304
INV838       22         924352601
INV839       1          268156038
INV84        29120      21131779
INV840       43         1139934415
INV841       16         466545463
INV842       24         1180888142
INV843       5          98179301
INV844       8          1166224888
INV845       29         1171022807
INV846       3          71931701
INV847       8          1056477253
INV848       2          579379686
INV849       21         1161892934
INV85        423441     304020150
INV850       50         831753780
INV851       1          530134936
INV852       7          1095668864
INV853       2          233312597
INV854       11         1131682103
INV855       36         376356686
INV856       41         1131505858
INV857       3          345957582
INV858       8          987372027
INV859       2          482999942
INV86        363150     270592454
INV860       11         1179162941
INV861       20         414948321
INV862       40         1173054389
INV863       12         254279101
INV864       30         1107116022
INV865       4          333912884
INV866       38         1164789604
INV867       49         1183261514
INV868       71         1102398920
INV869       18         1100700778
INV87        345692     259117628
INV870       1          416981589
INV871       3          1157463834
INV872       3          1060904444
INV873       2          611623168
INV874       4          1106412385
INV875       39         912374424
INV876       2          661038697
INV877       5          1137688336
INV878       16         1154482827
INV879       31         451974996
INV88        334242     216414498
INV880       21         1090976566
INV881       6          479966501
INV882       50         1089322010
INV883       4          346159624
INV884       8          1160538827
INV885       9          618678086
INV886       10         928627153
INV887       1          480241822
INV888       2          951616379
INV889       2          871667885
INV89        330476     204444184
INV890       2          818376178
INV891       2          729282197
INV892       3          961516656
INV893       18         854853893
INV894       16         890707862
INV895       2          577657875
INV896       34         1139635994
INV897       5          727905464
INV898       8          1063877851
INV899       5          590149535
INV9         129381     906404418
INV90        330020     200921246
INV900       11         1152684900
INV901       8          710744595
INV902       36         1166405653
INV903       10         625620248
INV904       19         1112325788
INV905       25         707449545
INV906       37         1002045037
INV907       8          1027154230
INV908       9          744708688
INV909       1          693712867
INV91        349261     240950261
INV910       1          690419613
INV911       1          688810701
INV912       1          639929110
INV913       1          625027500
INV914       1          623195831
INV915       1          617718696
INV916       2          1167479169
INV917       2          1124973432
INV918       2          972905134
INV919       3          915669535
INV92        446484     346833661
INV920       33         1175819391
INV921       17         337246022
INV922       35         1182263806
INV923       9          433016709
INV924       10         1134155138
INV925       17         736154490
INV926       40         1177080951
INV927       30         686206625
INV928       38         1144573634
INV929       24         1059642536
INV93        164559     278013557
INV930       12         1146055021
INV931       16         426715246
INV932       63         1164968250
INV933       19         776727519
INV934       3          1143035150
INV935       42         1134241877
INV936       13         1168959675
INV937       2          442951563
INV938       6          1166259661
INV939       4          643924932
INV94        399263     402818845
INV940       35         1175805876
INV941       9          512843503
INV942       16         1173233554
INV943       48         1172588912
INV944       7          236034213
INV945       62         1142249551
INV946       14         1124386096
INV947       15         438382888
INV948       40         1176398187
INV949       42         1147439138
INV95        38629      187147326
INV950       5          186802489
INV951       28         1113540571
INV952       25         1183920083
INV953       7          278388585
INV954       30         1179924498
INV955       6          543566409
INV956       25         1183567352
INV957       27         636126639
INV958       17         1147278217
INV959       196        610552163
INV96        800        42674647
INV960       26         1054305302
INV961       2          416648436
INV962       44         1165602779
INV963       23         537428299
INV964       31         1155380117
INV965       4          443902968
INV966       17         1181298860
INV967       15         441864740
INV968       34         1168049254
INV969       10         282815994
INV97        566        40635863
INV970       28         1140507194
INV971       17         466627605
INV972       30         1112641054
INV973       2          445716186
INV974       9          1085975686
INV975       25         642693539
INV976       30         1156609619
INV977       29         560632156
INV978       33         1051507514
INV979       2          795197424
INV98        8037       115580217
INV980       11         1170879383
INV981       41         961367314
INV982       21         1142240940
INV983       9          874060652
INV984       12         1174977387
INV985       18         860732275
INV986       19         1163517885
INV987       15         822446859
INV988       12         1137593010
INV989       15         1094577995
INV99        46584      504877383
INV990       3          480601000
INV991       51         1183760112
INV992       2          235147018
INV993       22         1165027366
INV994       26         452267105
INV995       2          940631047
INV996       2          928744483
INV997       2          883129211
INV998       3          1143834446
INV999       1          295284678
MAM1         54649      917178765
MAM10        3          308153814
MAM100       7          1147702881
MAM101       27         953979977
MAM102       5          1086466071
MAM103       12         1073178649
MAM104       1          188105751
MAM105       8          1101390325
MAM106       15         1074262986
MAM107       6          1125669670
MAM108       6          774631741
MAM109       12         1132049837
MAM11        15         1037946112
MAM110       18         1085536552
MAM111       3          320447314
MAM112       12         1178815323
MAM113       5          242278661
MAM114       47         1064535464
MAM115       3          418271949
MAM116       12         1168086867
MAM117       6          791898128
MAM118       12         1138729465
MAM119       11         658641730
MAM12        12         1137706418
MAM120       7          1170582831
MAM121       16         875048119
MAM122       7          1070781583
MAM123       12         1145013723
MAM124       4          156566841
MAM125       5          1162556979
MAM126       14         1169511893
MAM127       2          112310364
MAM128       12         1109808165
MAM129       19         1171295571
MAM13        1          103782134
MAM130       4          219237353
MAM131       8          1131294285
MAM132       8          726228234
MAM133       24         1070356570
MAM134       8          799447878
MAM135       19         1177960816
MAM136       7          731882456
MAM137       14         1164148358
MAM138       6          349193395
MAM139       12         1179433182
MAM14        19         1127022250
MAM140       4          397773065
MAM141       14         1041093991
MAM142       2          481778387
MAM143       5          1056405742
MAM144       4          577359420
MAM145       9          1094931139
MAM146       3          431583879
MAM147       9          1044771416
MAM148       3          562951973
MAM149       8          1139744895
MAM15        6          417335826
MAM150       4          450697867
MAM151       6          999063376
MAM152       3          667074377
MAM153       9          1168010004
MAM154       4          606841363
MAM155       19         1183539355
MAM156       6          784240423
MAM157       11         1178122221
MAM158       9          737268083
MAM159       8          1101462276
MAM16        20         1114156407
MAM160       10516      1093379399
MAM17        8          440415269
MAM18        18         1173305826
MAM19        5          246617504
MAM2         2          376685399
MAM20        16         1178104214
MAM21        10         836799539
MAM22        10         1171820346
MAM23        12         1029020087
MAM24        9          26809642
MAM25        54         7614329
MAM26        215        34073042
MAM27        431        71272130
MAM28        861        68509101
MAM29        1706       2411269
MAM3         9          1159833615
MAM30        6879       6176592
MAM31        110526     193403794
MAM32        33201      1099561407
MAM33        16         932399762
MAM34        253373     712937465
MAM35        6052       721714412
MAM36        1          662751787
MAM37        1          611347268
MAM38        5          1091124403
MAM39        4          833121924
MAM4         936        397469053
MAM40        9          1173688690
MAM41        370        631762200
MAM42        11         1148682982
MAM43        265        655228071
MAM44        14         1129485591
MAM45        10         780461055
MAM46        12         1154949216
MAM47        11         821210834
MAM48        3346       1174847022
MAM49        207460     650756767
MAM5         26814      24994146
MAM50        14         1092077466
MAM51        14         1163101092
MAM52        279        336844158
MAM53        6          1088563449
MAM54        11         1170209443
MAM55        4          257416099
MAM56        396        1126820426
MAM57        11         1123823459
MAM58        28         322280472
MAM59        9          1118303675
MAM6         13731      20581276
MAM60        15         1166025468
MAM61        6          401152657
MAM62        8          1076435216
MAM63        2          226942227
MAM64        14         1132032412
MAM65        271        307742124
MAM66        6          1084909688
MAM67        5          579063099
MAM68        13         1159289868
MAM69        2          319966445
MAM7         3445       7368868
MAM70        10         1125919330
MAM71        9          578892446
MAM72        11         1080315572
MAM73        11         752575683
MAM74        17         1117115584
MAM75        5          616253053
MAM76        10         1124329418
MAM77        2          272528628
MAM78        8          1171546937
MAM79        3          311079698
MAM8         107        699953
MAM80        19         1111022050
MAM81        1          178365832
MAM82        9          1137930415
MAM83        4          370992980
MAM84        12         1061089740
MAM85        2          296330659
MAM86        10         1109747736
MAM87        3          260392119
MAM88        10         1145323782
MAM89        2          211903297
MAM9         24         978923755
MAM90        10         1116587684
MAM91        8          367669076
MAM92        12         1121894092
MAM93        6          418702010
MAM94        16         1015883955
MAM95        4          651631450
MAM96        11         1156896317
MAM97        10         658511106
MAM98        11         1138344427
MAM99        165        648612555
PAT1         799937     380650087
PAT10        271895     194870018
PAT100       855295     50272813
PAT101       96566      20012584
PAT102       893771     125915996
PAT103       790992     623139960
PAT104       565823     806468807
PAT105       779693     427337725
PAT106       815031     321652669
PAT107       713904     246145656
PAT108       728138     463603491
PAT109       81360      153141874
PAT11        695316     537302870
PAT12        616745     312423158
PAT13        550435     336234424
PAT14        558843     479644330
PAT15        97886      9820533
PAT16        618968     522600188
PAT17        98835      382939732
PAT18        797353     222348363
PAT19        31169      33403273
PAT2         809085     544871876
PAT20        804549     303117744
PAT21        92452      1756588
PAT22        846018     25272339
PAT23        846018     16403244
PAT24        936830     589670636
PAT25        707138     139681125
PAT26        754654     539398031
PAT27        1095352    307304135
PAT28        610387     236245640
PAT29        520675     733807170
PAT3         625018     303686612
PAT30        630876     626582223
PAT31        725834     389970554
PAT32        725834     350765074
PAT33        808618     106711475
PAT34        614454     198519627
PAT35        706860     516370760
PAT36        161612     40887238
PAT37        1047866    19909454
PAT38        720643     78270616
PAT39        685448     388769770
PAT4         623619     423631098
PAT40        776835     341284579
PAT41        925604     622455932
PAT42        130468     96635421
PAT43        836770     697037292
PAT44        219302     91982645
PAT45        478398     369730555
PAT46        465573     363885306
PAT47        538688     501452614
PAT48        1460       4603802
PAT49        478541     109414935
PAT5         635000     361815202
PAT50        275396     358965751
PAT51        229252     116776485
PAT52        504649     200780045
PAT53        688229     330989793
PAT54        517739     781723621
PAT55        696501     289726628
PAT56        696501     196685805
PAT57        1175480    45090107
PAT58        623122     230103271
PAT59        455428     838741066
PAT6         633134     411695605
PAT60        455428     365884940
PAT61        325231     482206711
PAT62        121982     154449698
PAT63        447213     131724501
PAT64        1032880    196383084
PAT65        227776     118142255
PAT66        802491     187547556
PAT67        737903     168772635
PAT68        65066      7149938
PAT69        300935     428633458
PAT7         751933     290751828
PAT70        312425     86908455
PAT71        661716     354757423
PAT72        105682     68107937
PAT73        635968     172920997
PAT74        7666       114990
PAT75        600007     253224862
PAT76        22948      34610499
PAT77        387425     636579263
PAT78        6530       8858406
PAT79        482747     437258120
PAT8         146945     94866926
PAT80        309974     73656116
PAT81        671488     154795553
PAT82        246651     90238277
PAT83        234680     377596743
PAT84        208570     85618763
PAT85        1025193    21516964
PAT86        331154     110021550
PAT87        743946     592297584
PAT88        601967     722579971
PAT89        572273     786734443
PAT9         704058     375636088
PAT90        620176     688425199
PAT91        790293     652398383
PAT92        304116     76037464
PAT93        512789     752893376
PAT94        826524     599374610
PAT95        643350     725078440
PAT96        629482     818364735
PAT97        381127     520363322
PAT98        701251     321706921
PAT99        558444     41542612
PHG1         18937      659338801
PHG2         16336      686754141
PHG3         10594      182275861
PLN1         182369     828375546
PLN10        158        829520559
PLN100       35         1162360688
PLN100       1          608830648
PLN100       2          1146797356
PLN100       2          1146984767
PLN100       1          526310788
PLN100       1          664689228
PLN100       1          632403820
PLN100       1          613638454
PLN100       2          1172960765
PLN100       2          1147017396
PLN100       1          660476038
PLN101       73         724972614
PLN101       1          624334204
PLN101       1          613769411
PLN101       1          589927450
PLN101       1          557572468
PLN101       2          1148490360
PLN101       1          663019822
PLN101       1          626669531
PLN101       1          612901747
PLN101       2          1150057662
PLN101       2          1157797487
PLN102       45         1142219311
PLN102       1          667210568
PLN102       1          635382001
PLN102       1          614569426
PLN102       2          1169192410
PLN102       2          1163716432
PLN102       1          626973123
PLN102       1          611284754
PLN102       2          1150481064
PLN102       1          659290088
PLN102       2          1150737255
PLN103       10         661759416
PLN103       1          660553991
PLN103       1          632999331
PLN103       1          616334843
PLN103       1          595538521
PLN103       1          579057524
PLN103       2          1159220941
PLN103       1          659217363
PLN103       1          627225202
PLN103       1          611858135
PLN103       2          1164391514
PLN104       72         1160482328
PLN104       2          1152376894
PLN104       1          660591081
PLN104       1          627080904
PLN104       1          609113147
PLN104       2          1138662036
PLN104       1          628475395
PLN104       1          525655293
PLN104       1          659787933
PLN104       1          626680366
PLN104       1          612118009
PLN105       8          360700132
PLN105       1          587712295
PLN105       1          559096804
PLN105       2          1153763781
PLN105       1          662624081
PLN105       1          626502968
PLN105       1          614857888
PLN105       2          1161694293
PLN105       2          1153142705
PLN105       1          669220190
PLN105       1          629226312
PLN106       43         1155810616
PLN106       1          613110551
PLN106       2          1144904879
PLN106       2          1160236768
PLN106       1          658438119
PLN106       1          628047470
PLN106       1          612916554
PLN106       2          1143852611
PLN106       2          1150763450
PLN106       1          657631428
PLN106       1          629616096
PLN107       53         752164064
PLN107       1          610488678
PLN107       2          1145704528
PLN107       2          1148031132
PLN107       1          655385637
PLN107       1          626286153
PLN107       1          610690180
PLN107       2          1141737084
PLN107       2          1145450335
PLN107       1          659936173
PLN107       1          627661034
PLN108       158        1145539918
PLN108       1          608478632
PLN108       2          1164887918
PLN108       2          1157801119
PLN108       1          654540277
PLN108       1          624453744
PLN108       1          610565479
PLN108       2          1154225896
PLN108       2          1144646810
PLN108       1          661109612
PLN108       1          624188817
PLN109       1          494422770
PLN109       1          609603980
PLN109       2          1153106963
PLN109       2          1149274143
PLN109       1          657668641
PLN109       1          627263816
PLN109       1          611107145
PLN109       2          1143888586
PLN109       2          1151475536
PLN109       1          659552134
PLN109       1          627284235
PLN11        4          1049626460
PLN110       1          646201372
PLN110       1          612025601
PLN110       2          1148289352
PLN110       2          1155467049
PLN110       1          660627594
PLN110       1          636764043
PLN110       1          612684114
PLN110       2          1172404752
PLN110       2          1143811555
PLN110       1          660087335
PLN110       1          626870575
PLN111       1          587623253
PLN111       1          607666773
PLN111       1          586243134
PLN111       1          573947504
PLN111       2          1151319163
PLN111       1          663157241
PLN111       1          626857742
PLN111       1          607587567
PLN111       2          1166417974
PLN111       2          1149892400
PLN111       1          660726353
PLN112       1          663525381
PLN112       1          625613366
PLN112       1          606853752
PLN112       1          591973374
PLN112       2          1181333537
PLN112       1          520737098
PLN112       1          659649991
PLN112       1          630477981
PLN112       1          612914000
PLN112       1          592900278
PLN112       1          566194267
PLN113       2          1170194602
PLN113       1          634521465
PLN113       2          1178059891
PLN113       1          626766831
PLN113       1          610506001
PLN113       2          1139699259
PLN113       1          626388232
PLN113       1          525410090
PLN113       1          659109138
PLN113       1          625619081
PLN113       1          605020174
PLN114       52         1140868282
PLN114       2          1144201423
PLN114       2          1150772597
PLN114       1          660123737
PLN114       1          626033862
PLN114       1          611584699
PLN114       2          1146634294
PLN114       1          629468067
PLN114       2          1181536715
PLN114       1          634780758
PLN114       1          613857241
PLN115       3          282488941
PLN115       2          1153523653
PLN115       2          1157943603
PLN115       1          655608708
PLN115       1          630476109
PLN115       1          611734907
PLN115       2          1148834704
PLN115       2          1153026048
PLN115       1          660958633
PLN115       1          628850999
PLN115       1          613418293
PLN116       61         1124765676
PLN116       1          593424848
PLN116       1          555705214
PLN116       2          1149230152
PLN116       1          662192201
PLN116       1          624651312
PLN116       1          607896916
PLN116       2          1144733231
PLN116       1          627906795
PLN116       2          1180743776
PLN116       1          626336238
PLN117       4          316808231
PLN117       1          607408596
PLN117       2          1149881386
PLN117       2          1156807113
PLN117       1          662539114
PLN117       1          634696490
PLN117       1          614659814
PLN117       2          1155079160
PLN117       2          1150818685
PLN117       1          657222892
PLN117       1          629605540
PLN118       35         1154801519
PLN118       1          613053250
PLN118       2          1144594366
PLN118       2          1153001227
PLN118       1          663034619
PLN118       1          623546353
PLN118       1          613383894
PLN118       2          1145099380
PLN118       7          800846786
PLN118       43         1165400665
PLN118       27         869035869
PLN119       33         903586639
PLN119       5          1034335425
PLN119       5          973412539
PLN119       1          454733196
PLN119       2          877648901
PLN119       1          379526086
PLN119       11         1184012898
PLN119       9          226764577
PLN119       27         712893091
PLN119       1          520479541
PLN119       1          655484837
PLN12        1          267785325
PLN120       42         1153994395
PLN120       1          626855960
PLN120       1          604911185
PLN120       1          592828626
PLN120       1          553427711
PLN120       2          1152814527
PLN120       1          631897805
PLN120       1          637173558
PLN120       1          641960388
PLN120       2          1176182574
PLN120       2          1155488842
PLN121       37         1012187192
PLN121       1          660305412
PLN121       1          629753639
PLN121       1          609200707
PLN121       2          1175561398
PLN121       1          633965700
PLN121       2          1180215838
PLN121       1          627226266
PLN121       1          603942392
PLN121       2          1145038912
PLN121       2          1141862336
PLN122       43         1174230866
PLN122       1          661554418
PLN122       1          627699516
PLN122       1          609498991
PLN122       1          588006371
PLN122       1          560132838
PLN122       51         1161837995
PLN122       8          126267343
PLN122       32         1131142309
PLN122       1          369077699
PLN122       1          639092456
PLN123       35         977765170
PLN123       1          650132723
PLN123       2          1119308834
PLN123       1          734473537
PLN123       2          1100022842
PLN123       2          990953513
PLN123       2          1156725275
PLN123       2          921884013
PLN123       1          588888971
PLN123       2          968927852
PLN123       2          1122645515
PLN124       44         1183169112
PLN124       14         393517910
PLN124       35         1168755904
PLN124       3          198866682
PLN124       65         1175961107
PLN124       43         528340211
PLN124       42         792175415
PLN124       1          646201372
PLN124       1          587623253
PLN124       1          663525381
PLN124       2          1170194602
PLN125       61         342767452
PLN125       2          684606446
PLN125       1          525133463
PLN125       1          663523538
PLN125       1          635405230
PLN125       1          611936476
PLN125       2          1150154113
PLN125       2          1161072711
PLN125       1          660736956
PLN125       1          627598042
PLN125       1          612187513
PLN126       12         1080932099
PLN126       2          1155070448
PLN126       1          627617921
PLN126       1          518127376
PLN126       1          673406957
PLN126       1          630137118
PLN126       1          612939186
PLN126       2          1151335502
PLN126       2          1155631783
PLN126       1          657661460
PLN126       1          626889213
PLN127       1          385644068
PLN127       1          610003100
PLN127       2          1148528258
PLN127       1          626222545
PLN127       2          1182281996
PLN127       1          630354994
PLN127       1          612387238
PLN127       1          588087319
PLN127       1          567667584
PLN127       2          1149070389
PLN127       1          653250953
PLN128       2          884812093
PLN128       1          631324550
PLN128       1          609093722
PLN128       2          1149523883
PLN128       2          1145083390
PLN128       1          655260812
PLN128       1          634191159
PLN128       1          614681618
PLN128       1          597998838
PLN128       1          574769137
PLN128       2          1152836532
PLN129       1          446362846
PLN129       1          658721539
PLN129       1          626163282
PLN129       1          609194012
PLN129       2          1153379980
PLN129       2          1162676726
PLN129       1          656359106
PLN129       1          622273932
PLN129       1          610730036
PLN129       1          596985997
PLN129       1          555033258
PLN13        4          963836134
PLN130       2          986227910
PLN130       2          1150333174
PLN130       1          657708949
PLN130       1          625240013
PLN130       1          610861510
PLN130       2          1136292166
PLN130       1          630182139
PLN130       2          1179461484
PLN130       1          624169276
PLN130       1          611474174
PLN130       2          1152158626
PLN131       8          726884344
PLN131       2          1154678582
PLN131       1          664634244
PLN131       1          643202471
PLN131       1          617103718
PLN131       2          1161114768
PLN131       1          645264326
PLN131       2          1178750198
PLN131       1          634680428
PLN131       1          612896067
PLN131       2          1153985512
PLN132       26         967428969
PLN132       2          1159127655
PLN132       1          658111403
PLN132       1          631828453
PLN132       1          612358733
PLN132       2          1172628206
PLN132       2          1161043722
PLN132       1          661402595
PLN132       1          635870417
PLN132       1          617906818
PLN132       2          1154505804
PLN133       2          746994619
PLN133       1          639539621
PLN133       1          522184041
PLN133       1          666500271
PLN133       1          632086707
PLN133       1          607961820
PLN133       2          1173780312
PLN133       21         1134943785
PLN133       25         978183503
PLN133       31         1162575117
PLN133       11         428279349
PLN134       2          884447165
PLN134       10         1182440093
PLN134       88         789475101
PLN134       30         1163880160
PLN134       20         695066696
PLN134       31         1168031906
PLN134       9          308050326
PLN134       25         1164903412
PLN134       4          305227123
PLN134       18         1179459082
PLN134       7          726563806
PLN135       2          918277773
PLN135       13         1145638388
PLN135       21         341478864
PLN135       37         1181166246
PLN135       11         1086198137
PLN135       4          988846570
PLN135       8          855519588
PLN135       17         1122475859
PLN135       28         577307151
PLN135       1          2143528264
PLN135       1          2138631366
PLN136       1          513745672
PLN136       1          2132989935
PLN136       1          2142145023
PLN136       1          2142779784
PLN136       1          124381055
PLN136       1          2112395848
PLN136       1          2144481838
PLN136       1          2133121580
PLN136       1          2141806609
PLN136       1          1870266305
PLN136       1          2134931027
PLN137       44         1177676547
PLN137       1          2108664250
PLN137       1          2146278775
PLN137       1          2117022170
PLN137       1          1576301307
PLN137       1          2067099338
PLN137       1          2134690998
PLN137       1          2136662657
PLN137       1          2140543523
PLN137       1          1531582847
PLN137       1          2146571508
PLN138       26         1140975239
PLN138       1          2138192289
PLN138       1          2101175359
PLN138       1          2146227213
PLN138       1          621086779
PLN138       1          2138605540
PLN138       1          2083688238
PLN138       1          2144314009
PLN138       1          2139184679
PLN138       1          172723629
PLN138       1          2132146989
PLN139       4          331285629
PLN139       1          2133919239
PLN139       1          2133305249
PLN139       1          2100933269
PLN139       1          143347570
PLN139       1          2134142781
PLN139       1          2145201137
PLN139       1          2137733646
PLN139       1          1914313492
PLN139       1          2145479601
PLN139       1          2114166385
PLN14        118        388802600
PLN140       19         1126901545
PLN140       2          3701885723
PLN140       1          2141253099
PLN140       1          2119186544
PLN140       1          2142175433
PLN140       1          1498831827
PLN140       9          1052661862
PLN140       2          289205187
PLN140       15         1117991556
PLN140       31         1043827067
PLN140       2          1130183954
PLN141       16         912358218
PLN141       2          1009393112
PLN141       2          993028308
PLN141       2          1022916012
PLN141       1          567007916
PLN141       2          1019386330
PLN141       3          1015418383
PLN141       2          1022027198
PLN141       1          538841055
PLN141       2          982316280
PLN141       2          970455477
PLN142       66         1141407077
PLN142       2          978300218
PLN142       1          519958927
PLN142       2          968690797
PLN142       3          980008249
PLN142       1          448723479
PLN142       2          1145618670
PLN142       1          480566411
PLN142       2          943080858
PLN142       2          1000998827
PLN142       2          1157028134
PLN143       14         530754150
PLN143       1          478334130
PLN143       2          956665786
PLN143       3          1002859015
PLN143       2          1128818178
PLN143       1          507274784
PLN143       2          948335936
PLN143       2          879747037
PLN143       2          1127570290
PLN143       1          487585716
PLN143       2          938819340
PLN144       31         1163496004
PLN144       3          885120133
PLN144       1          546259763
PLN144       2          942009307
PLN144       1          491835565
PLN144       2          923497301
PLN144       2          944807908
PLN144       2          874182919
PLN144       2          876644296
PLN144       2          959955654
PLN144       2          1006446686
PLN145       7          308663671
PLN145       2          922850811
PLN145       1          420799321
PLN145       2          930959077
PLN145       2          1041934893
PLN145       2          942999660
PLN145       3          908571112
PLN145       2          994915609
PLN145       2          1008745383
PLN145       2          850230395
PLN145       1          470832587
PLN146       15         1140209198
PLN146       2          994476395
PLN146       2          854196926
PLN146       2          912645655
PLN146       2          862849566
PLN146       2          1021576632
PLN146       2          850007440
PLN146       1          367632597
PLN146       2          912116412
PLN146       1          553356059
PLN146       2          966919222
PLN147       72         1144021221
PLN147       2          876261642
PLN147       2          433744592
PLN147       2          997148082
PLN147       1          525597199
PLN147       2          975421395
PLN147       3          998127563
PLN147       1          531985519
PLN147       2          997566044
PLN147       1          499943225
PLN147       2          945126499
PLN148       61         1159163589
PLN148       2          977083963
PLN148       2          1036274906
PLN148       1          477529720
PLN148       3          1105984004
PLN148       2          1091311779
PLN148       2          928973494
PLN148       3          547302110
PLN148       2          949186154
PLN148       2          998536841
PLN148       2          803475842
PLN149       77         196425373
PLN149       2          950330420
PLN149       2          1091972596
PLN149       2          995224407
PLN149       2          973886503
PLN149       1          444660800
PLN149       2          1023553300
PLN149       2          914623388
PLN149       2          836746646
PLN149       1          432790581
PLN149       2          1058778957
PLN15        65         1139137459
PLN150       89         1079795203
PLN150       2          930200695
PLN150       1          398551120
PLN150       3          942162386
PLN150       1          488646431
PLN150       2          919820886
PLN150       2          904199719
PLN150       1          469438496
PLN150       2          897026796
PLN150       1          532902629
PLN150       2          948044567
PLN151       12         550367550
PLN151       2          935988512
PLN151       1          436072789
PLN151       2          1096125550
PLN151       1          474248680
PLN151       2          870794531
PLN151       2          886494923
PLN151       2          1089597455
PLN151       1          410174162
PLN151       2          893651928
PLN151       3          1146413290
PLN152       58         1176452154
PLN152       1          827770304
PLN152       1          819590567
PLN152       1          657919172
PLN152       1          735222392
PLN152       1          640551262
PLN152       2          850883630
PLN152       1          641523445
PLN152       1          830702509
PLN152       1          817725293
PLN152       1          657518596
PLN153       15         525826380
PLN153       1          728079018
PLN153       1          637620844
PLN153       2          841520699
PLN153       2          787615973
PLN153       1          547589534
PLN153       2          929522122
PLN153       2          918166143
PLN153       2          806717380
PLN153       2          940422912
PLN153       1          481399899
PLN154       8          1100763882
PLN154       2          951785915
PLN154       1          437373607
PLN154       2          1059882713
PLN154       2          918539616
PLN154       1          395065095
PLN154       2          968208187
PLN154       2          1065368112
PLN154       2          928206292
PLN154       1          420024747
PLN154       32         1127028223
PLN155       12         876120058
PLN155       3          189270989
PLN155       28         1129046251
PLN155       48         399992240
PLN155       30         1163643496
PLN155       10         243332908
PLN155       50         1168645895
PLN155       24         1108652219
PLN155       55         1166738942
PLN155       55         1162954495
PLN155       15         248922058
PLN156       107        1113094433
PLN156       36         1121022866
PLN156       5          495551257
PLN156       41         1178973598
PLN156       52         1171134433
PLN156       7          194512759
PLN156       24         1161318370
PLN156       20         798845768
PLN156       9          453146765
PLN156       2          3545513960
PLN156       1          1499997841
PLN157       10         393899286
PLN157       1          1493209057
PLN157       1          1187610474
PLN157       1          943684407
PLN157       8          1161825966
PLN157       10         678190269
PLN157       60         1123620493
PLN157       35         1103233680
PLN157       46         1169631932
PLN157       11         202846913
PLN157       42         1174046069
PLN158       37         1157200342
PLN158       17         875971355
PLN158       1          495016746
PLN158       1          767071137
PLN158       1          671256291
PLN158       1          670741101
PLN158       1          671191297
PLN158       1          771176557
PLN158       1          643128204
PLN158       1          694350238
PLN158       1          641290954
PLN159       34         484801414
PLN159       2          1174904300
PLN159       1          745638687
PLN159       8          1174732410
PLN159       2          147868549
PLN159       35         1182764044
PLN159       5          172411700
PLN159       15         1137951826
PLN159       5          302966115
PLN159       38         966678693
PLN159       1          276062833
PLN16        19724      632039832
PLN160       109        1066016693
PLN160       4          1030454020
PLN160       3          601928786
PLN160       4          1044647336
PLN160       12         971273463
PLN160       63         1078890326
PLN160       5          1171014872
PLN160       2          414484519
PLN160       6          1075986347
PLN160       5          1011739439
PLN160       3          641040368
PLN161       3          217459947
PLN161       6          1155659052
PLN161       6          1180680467
PLN161       1          226440888
PLN161       6          1183825192
PLN161       1          144960904
PLN161       4          596865443
PLN161       1          956684326
PLN161       1          561974515
PLN161       1          718270646
PLN161       1          682093502
PLN162       45         1150354114
PLN162       1          700447244
PLN162       1          683485999
PLN162       1          723946829
PLN162       1          751391258
PLN162       1          651249186
PLN162       2          1175723351
PLN162       2          1136845382
PLN162       44         1170528899
PLN162       33         350013929
PLN162       71         1093753674
PLN163       26         1026200593
PLN163       4          296118519
PLN163       50         1034374597
PLN163       39         1073881614
PLN163       15         186744529
PLN163       55         1086348695
PLN163       9          812247399
PLN163       13         1182713933
PLN163       5          235556068
PLN163       40         1180635522
PLN163       42         459035655
PLN164       1          252054568
PLN164       102        1172312507
PLN164       33         462172122
PLN164       96         1181631126
PLN164       17         485320651
PLN164       8          996864010
PLN164       2          641905789
PLN164       17         1163882844
PLN164       10         553844493
PLN164       8          1153933128
PLN164       16         907583600
PLN165       3          968319031
PLN165       61         1171051519
PLN165       27         734261416
PLN165       61         1176014371
PLN165       24         731321476
PLN165       13         1180963047
PLN165       5          688244352
PLN165       14         1163113056
PLN165       16         805479925
PLN165       23         1022775770
PLN165       10         746646445
PLN166       1          372789172
PLN166       16         1011906545
PLN166       135145     467188272
PLN167       22         1167044508
PLN168       11         374752144
PLN169       23         1153098306
PLN17        96584      101383193
PLN170       26         1154548503
PLN171       1          35730237
PLN172       46         1154003332
PLN173       33         1110400232
PLN174       35         1182511832
PLN175       22         740099219
PLN176       34         1161530233
PLN177       25         854672730
PLN178       34         1157604427
PLN179       24         825387235
PLN18        113437     117621940
PLN180       35         1172475088
PLN181       12         446630180
PLN182       26         1149300899
PLN183       5          554209616
PLN184       8          1169179641
PLN185       3          366576483
PLN186       9          1069109235
PLN187       5          734894067
PLN188       8          1084336480
PLN189       5          513878443
PLN19        57311      72144580
PLN190       8          1129219417
PLN191       4          564629152
PLN192       10         1173787899
PLN193       4          564390138
PLN194       184        1183675910
PLN195       307        1012676673
PLN196       37         16871
PLN197       149        79314
PLN198       2469       93786416
PLN199       7181       18795412
PLN2         101394     600277276
PLN20        28689      28922869
PLN200       14346      29953091
PLN201       227168     299417720
PLN202       379449     326289045
PLN203       273015     666394656
PLN204       72044      110626104
PLN205       98644      85504671
PLN206       49729      72847341
PLN207       25060      110564695
PLN208       21867      892692548
PLN209       1872       1106451307
PLN21        3409       722549176
PLN210       8          500798893
PLN211       513        1049508159
PLN212       1          474651383
PLN213       1          612216829
PLN214       1          571018318
PLN215       2          1112570752
PLN216       130        1162682290
PLN217       13681      570195101
PLN218       198960     140044002
PLN219       384628     373799778
PLN22        181        156660490
PLN220       343659     278663977
PLN221       274523     291245428
PLN222       283673     242537252
PLN223       237398     271582332
PLN224       382373     479091593
PLN225       21551      19736583
PLN226       323192     495932462
PLN227       287063     593183218
PLN228       21492      414505005
PLN229       30271      986119976
PLN23        1125       877653193
PLN230       3295       696602499
PLN231       1392       566152517
PLN232       1283       755100775
PLN233       1          675310294
PLN234       1          628753756
PLN235       1          624247919
PLN236       2          1172266179
PLN237       8564       784313867
PLN238       1          727344967
PLN239       1          946003158
PLN24        109        78230336
PLN240       1          965754312
PLN241       1          906459801
PLN242       1          876148008
PLN243       1          885153844
PLN244       1          899925126
PLN245       4163       1100106582
PLN246       8          255456585
PLN247       543        1092756245
PLN248       129        281783689
PLN249       206        92200731
PLN25        690        1012117390
PLN250       64         1045685747
PLN251       1          696809892
PLN252       1          655542733
PLN253       1          648987779
PLN254       1          622068216
PLN255       1          583456046
PLN256       132        1176770373
PLN257       1          675310294
PLN258       1          628753756
PLN259       1          624247919
PLN26        371        1062942605
PLN260       2          1172266179
PLN261       345        729691402
PLN262       1          521073757
PLN263       1          672273650
PLN264       1          634137895
PLN265       1          624121443
PLN266       2          1171800569
PLN267       2          1153005584
PLN268       1          661076038
PLN269       1          626572591
PLN27        255        1101294268
PLN270       1          612852138
PLN271       2          1169525711
PLN272       2          1136827172
PLN273       1          653624577
PLN274       1          616219606
PLN275       1          610044819
PLN276       2          1134152592
PLN277       2          1156707404
PLN278       1          685423969
PLN279       1          640667275
PLN28        29         802880115
PLN280       1          639123876
PLN281       1          612949391
PLN282       1          577192767
PLN283       1          641629864
PLN284       2          1148934912
PLN285       1          604770208
PLN286       2          1173859433
PLN287       1          556080982
PLN288       2          1115335392
PLN289       1          652551272
PLN29        118        1157726217
PLN290       1          615767531
PLN291       1          605571303
PLN292       1          592249714
PLN293       4          1166268162
PLN294       1          550024188
PLN295       1          710194481
PLN296       1          661081403
PLN297       1          659460550
PLN298       1          630572514
PLN299       1          598618390
PLN3         197597     419771519
PLN30        73         555012493
PLN300       1          658974642
PLN301       1          559656399
PLN302       1          717517502
PLN303       1          672450454
PLN304       1          665297378
PLN305       1          636785599
PLN306       1          599706080
PLN307       1          675658265
PLN308       1          523168208
PLN309       1          671211297
PLN31        74         124609184
PLN310       1          630677708
PLN311       1          623428415
PLN312       1          604298040
PLN313       1          558526623
PLN314       2          1124081839
PLN315       1          640830439
PLN316       1          597781253
PLN317       1          600363860
PLN318       2          1105176863
PLN319       2          1154056276
PLN32        15         1076501108
PLN320       1          685947972
PLN321       1          649921694
PLN322       1          641099225
PLN323       1          611845738
PLN324       1          581041262
PLN325       2          1176958498
PLN326       1          667717957
PLN327       1          631819663
PLN328       1          624692602
PLN329       1          597351075
PLN33        3          422359550
PLN330       1          561737938
PLN331       2          1154165677
PLN332       1          670202054
PLN333       1          631946783
PLN334       1          626743494
PLN335       2          1167772850
PLN336       2          1151941538
PLN337       1          671530377
PLN338       1          631910401
PLN339       1          622474059
PLN34        49         1134143683
PLN340       2          1160377439
PLN341       2          1159528938
PLN342       1          684336246
PLN343       1          636053469
PLN344       1          629969872
PLN345       2          1172688001
PLN346       2          1160045407
PLN347       1          665715246
PLN348       1          624683667
PLN349       1          621078253
PLN35        31         548900587
PLN350       2          1159864294
PLN351       2          1170185454
PLN352       1          697540743
PLN353       1          655862368
PLN354       1          646765634
PLN355       1          618540729
PLN356       1          587963859
PLN357       455        1147653963
PLN358       10         201809768
PLN359       21         707743781
PLN36        21         1180521825
PLN360       1          705338699
PLN361       1          493450010
PLN362       1          804285258
PLN363       1          810734643
PLN364       1          673981989
PLN365       1          754496630
PLN366       1          855759449
PLN367       1          614042580
PLN368       1          743847818
PLN369       1          673340788
PLN37        47         381546474
PLN370       1          515668560
PLN371       1          713320806
PLN372       1          703598484
PLN373       1          570159854
PLN374       1          625793224
PLN375       1          721110502
PLN376       1          459355444
PLN377       1          745201001
PLN378       1          749284433
PLN379       1          643344672
PLN38        159        1056502701
PLN380       1          595297365
PLN381       1          688905267
PLN382       1          491807393
PLN383       1          769338634
PLN384       1          671568023
PLN385       1          635285330
PLN386       1          745618965
PLN387       1          839470345
PLN388       1          646400022
PLN389       1          747589525
PLN39        125        832265940
PLN390       2          1171764895
PLN391       1          703962928
PLN392       1          702438406
PLN393       2          1178978634
PLN394       2          1173154747
PLN395       1          734536914
PLN396       1          738743901
PLN397       1          636778132
PLN398       1          602900890
PLN399       1          697493198
PLN4         54154      448569398
PLN40        213        995602210
PLN400       1          490518203
PLN401       1          784661008
PLN402       1          810500911
PLN403       1          655314739
PLN404       1          752710991
PLN405       1          890847171
PLN406       1          621781073
PLN407       1          743084022
PLN408       1          676741658
PLN409       1          509452426
PLN41        32         996843807
PLN410       1          710124532
PLN411       2          1058788934
PLN412       1          620140791
PLN413       1          716573881
PLN414       1          476726550
PLN415       1          756324664
PLN416       1          977471539
PLN417       2          1144819353
PLN418       1          646234737
PLN419       1          605172934
PLN42        73         639978110
PLN420       1          593744788
PLN421       2          1117445025
PLN422       1          607667504
PLN423       1          590561804
PLN424       2          1176631761
PLN425       1          782694893
PLN426       1          796420183
PLN427       1          650274702
PLN428       1          739889549
PLN429       1          848590828
PLN43        4          991306162
PLN430       1          610626473
PLN431       1          738023571
PLN432       2          1173882462
PLN433       1          701434008
PLN434       1          690770133
PLN435       1          567265955
PLN436       1          612987783
PLN437       1          704156067
PLN438       1          475327881
PLN439       1          732118298
PLN44        1          296818136
PLN440       1          733931846
PLN441       1          636796232
PLN442       1          599764323
PLN443       1          691313424
PLN444       1          493357854
PLN445       1          782685093
PLN446       1          786410271
PLN447       1          648139033
PLN448       1          744407562
PLN449       1          835583350
PLN45        5          1159558460
PLN450       1          623221719
PLN451       1          741299132
PLN452       1          669032550
PLN453       1          517040482
PLN454       1          711661679
PLN455       1          708205786
PLN456       2          1156892395
PLN457       2          1178356817
PLN458       1          737453356
PLN459       1          736349413
PLN46        56         233110334
PLN460       1          639162162
PLN461       1          586755746
PLN462       1          704478343
PLN463       1          492109999
PLN464       1          791475352
PLN465       1          785940626
PLN466       1          661246824
PLN467       1          756990402
PLN468       1          858776195
PLN469       1          621195942
PLN47        21         1168726770
PLN470       1          754256086
PLN471       1          670301833
PLN472       1          509263899
PLN473       1          708234589
PLN474       1          725120110
PLN475       1          575129590
PLN476       1          620883766
PLN477       1          727285804
PLN478       1          479660269
PLN479       1          745978486
PLN48        1          157681923
PLN480       1          750160716
PLN481       1          642428577
PLN482       1          591313643
PLN483       1          705330581
PLN484       1          495656580
PLN485       1          803232604
PLN486       1          790745243
PLN487       1          657494025
PLN488       1          759305888
PLN489       1          856542542
PLN49        184        1170332002
PLN490       1          628321883
PLN491       1          754364263
PLN492       1          697113365
PLN493       1          504254270
PLN494       1          715354979
PLN495       1          713929667
PLN496       1          572943128
PLN497       1          626959190
PLN498       1          715714221
PLN499       1          483823121
PLN5         32073      942678547
PLN50        52         491981677
PLN500       1          742917797
PLN501       1          748536659
PLN502       1          643784981
PLN503       1          600654286
PLN504       2          1171400808
PLN505       1          794150360
PLN506       1          799857935
PLN507       1          655329108
PLN508       1          749763888
PLN509       1          838116175
PLN51        8          1074474850
PLN510       1          610468321
PLN511       1          736551279
PLN512       2          1171154657
PLN513       2          1170482349
PLN514       1          566465558
PLN515       1          614421429
PLN516       2          1179310235
PLN517       1          735408736
PLN518       1          969998116
PLN519       11         635028102
PLN52        48         777884683
PLN520       1          595339094
PLN521       1          698605642
PLN522       1          499102108
PLN523       1          791748890
PLN524       1          797311483
PLN525       1          656817438
PLN526       1          753360318
PLN527       1          845838138
PLN528       1          619661694
PLN529       1          752772853
PLN53        76         1120919626
PLN530       1          689709469
PLN531       1          509595892
PLN532       1          712797596
PLN533       1          710493282
PLN534       1          570643040
PLN535       1          619886155
PLN536       1          705533140
PLN537       1          484551304
PLN538       1          740148362
PLN539       1          757233630
PLN54        18         645106926
PLN540       1          642499559
PLN541       1          594006513
PLN542       1          693261537
PLN543       1          492948387
PLN544       1          781462734
PLN545       1          802944975
PLN546       1          650275864
PLN547       1          756841830
PLN548       1          850623622
PLN549       1          614136911
PLN55        337        1002760898
PLN550       1          723255126
PLN551       2          1177410070
PLN552       1          712168462
PLN553       1          712339524
PLN554       1          564869106
PLN555       1          619418949
PLN556       1          715454519
PLN557       1          478264344
PLN558       1          734693445
PLN559       1          749685439
PLN56        121        251819355
PLN560       1          633598967
PLN561       1          782818162
PLN562       1          1022071454
PLN563       1          971920087
PLN564       1          827198496
PLN565       1          867619200
PLN566       1          806566123
PLN567       1          1015700474
PLN568       1          742303966
PLN569       1          956173857
PLN57        433        1050481664
PLN570       1          916702776
PLN571       1          874517040
PLN572       1          816294110
PLN573       1          750216944
PLN574       21         862613184
PLN575       176        657269103
PLN576       1          665585731
PLN577       1          621516506
PLN578       1          610333535
PLN579       2          1150013201
PLN58        99         698308529
PLN580       119        632628552
PLN581       4          1055123987
PLN582       2          399259151
PLN583       773        1136041142
PLN584       18         958385885
PLN585       3          1008669690
PLN586       16454      1068645461
PLN587       5636       1862075
PLN588       7252       957026037
PLN589       1          594102056
PLN59        430        1173128636
PLN590       1          689851870
PLN591       1          495453186
PLN592       1          780798557
PLN593       1          801256715
PLN594       1          651852609
PLN595       1          750843639
PLN596       1          830829764
PLN597       1          615552423
PLN598       1          744588157
PLN599       1          673617499
PLN6         46         124218893
PLN60        127        437592776
PLN600       1          509857067
PLN601       1          709773743
PLN602       1          713149757
PLN603       1          566080677
PLN604       1          618079260
PLN605       1          720988478
PLN606       1          473592718
PLN607       1          736706236
PLN608       1          750620385
PLN609       2578       1146365542
PLN61        105        1134076865
PLN610       4108       303878996
PLN611       15611      709441102
PLN612       1          585266722
PLN613       1          681112512
PLN614       1          775448786
PLN615       1          790338525
PLN616       1          746673839
PLN617       1          836514780
PLN618       1          736872137
PLN619       1          676292951
PLN62        111        220031698
PLN620       1          669155517
PLN621       1          701372996
PLN622       1          615672275
PLN623       1          698614761
PLN624       1          728031845
PLN625       12303      731451465
PLN626       94681      142561266
PLN627       280498     582157750
PLN628       302413     570758891
PLN629       15820      37737542
PLN63        162        1085904129
PLN630       246081     636632506
PLN631       45686      143540254
PLN632       201296     690380000
PLN633       2873       16285478
PLN634       160482     731870821
PLN635       27007      86980451
PLN636       166190     727890154
PLN637       128441     590542724
PLN638       169300     731548911
PLN639       54900      195093939
PLN64        337        692989072
PLN640       134091     782940810
PLN641       53290      312375310
PLN642       202091     708206956
PLN643       33539      196057383
PLN644       175477     722794878
PLN645       11923      683457356
PLN646       1          528447123
PLN647       1          678170541
PLN648       1          639558213
PLN649       1          629672760
PLN65        172        1104865850
PLN650       1          608467472
PLN651       1          565695744
PLN652       2          1166970321
PLN653       1          684376481
PLN654       1          642597466
PLN655       1          631979072
PLN656       1          607115911
PLN657       1          582960187
PLN658       1          640026769
PLN659       1          608979116
PLN66        16         282568200
PLN660       1          720972993
PLN661       1          501257520
PLN662       1          804602427
PLN663       1          808121247
PLN664       1          649118519
PLN665       1          758906661
PLN666       1          861141126
PLN667       1          642382296
PLN668       1          759893476
PLN669       1          689766370
PLN67        224        1167597370
PLN670       1          531462149
PLN671       1          714517032
PLN672       1          717288350
PLN673       1          586345039
PLN674       1          626266972
PLN675       1          738085275
PLN676       1          505809789
PLN677       1          759124079
PLN678       1          751612808
PLN679       12         1160338339
PLN68        96         448470916
PLN680       685        1037884752
PLN681       2          1145861525
PLN682       2          1112884977
PLN683       1          477706438
PLN684       2          875660940
PLN685       2          924439243
PLN686       1          481348281
PLN687       2          896921305
PLN688       2          995026189
PLN689       2          869378871
PLN69        10         1182999913
PLN690       2          922541915
PLN691       2          917029648
PLN692       1          538887009
PLN693       1          574640544
PLN694       1          667652801
PLN695       2          1153333809
PLN696       2          976557482
PLN697       2          971318115
PLN698       2          905021021
PLN699       2          779060037
PLN7         4357       1078154010
PLN70        9          1033145339
PLN700       2          1026993414
PLN701       2          1040398764
PLN702       2          906287378
PLN703       2          1107801300
PLN704       2          1085890887
PLN705       1          588203704
PLN706       2          1015273266
PLN707       2          965280586
PLN708       1          582703961
PLN709       2          1026383973
PLN71        9          1070832115
PLN710       2          1018992133
PLN711       20         537195591
PLN712       1          613662638
PLN713       1          794474755
PLN714       1          760111594
PLN715       1          769810128
PLN716       1          715684684
PLN717       1          623890083
PLN718       1          755457679
PLN719       1          717109572
PLN72        10         1167983468
PLN720       1          817712742
PLN721       1          864624966
PLN722       1          701857263
PLN723       1          726425509
PLN724       1          738041677
PLN725       1          767912069
PLN726       1          504659958
PLN727       1          662526948
PLN728       2          1167934623
PLN729       2          1091547167
PLN73        6          1041755176
PLN730       3          1082389428
PLN731       2          582533673
PLN732       3          942215135
PLN733       1          354403191
PLN734       316        1102146609
PLN735       37         1037827543
PLN736       74         199331596
PLN737       436        1166298862
PLN738       26         992712695
PLN739       4          1158055928
PLN74        2          356433379
PLN740       2          1135086767
PLN741       2          1031765593
PLN742       149        1154467731
PLN743       23         858680371
PLN744       1053       1144769269
PLN745       1          703076930
PLN746       1          495911329
PLN747       1          796169439
PLN748       1          779372321
PLN749       1          665561653
PLN75        63         1173046176
PLN750       1          757165295
PLN751       1          852704148
PLN752       1          623698249
PLN753       1          745048881
PLN754       1          677947850
PLN755       1          524289323
PLN756       1          726838826
PLN757       1          701430346
PLN758       1          584133940
PLN759       1          622677745
PLN76        182        756898379
PLN760       1          745712656
PLN761       1          490622797
PLN762       1          748850018
PLN763       1          753856519
PLN764       700        674126380
PLN765       1          593930347
PLN766       1          702775664
PLN767       1          494594617
PLN768       1          792837209
PLN769       1          812232696
PLN77        117        1159004230
PLN770       1          661835603
PLN771       1          750337041
PLN772       1          854463248
PLN773       1          623248023
PLN774       1          749950614
PLN775       1          673746810
PLN776       1          520815567
PLN777       1          712547961
PLN778       1          703299309
PLN779       1          569771178
PLN78        12         1141850928
PLN780       1          620176429
PLN781       1          717542863
PLN782       1          493761083
PLN783       1          746502734
PLN784       1          752612656
PLN785       573        686952725
PLN786       2          990024350
PLN787       2          888868060
PLN788       1          485323027
PLN789       2          941973305
PLN79        5          1125968574
PLN790       2          1051914856
PLN791       1          638425132
PLN792       1          716105986
PLN793       1          613160974
PLN794       2          1177939381
PLN795       2          1016319037
PLN796       1          480949782
PLN797       2          954568201
PLN798       1          298028472
PLN799       242        1168816031
PLN8         77         711343148
PLN80        2          359637190
PLN800       310        746899521
PLN801       133        749981360
PLN802       1          702775664
PLN803       1          494594617
PLN804       1          792837209
PLN805       1          812232696
PLN806       1          661835603
PLN807       1          750337041
PLN808       1          854463248
PLN809       1          623248023
PLN81        283        1034403005
PLN810       1          749950614
PLN811       1          673746810
PLN812       1          520815567
PLN813       1          712547961
PLN814       1          703299309
PLN815       1          569771178
PLN816       1          620176429
PLN817       1          717542863
PLN818       1          493761083
PLN819       1          746502734
PLN82        40         1075820283
PLN820       1          752612656
PLN821       233        1180834457
PLN822       6503       509584943
PLN823       1          657893865
PLN824       2          1156686622
PLN825       2          1150914040
PLN826       5          626957076
PLN827       103        1176215683
PLN828       32         874057681
PLN829       59         1170613979
PLN83        3          424655429
PLN830       37         890565897
PLN831       42         1157660304
PLN832       33         916538999
PLN833       38         1124061822
PLN834       19         958397564
PLN835       35         1145742472
PLN836       11         421835350
PLN837       39         1163413684
PLN838       178        739865527
PLN839       10         1112532336
PLN84        8          1102481801
PLN840       120        1115935246
PLN841       5          402339329
PLN842       21         1180552620
PLN843       8          416782388
PLN844       279        1134361485
PLN845       9          315307783
PLN846       4          1080552710
PLN847       2          438380923
PLN848       43         1145344578
PLN849       13         1126392473
PLN85        2          540692104
PLN850       119        245112629
PLN851       23         1093148685
PLN852       5          422767247
PLN853       24         1165880814
PLN854       189        569374133
PLN855       1          599230268
PLN856       1          709345803
PLN857       1          499575344
PLN858       1          795989443
PLN859       1          809120074
PLN86        4          991095321
PLN860       1          670531570
PLN861       1          759055895
PLN862       1          872909281
PLN863       1          637083831
PLN864       1          765902670
PLN865       1          688536368
PLN866       1          533804092
PLN867       1          714878730
PLN868       1          728610199
PLN869       1          586077705
PLN87        2          509157458
PLN870       1          622419581
PLN871       1          733835468
PLN872       1          506756789
PLN873       1          759450946
PLN874       1          768174826
PLN875       3          659068422
PLN876       1          865431811
PLN877       1          841368522
PLN878       1          772393794
PLN879       1          766078222
PLN88        23         1166540265
PLN880       1          735900830
PLN881       1          693266847
PLN882       1          690056233
PLN883       1          654671025
PLN884       1          681539918
PLN885       1          650134427
PLN886       1          643737533
PLN887       2          1092839925
PLN888       1          528421643
PLN889       2          1025960110
PLN89        259        1173013079
PLN890       1          484156440
PLN891       13         427663120
PLN892       1          1574527093
PLN893       1          1805244829
PLN894       1          1716769615
PLN895       1          1637815978
PLN896       1          1645877737
PLN897       1          1365994436
PLN898       1          1520236431
PLN899       8          34567157
PLN9         32         1155338215
PLN90        3          110045716
PLN900       13         790727573
PLN901       1          660114068
PLN902       1          623862790
PLN903       1          606413785
PLN904       2          1155915948
PLN905       1          627107635
PLN906       2          1184046427
PLN907       1          626943711
PLN908       1          613583204
PLN909       1          592677528
PLN91        17         900773506
PLN910       1          559914542
PLN911       2          1147808788
PLN912       1          656479363
PLN913       1          621609376
PLN914       1          611088072
PLN915       2          1140013277
PLN916       2          1154214120
PLN917       1          661498744
PLN918       1          626053568
PLN919       1          608346219
PLN92        1          594546470
PLN920       2          1151823422
PLN921       1          639402856
PLN922       1          523218450
PLN923       1          661546608
PLN924       1          633922074
PLN925       1          612932250
PLN926       1          591516528
PLN927       2          1182689651
PLN928       1          530821096
PLN929       1          664715623
PLN93        2          1174734371
PLN930       1          631770265
PLN931       1          613234972
PLN932       1          604325310
PLN933       1          582152544
PLN934       2          1158575799
PLN935       1          661621317
PLN936       1          626868012
PLN937       1          607094319
PLN938       2          1149874108
PLN939       2          1149787837
PLN94        2          1111268940
PLN940       1          656602423
PLN941       1          622110859
PLN942       1          612883152
PLN943       2          1142529769
PLN944       2          1154234909
PLN945       1          656789389
PLN946       1          625372561
PLN947       1          603451504
PLN948       2          1159731212
PLN949       2          1150269419
PLN95        28         1135832320
PLN950       1          657552530
PLN951       1          618447767
PLN952       1          613586716
PLN953       2          1143934454
PLN954       1          631620540
PLN955       1          521019562
PLN956       1          676241010
PLN957       1          632313166
PLN958       1          603807353
PLN959       2          1155326502
PLN96        19         506053923
PLN960       2          1150412865
PLN961       1          662000247
PLN962       1          633487160
PLN963       1          612164168
PLN964       1          594048367
PLN965       1          565074362
PLN966       2          1150238410
PLN967       1          660449817
PLN968       1          627269420
PLN969       1          602651360
PLN97        25         1176429757
PLN970       2          1162506895
PLN971       2          1158496591
PLN972       1          664401522
PLN973       1          626503588
PLN974       1          611188438
PLN975       2          1171231026
PLN976       1          639824632
PLN977       2          1173957386
PLN978       1          621715108
PLN979       1          610707416
PLN98        57         1173826657
PLN980       1          589489225
PLN981       1          558356414
PLN982       2          1151723189
PLN983       1          660500976
PLN984       1          634743673
PLN985       1          616002081
PLN986       2          1150169128
PLN987       2          1153490048
PLN988       1          669356984
PLN989       1          631173187
PLN99        8          204748821
PLN990       1          607766370
PLN991       2          1145806163
PLN992       2          1143277701
PLN993       1          664077638
PLN994       1          624178744
PLN995       1          609451706
PLN996       2          1144639091
PLN997       1          631526965
PLN998       1          660034972
PLN999       1          625104971
PRI1         23047      60053106
PRI10        2242       1049737833
PRI11        7          1054721751
PRI12        9619       1167759726
PRI13        51713      80725821
PRI14        53151      979836358
PRI15        9          1175135830
PRI16        5          991549712
PRI17        7          910099250
PRI18        6          1153842615
PRI19        11         1048068825
PRI2         28864      1050341494
PRI20        8          1079976827
PRI21        7          985425849
PRI22        10         1151487527
PRI23        11         1110746497
PRI24        2          278974018
PRI25        7          1151013097
PRI26        127671     939740267
PRI27        52008      101670651
PRI28        163401     559900232
PRI29        169220     642798216
PRI3         4703       636595787
PRI30        107949     842809822
PRI31        11829      60187941
PRI32        117247     875892199
PRI33        164        426290540
PRI34        772        1171021624
PRI35        56852      812922290
PRI4         8333       1104652402
PRI5         8708       961605218
PRI6         19803      634234652
PRI7         27929      79132073
PRI8         96050      166265556
PRI9         30070      1101152567
ROD1         42159      1008837853
ROD10        12         1077235365
ROD100       6          568551949
ROD101       13         1057276660
ROD102       3          482785390
ROD103       11         1120709301
ROD104       11         954882810
ROD105       11         1138251811
ROD106       17         1102190201
ROD107       7          1067152563
ROD108       6          668123932
ROD109       16         1131848017
ROD11        4          763441177
ROD110       7          689992124
ROD111       19         1156972737
ROD112       5          609164690
ROD113       13         1146902586
ROD114       13         706688834
ROD115       11         1146173548
ROD116       148        1098231299
ROD117       1          200613070
ROD118       7          1092870110
ROD119       13         1146606716
ROD12        8          1167428371
ROD120       27085      192469579
ROD13        161        918978924
ROD14        7          1078339014
ROD15        5          617359317
ROD16        89         1130749860
ROD17        5          531191793
ROD18        15         1161179778
ROD19        7          553671745
ROD2         4239       782462163
ROD20        19         1172805098
ROD21        98210      627840144
ROD22        8          1096445171
ROD23        11         1065805777
ROD24        8          1087503260
ROD25        10         859668626
ROD26        7          1065740602
ROD27        110        1130872454
ROD28        10         1095487923
ROD29        4          611448462
ROD3         5925       1106303123
ROD30        9          1170792484
ROD31        7          1007233338
ROD32        12         1139805638
ROD33        7          1102147628
ROD34        10         1155930739
ROD35        11         1098049524
ROD36        9          1150323287
ROD37        9          1170918579
ROD38        9          1178699347
ROD39        10         1042031390
ROD4         16388      354458066
ROD40        2          334811729
ROD41        8          1108112131
ROD42        11         1166769479
ROD43        1          157584965
ROD44        8          1106421483
ROD45        11         1096468690
ROD46        2          245275529
ROD47        10         1105189242
ROD48        9          1153800168
ROD49        1          177680146
ROD5         23215      505710838
ROD50        8          1124775391
ROD51        11         1014425308
ROD52        2          370341452
ROD53        8          1135703989
ROD54        6          684815851
ROD55        10         1148623723
ROD56        5          671349488
ROD57        11         1011717511
ROD58        5          821705591
ROD59        9          1145859896
ROD6         303403     646139146
ROD60        8          740870690
ROD61        7          1083840393
ROD62        10         1142364021
ROD63        3          146446812
ROD64        10         1150647282
ROD65        8          1094459808
ROD66        3          269228856
ROD67        10         1152930414
ROD68        4          578343561
ROD69        19         1066268739
ROD7         97485      65752145
ROD70        8          876855184
ROD71        19         1151436343
ROD72        6          649442391
ROD73        12         1119919372
ROD74        21         1026661546
ROD75        1          188060799
ROD76        8          1175090281
ROD77        7          697432909
ROD78        12         1037257517
ROD79        6          916476668
ROD8         40624      989063787
ROD80        10         1136813612
ROD81        6          757758797
ROD82        8          1083186456
ROD83        10         1065713492
ROD84        1          184589612
ROD85        7          1082392531
ROD86        9          1050453265
ROD87        9          1140334745
ROD88        11         1018693748
ROD89        10         1099288471
ROD9         5          747888891
ROD90        8          967904117
ROD91        13         1050156797
ROD92        9          1142937325
ROD93        14         1036322534
ROD94        6          975869499
ROD95        13         1164045684
ROD96        9          1064632113
ROD97        11         1130583323
ROD98        8          525643352
ROD99        7          1113949024
STS1         322255     155037062
STS2         325270     215137713
STS3         330216     149930483
STS4         369247     120817879
SYN1         54450      995654191
SYN10        135752     848257181
SYN11        56055      402173564
SYN2         5          418163749
SYN3         7          1026747849
SYN4         7          905174914
SYN5         9          1164048999
SYN6         7          771284004
SYN7         6          1076407027
SYN8         333        913831861
SYN9         66393      241027112
TSA1         530474     190965098
TSA10        107955     75847634
TSA11        421728     180662797
TSA12        453722     281751974
TSA13        496775     439245490
TSA14        151611     162821539
TSA15        478101     442403965
TSA16        69555      96695981
TSA17        540330     380298629
TSA18        75992      43161511
TSA19        472069     354771593
TSA2         431253     271169054
TSA20        472700     346803005
TSA21        485077     345824164
TSA22        447500     371642457
TSA23        137157     81320982
TSA24        510932     439399615
TSA25        58986      96878191
TSA26        386750     404742785
TSA27        386747     295816167
TSA28        515188     355802485
TSA29        41717      39146972
TSA3         450976     244523399
TSA30        402182     380481762
TSA31        1332       456025
TSA32        350087     279521147
TSA33        350088     306834608
TSA34        506159     408010496
TSA35        176936     190058946
TSA36        519423     404484025
TSA37        32591      22930116
TSA38        309272     251629584
TSA39        263445     683524151
TSA4         423423     363034342
TSA40        30090      107284106
TSA41        321401     286606614
TSA42        33866      32890162
TSA43        225626     184706695
TSA44        67909      19803915
TSA45        252490     65705875
TSA46        134255     46673193
TSA47        386745     358263417
TSA48        400786     529016441
TSA49        111964     240609423
TSA5         391580     314616150
TSA50        391566     529635074
TSA51        121185     168266178
TSA52        431861     456395607
TSA53        94591      61299880
TSA54        451898     419220916
TSA55        123499     121448278
TSA6         443854     278464186
TSA7         576449     352192162
TSA8         23841      14335953
TSA9         545119     359475407
UNA1         769        4547944
VRL1         351165     457406579
VRL10        238615     459098915
VRL100       26044      663939957
VRL101       11626      345235602
VRL102       22860      665086056
VRL103       11858      343538398
VRL104       23413      665701550
VRL105       10928      324701294
VRL106       23119      666015001
VRL107       11606      339734423
VRL108       23789      665031434
VRL109       11350      338299608
VRL11        216563     446868739
VRL110       23448      664409576
VRL111       11575      339039157
VRL112       23149      661332617
VRL113       2048       61046862
VRL114       26122      664160460
VRL115       2174       64764995
VRL116       22327      664086068
VRL117       23317      666255776
VRL118       3659       109050930
VRL119       23180      665172380
VRL12        201744     666493106
VRL120       11590      335046137
VRL121       23008      664679711
VRL122       12228      338832059
VRL123       22591      664270966
VRL124       13692      405909769
VRL125       22387      665914600
VRL126       2482       73993039
VRL127       22703      667381501
VRL128       3394       101172342
VRL129       22628      661840989
VRL13        64782      155179108
VRL130       4656       137549576
VRL131       22904      673803092
VRL132       4083       119637084
VRL133       22879      662991979
VRL134       5551       165320293
VRL135       23148      664999694
VRL136       5819       171775000
VRL137       22673      668542528
VRL138       7849       231600738
VRL139       22871      663327809
VRL14        212107     526211417
VRL140       4238       120052508
VRL141       28861      669032717
VRL142       3746       111460380
VRL143       22891      664361220
VRL144       2509       73351678
VRL145       24552      664240287
VRL146       9762       251362612
VRL147       22702      660801592
VRL148       7250       203163134
VRL149       36328      650622377
VRL15        231504     510332536
VRL150       7719       221201008
VRL151       22388      661482637
VRL152       13163      287131435
VRL153       24412      662422103
VRL154       3082       83056403
VRL155       22771      661222738
VRL156       6828       200274547
VRL157       22489      661890907
VRL158       3424       98648510
VRL159       22671      664240162
VRL16        192669     552943831
VRL160       5495       160014237
VRL161       22762      662463834
VRL162       10496      288267786
VRL163       24386      659952216
VRL164       7386       219192736
VRL165       23092      661622542
VRL166       7565       220521556
VRL167       25220      662310155
VRL168       4939       123779990
VRL169       23251      663395448
VRL17        21400      139451107
VRL170       4539       115826637
VRL171       24300      663419155
VRL172       3563       104712982
VRL173       25788      661101279
VRL174       4589       133546685
VRL175       24491      669736945
VRL176       3674       98938219
VRL177       24351      665637579
VRL178       2685       72430400
VRL179       24069      667426005
VRL18        73937      643896996
VRL180       3512       103654952
VRL181       24667      666306851
VRL182       6944       203160225
VRL183       23810      668006965
VRL184       6812       184506286
VRL185       23296      668363688
VRL186       2852       84712584
VRL187       24187      665094210
VRL188       3922       107724361
VRL189       23339      665176538
VRL19        11407      129107876
VRL190       3280       93669315
VRL191       27330      659200052
VRL192       6944       178729503
VRL193       23992      667076935
VRL194       4728       132417861
VRL195       22723      661214812
VRL196       5850       167602381
VRL197       27182      660103618
VRL198       9720       274841774
VRL199       24051      670232794
VRL2         17631      234354529
VRL20        61362      650031595
VRL200       3172       93782526
VRL201       23530      664001771
VRL202       23608      623469228
VRL203       25193      666754935
VRL204       4549       123588514
VRL205       24867      661166335
VRL206       2488       73964907
VRL207       25598      664144974
VRL208       6263       169704624
VRL209       25718      667634849
VRL21        10666      157039990
VRL210       14249      347056515
VRL211       26412      664860050
VRL212       4115       122105870
VRL213       23738      668811682
VRL214       5337       150667363
VRL215       26323      660701067
VRL216       4632       125077545
VRL217       26498      661122407
VRL218       6435       126429604
VRL219       27192      658251995
VRL22        35249      659745762
VRL220       7396       202846491
VRL221       23997      663152115
VRL222       8467       205721477
VRL223       25467      664387219
VRL224       23095      665471073
VRL225       3583       105451757
VRL226       30162      663743221
VRL227       12573      337105674
VRL228       23987      665681145
VRL229       4163       123851428
VRL23        5845       129302223
VRL230       23546      669066689
VRL231       2557       86055576
VRL232       24310      666823566
VRL233       3764       99778178
VRL234       24996      667498705
VRL235       2799       110004708
VRL236       23811      670211616
VRL237       13151      374757527
VRL238       29069      658082926
VRL239       18565      368364856
VRL24        27312      665721536
VRL240       26790      667893210
VRL241       16523      414468305
VRL242       31781      659141754
VRL243       5331       139241702
VRL244       25384      668647837
VRL245       5839       157123144
VRL246       31228      660268348
VRL247       11860      301542138
VRL248       25992      659732017
VRL249       3388       100932101
VRL25        13884      308196854
VRL250       24182      666450464
VRL251       6056       138648401
VRL252       29131      660984679
VRL253       3542       98178735
VRL254       35937      652249203
VRL255       5388       89576759
VRL256       24820      665712294
VRL257       2716       76867684
VRL258       28058      662477137
VRL259       3172       94020244
VRL26        32776      659460329
VRL260       27513      669104309
VRL261       2232       145519660
VRL262       24827      673537770
VRL263       7664       169185116
VRL264       25321      664486320
VRL265       3146       88780507
VRL266       40824      653578410
VRL267       10205      185232187
VRL268       32623      666347937
VRL269       16826      225289123
VRL27        14107      301524080
VRL270       26017      667169525
VRL271       2841       83899097
VRL272       46895      656030613
VRL273       11840      181982590
VRL274       34139      666316905
VRL275       10559      229488301
VRL276       34154      667549164
VRL277       11193      269051448
VRL278       22342      665926509
VRL279       2213       63674476
VRL28        24771      661733446
VRL280       34196      668567394
VRL281       5469       94606009
VRL282       28397      664772240
VRL283       4028       87504621
VRL284       36876      660160913
VRL285       2815       70883257
VRL286       39022      662192710
VRL287       5890       83131988
VRL288       25709      668361267
VRL289       13676      309872864
VRL29        20908      281282381
VRL290       12227      365289108
VRL291       18622      556401819
VRL292       1904       56895892
VRL293       37600      1122562705
VRL294       6408       191001999
VRL295       38039      1133916160
VRL296       7081       211211275
VRL297       37759      1126417186
VRL298       4393       131120156
VRL299       37573      1121004282
VRL3         271538     434737633
VRL30        23746      661358843
VRL300       3678       109876644
VRL301       37263      1113069284
VRL302       6459       192949404
VRL303       37152      1110095569
VRL304       3508       104849697
VRL305       37050      1109816359
VRL306       2971       88793839
VRL307       3626       108345075
VRL308       37059      1106189870
VRL309       3080       92054761
VRL31        6587       182464490
VRL310       37003      1105752003
VRL311       11640      347894626
VRL312       37117      1107776127
VRL313       3565       106560617
VRL314       37101      1107706020
VRL315       8906       266186263
VRL316       37266      1112961387
VRL317       19262      575377200
VRL318       37096      1108446363
VRL319       13825      412904674
VRL32        24944      660257958
VRL320       36984      1105279601
VRL321       9990       298572291
VRL322       37050      1107279362
VRL323       8845       264320349
VRL324       37064      1107692833
VRL325       6116       182789958
VRL326       36189      1081600686
VRL327       7777       232438502
VRL328       36975      1104659436
VRL329       7120       212797569
VRL33        6094       160643526
VRL330       36968      1104523842
VRL331       7152       213351330
VRL332       37490      1118859789
VRL333       7207       215280046
VRL334       37076      1107334502
VRL335       7143       213477342
VRL336       37102      1107707586
VRL337       6910       206517986
VRL338       36982      1105546560
VRL339       15953      475986831
VRL34        29620      659050873
VRL340       37101      1108822824
VRL341       14316      427808954
VRL342       37334      1114025091
VRL343       14994      447344151
VRL344       37333      1114773948
VRL345       2938       87808607
VRL346       36929      1103098613
VRL347       3203       95653246
VRL348       37305      1113491932
VRL349       3215       96002981
VRL35        5227       145555528
VRL350       37288      1113064958
VRL351       16286      486144130
VRL352       37084      1107504618
VRL353       6424       191904149
VRL354       37076      1107432971
VRL355       20302      605934045
VRL356       37031      1105952216
VRL357       9832       293761710
VRL358       36863      1101228020
VRL359       37008      1104966084
VRL36        22974      665203149
VRL360       3180       94878679
VRL361       37256      1111474329
VRL362       36493      1089874613
VRL363       36961      1104073846
VRL364       22011      657495345
VRL365       37040      1106411997
VRL366       14424      430928209
VRL367       37512      1115966636
VRL368       32908      983056718
VRL369       37272      1113460437
VRL37        810        20017439
VRL370       21437      640266041
VRL371       37031      1105934353
VRL372       12962      387102364
VRL373       37130      1108723285
VRL374       12932      386175225
VRL375       36661      1094921729
VRL376       13350      398759112
VRL377       37127      1108347763
VRL378       12643      377434462
VRL379       37089      1107210769
VRL38        23653      664319814
VRL380       6009       179371181
VRL381       37135      1108608927
VRL382       13706      409227550
VRL383       37191      1109653846
VRL384       14124      420580642
VRL385       37487      1119207298
VRL386       4769       142428949
VRL387       37392      1116764909
VRL388       4696       140298925
VRL389       37117      1108332871
VRL39        3113       82392829
VRL390       4890       146149213
VRL391       36462      1088391604
VRL392       5358       159900353
VRL393       36324      1083869001
VRL394       5527       164048842
VRL395       37683      1121763094
VRL396       4884       145039704
VRL397       37843      1127535366
VRL398       4948       147671027
VRL399       37836      1126567483
VRL4         204160     233127006
VRL40        25118      663967751
VRL400       30530      908724895
VRL401       37853      1126033212
VRL402       9402       280228621
VRL403       37824      1127171611
VRL404       2984       88807861
VRL405       37488      1117304491
VRL406       7726       230243891
VRL407       37941      1129305563
VRL408       37532      1120445998
VRL409       1997       59668580
VRL41        3558       86379552
VRL410       37597      1124750543
VRL411       7196       214942299
VRL412       36501      1085327765
VRL413       17277      515643148
VRL414       37644      1124295123
VRL415       16185      483323509
VRL416       37607      1123409112
VRL417       25114      750053377
VRL418       37125      1108729574
VRL419       10553      315107198
VRL42        26194      663182503
VRL420       37302      1115666751
VRL421       4990       149019167
VRL422       36729      1102119676
VRL423       4057       115151724
VRL424       38007      1099550726
VRL425       22700      657113389
VRL426       36233      1080568498
VRL427       20238      604653619
VRL428       36126      1079468132
VRL429       6493       194076254
VRL43        4328       101944484
VRL430       36442      1089136069
VRL431       3660       109381809
VRL432       36355      1085843904
VRL433       36149      1079760964
VRL434       2736       81726358
VRL435       36514      1090498832
VRL436       36471      1088861655
VRL437       2690       80317374
VRL438       36498      1089640784
VRL439       36485      1089316635
VRL44        29984      666877316
VRL440       4058       121149887
VRL441       36480      1089187037
VRL442       20291      605840055
VRL443       36692      1094502133
VRL444       20044      597880417
VRL445       37103      1105397042
VRL446       24055      717589519
VRL447       37470      1114694532
VRL448       13938      413639342
VRL449       38145      1132689212
VRL45        3451       91141747
VRL450       3923       116515899
VRL451       38113      1131951323
VRL452       8619       255935606
VRL453       38110      1131479978
VRL454       6988       207482376
VRL455       38120      1132052489
VRL456       11014      327172908
VRL457       38163      1132954792
VRL458       16013      428292237
VRL459       36504      1089824880
VRL46        30882      661771962
VRL460       14633      436963840
VRL461       36465      1089798277
VRL462       9067       270816317
VRL463       36634      1094347090
VRL464       16099      480946357
VRL465       36585      1092939862
VRL466       26936      804680772
VRL467       36579      1092745835
VRL468       19701      588548265
VRL469       36409      1087850765
VRL47        3927       112530241
VRL470       7691       229888754
VRL471       36081      1076074075
VRL472       28426      846960086
VRL473       36019      1068363395
VRL474       4444       132299980
VRL475       36633      1089995904
VRL476       23595      696576942
VRL477       37531      1120499182
VRL478       19177      572789700
VRL479       36329      1085562659
VRL48        24802      665944663
VRL480       26285      785357524
VRL481       35888      1072345405
VRL482       4109       122793098
VRL483       39032      1088756013
VRL484       4213       123289782
VRL485       39151      1092596317
VRL486       21876      606114024
VRL487       27208      668339779
VRL488       6782       180361510
VRL489       25964      671616295
VRL49        8275       198201474
VRL490       4268       120925526
VRL491       28113      669243590
VRL492       3041       62167235
VRL493       43669      655198029
VRL494       5435       69370841
VRL495       47375      649420172
VRL496       9074       65241280
VRL497       26227      670525319
VRL498       13735      66657146
VRL499       61633      639399229
VRL5         280540     596133023
VRL50        23424      665657614
VRL500       40583      121682196
VRL51        2191       65297472
VRL52        26410      663489762
VRL53        7941       227472348
VRL54        23414      659312050
VRL55        3877       115050329
VRL56        23459      666498757
VRL57        7604       224410146
VRL58        24455      660244246
VRL59        12870      379798658
VRL6         23485      82588249
VRL60        37083      1108550266
VRL61        30424      909649509
VRL62        37114      1109250740
VRL63        8058       240802925
VRL64        37139      1109667181
VRL65        5932       176025665
VRL66        23342      665139591
VRL67        2947       83685526
VRL68        23434      666365700
VRL69        13040      336264336
VRL7         253022     337221008
VRL70        22381      659575407
VRL71        3638       104774809
VRL72        23042      660595591
VRL73        11913      342221608
VRL74        22812      660547330
VRL75        11733      323111289
VRL76        22415      662597999
VRL77        5272       151310692
VRL78        22659      662437788
VRL79        1998       59113996
VRL8         248767     410111496
VRL80        22836      664299533
VRL81        2347       68539361
VRL82        23853      668562404
VRL83        7629       218240519
VRL84        22604      662478335
VRL85        8047       225950637
VRL86        22724      664920515
VRL87        2635       78589590
VRL88        22494      660735890
VRL89        11922      342043890
VRL9         237501     450889113
VRL90        24307      666168961
VRL91        11967      342780598
VRL92        23312      667704534
VRL93        14252      363117989
VRL94        24206      666022023
VRL95        11654      345441201
VRL96        24197      667442447
VRL97        12113      342896632
VRL98        22579      662522993
VRL99        12505      349482081
VRT1         151992     879089965
VRT10        1171       26255719
VRT100       226        1172298670
VRT101       6          287514912
VRT102       21         1147858523
VRT103       8          396461523
VRT104       20         1173136487
VRT105       40         408449657
VRT106       21         1168748140
VRT107       6          417779009
VRT108       18         1151861742
VRT109       8          407907477
VRT11        293        13983146
VRT110       23         1107646329
VRT111       13         713326122
VRT112       23         1144234985
VRT113       9          420614896
VRT114       134        1180161953
VRT115       79         1025790260
VRT116       1          843366180
VRT117       1          842558404
VRT118       1          707956555
VRT119       1          635713434
VRT12        62         1165207373
VRT120       2          1006930617
VRT121       6          953838719
VRT122       1          690654357
VRT123       2          1036857559
VRT124       1          481763206
VRT125       4          1057207450
VRT126       35         773383371
VRT127       4329       1156513083
VRT128       16002      459253055
VRT129       420832     391734084
VRT13        11         316368323
VRT130       7800       9038790
VRT131       384549     422711122
VRT132       57741      115644000
VRT133       67         1170083182
VRT134       5          206181523
VRT135       47         1183370565
VRT136       7          243122995
VRT137       23         1181318093
VRT138       23         251314286
VRT139       405        1094560939
VRT14        42         1131640503
VRT140       4          347682430
VRT141       54         1154458892
VRT142       10         313635714
VRT143       43         1146391866
VRT144       5          240249405
VRT145       31         1184009833
VRT146       15         299492187
VRT147       28         1054983542
VRT148       13         348062730
VRT149       94         852284325
VRT15        51         1151263002
VRT150       2          696540660
VRT151       4          904864528
VRT152       33         731071093
VRT153       37         1164742986
VRT154       36         528124428
VRT155       37         1123854199
VRT156       9          481951495
VRT157       156        1183779024
VRT158       6          312654085
VRT159       1589       1155278298
VRT16        1          25018904
VRT160       64         1040389365
VRT161       5          1114313003
VRT162       20         655696990
VRT163       32         1165038142
VRT164       10         359729387
VRT165       37         977985462
VRT166       3          346034432
VRT167       12         843150289
VRT168       91         688705431
VRT169       43         1161336176
VRT17        21         1144265373
VRT170       12         337935768
VRT171       33         1177732884
VRT172       10         315490636
VRT173       29         1133415830
VRT174       19         985076759
VRT175       13         1094615957
VRT176       1          168556870
VRT177       302        1175670063
VRT178       22         599394507
VRT179       42         1159071038
VRT18        11         861785425
VRT180       12         363275175
VRT181       38         1157829262
VRT182       17         1062116002
VRT183       43         1173707836
VRT184       29         886034587
VRT185       55         1165077059
VRT186       8          313502651
VRT187       30         1158773265
VRT188       18         307245863
VRT189       11         1125864671
VRT19        37         1039301283
VRT190       6          320509967
VRT191       37         1160120295
VRT192       11         302784051
VRT193       26         986334395
VRT194       4          443026194
VRT195       53         1177747146
VRT196       16         515509915
VRT197       24         1145214277
VRT198       20         842461686
VRT199       39         1152236201
VRT2         3          141387178
VRT20        2          394160013
VRT200       5          287434963
VRT201       28         1173216529
VRT202       19         516043856
VRT203       30         1178674121
VRT204       19         723703127
VRT205       44         1152763700
VRT206       13         540214668
VRT207       17         1143715445
VRT208       18         1174563204
VRT209       16         342884613
VRT21        30         1168492153
VRT210       27         1175110025
VRT211       23         1166697769
VRT212       8          219831677
VRT213       48         1160289310
VRT214       18         759308542
VRT215       23         1171047943
VRT216       10         534818626
VRT217       36         1182736379
VRT218       16         567153184
VRT219       28         1134330417
VRT22        29         742092719
VRT220       303        755315061
VRT221       38         1165356567
VRT222       8          214956194
VRT223       51         1172310789
VRT224       31         991676973
VRT225       2          484884812
VRT226       6          1101564199
VRT227       5          549920900
VRT228       21         1018602957
VRT229       1          218912229
VRT23        30         1174531068
VRT230       38         1176533902
VRT231       7          517093999
VRT232       20         1141381288
VRT233       16         736377496
VRT234       15         1167658288
VRT235       26         287064166
VRT236       37         1177840384
VRT237       14         728760872
VRT238       40         1171007353
VRT239       2          181314551
VRT24        40         778567113
VRT240       43         1178099053
VRT241       11         1013144776
VRT242       6          1099894888
VRT243       4          531276777
VRT244       13         1174401695
VRT245       6          321859036
VRT246       22         1163106414
VRT247       34         516457854
VRT248       31         1159946079
VRT249       29         737532156
VRT25        147        10842596
VRT250       150        1081754494
VRT251       19         1093025330
VRT252       6          295537066
VRT253       43         1171949486
VRT254       37         796605274
VRT255       40         1107875829
VRT256       15         1063299345
VRT257       13         1138287802
VRT258       16         1105290063
VRT259       15         1130244137
VRT26        586        15797052
VRT260       15         1036912531
VRT261       41         1159354291
VRT262       35304      1103421015
VRT27        2343       67436863
VRT28        231773     799599927
VRT29        18385      13493823
VRT3         31         1168751005
VRT30        201992     813214419
VRT31        31         452289725
VRT32        196759     156490806
VRT33        335335     229992764
VRT34        176839     120754439
VRT35        133023     105741590
VRT36        298628     205468986
VRT37        291757     181465675
VRT38        327268     606042895
VRT39        95677      1060886498
VRT4         30955      1101865239
VRT40        145106     21008965
VRT41        75789      25336814
VRT42        13711      1164642593
VRT43        6492       595515114
VRT44        6958       1164949634
VRT45        18         646516563
VRT46        48         1183553258
VRT47        227        233550951
VRT48        39         902622871
VRT49        3          1023379555
VRT5         74952      70629379
VRT50        2          589523540
VRT51        6          1150383114
VRT52        2          310907973
VRT53        24         1179751921
VRT54        13         344051702
VRT55        43         1172808323
VRT56        20         319354703
VRT57        1          839681426
VRT58        1          825560060
VRT59        2          1082779519
VRT6         37396      74041240
VRT60        2          758561446
VRT61        6          1178831395
VRT62        19         1164471784
VRT63        1          46063367
VRT64        22         1169870462
VRT65        332        504305975
VRT66        49         1183118178
VRT67        3          26813209
VRT68        1          772932187
VRT69        1          662004353
VRT7         18698      27611025
VRT70        2          911653698
VRT71        1          364230008
VRT72        4          1133578097
VRT73        493        875502265
VRT74        28         1159189661
VRT75        1          81199652
VRT76        27         1178866037
VRT77        2          65038611
VRT78        24         1169138155
VRT79        4          106598356
VRT8         9349       597580446
VRT80        29         755437537
VRT81        41         289507176
VRT82        35         926559538
VRT83        2          1080114977
VRT84        3          1012738546
VRT85        2          458353277
VRT86        11         1181336336
VRT87        462        807789205
VRT88        10         1126531868
VRT89        3          244017515
VRT9         4685       4674270
VRT90        624        928535178
VRT91        1          313568160
VRT92        4          1044936093
VRT93        3          637611209
VRT94        6          1049980901
VRT95        3          425844009
VRT96        38         1127532336
VRT97        6          357716939
VRT98        23         1143934087
VRT99        18         187861254

2.2.7 Selected Per-Organism Statistics 

  The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 261.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:

Entries        Bases   Species

8849611 263280740770   Severe acute respiratory syndrome coronavirus 2
1943950 255975379562   Triticum aestivum
111961  205666444201   Hordeum vulgare
1347585 126087260773   Hordeum vulgare subsp. vulgare
520     106587373982   Hordeum bulbosum
164      93011095388   Viscum album
29876    92980158773   Hordeum vulgare subsp. spontaneum
10049258 43637339408   Mus musculus
27810338 36825525087   Homo sapiens
175081   24021381303   Escherichia coli
29811    21128005736   Avena sativa
2640663  20263158983   Arabidopsis thaliana
33665    16333452591   Klebsiella pneumoniae
2243780  16210185539   Bos taurus
1732296  13758456861   Danio rerio
312035   13104402122   Arachis hypogaea
195      11554711366   Sambucus nigra
28766    11286173222   Vicia faba
14812    10342955730   Triticum monococcum
23130     9981582961   Triticum turgidum subsp. durum

2.2.8 Growth of GenBank

  The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.

  From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.

Release      Date     Base Pairs   Entries

    3    Dec 1982         680338       606
   14    Nov 1983        2274029      2427
   20    May 1984        3002088      3665
   24    Sep 1984        3323270      4135
   25    Oct 1984        3368765      4175
   26    Nov 1984        3689752      4393
   32    May 1985        4211931      4954
   36    Sep 1985        5204420      5700
   40    Feb 1986        5925429      6642
   42    May 1986        6765476      7416
   44    Aug 1986        8442357      8823
   46    Nov 1986        9615371      9978
   48    Feb 1987       10961380     10913
   50    May 1987       13048473     12534
   52    Aug 1987       14855145     14020
   53    Sep 1987       15514776     14584
   54    Dec 1987       16752872     15465
   55    Mar 1988       19156002     17047
   56    Jun 1988       20795279     18226
   57    Sep 1988       22019698     19044
   57.1  Oct 1988       23800000     20579
   58    Dec 1988       24690876     21248
   59    Mar 1989       26382491     22479
   60    Jun 1989       31808784     26317
   61    Sep 1989       34762585     28791
   62    Dec 1989       37183950     31229
   63    Mar 1990       40127752     33377
   64    Jun 1990       42495893     35100
   65    Sep 1990       49179285     39533
   66    Dec 1990       51306092     41057
   67    Mar 1991       55169276     43903
   68    Jun 1991       65868799     51418
   69    Sep 1991       71947426     55627
   70    Dec 1991       77337678     58952
   71    Mar 1992       83894652     65100
   72    Jun 1992       92160761     71280
   73    Sep 1992      101008486     78608
   74    Dec 1992      120242234     97084
   75    Feb 1993      126212259    106684
   76    Apr 1993      129968355    111911
   77    Jun 1993      138904393    120134
   78    Aug 1993      147215633    131328
   79    Oct 1993      157152442    143492
   80    Dec 1993      163802597    150744
   81    Feb 1994      173261500    162946
   82    Apr 1994      180589455    169896
   83    Jun 1994      191393939    182753
   84    Aug 1994      201815802    196703
   85    Oct 1994      217102462    215273
   86    Dec 1994      230485928    237775
   87    Feb 1995      248499214    269478
   88    Apr 1995      286094556    352414
   89    Jun 1995      318624568    425211
   90    Aug 1995      353713490    492483
   91    Oct 1995      384939485    555694
   92    Dec 1995      425860958    620765
   93    Feb 1996      463758833    685693
   94    Apr 1996      499127741    744295
   95    Jun 1996      551750920    835487
   96    Aug 1996      602072354    920588
   97    Oct 1996      651972984    1021211
   98    Dec 1996      730552938    1114581
   99    Feb 1997      786898138    1192505
   100   Apr 1997      842864309    1274747
   101   Jun 1997      966993087    1491069
   102   Aug 1997     1053474516    1610848
   103   Oct 1997     1160300687    1765847
   104   Dec 1997     1258290513    1891953
   105   Feb 1998     1372368913    2042325
   106   Apr 1998     1502542306    2209232
   107   Jun 1998     1622041465    2355928
   108   Aug 1998     1797137713    2532359
   109   Oct 1998     2008761784    2837897
   110   Dec 1998     2162067871    3043729
   111   Apr 1999     2569578208    3525418
   112   Jun 1999     2974791993    4028171
   113   Aug 1999     3400237391    4610118
   114   Oct 1999     3841163011    4864570
   115   Dec 1999     4653932745    5354511
   116   Feb 2000     5805414935    5691170
   117   Apr 2000     7376080723    6215002
   118   Jun 2000     8604221980    7077491
   119   Aug 2000     9545724824    8214339
   120   Oct 2000    10335692655    9102634
   121   Dec 2000    11101066288    10106023
   122   Feb 2001    11720120326    10896781
   123   Apr 2001    12418544023    11545572
   124   Jun 2001    12973707065    12243766
   125   Aug 2001    13543364296    12813516
   126   Oct 2001    14396883064    13602262
   127   Dec 2001    15849921438    14976310
   128   Feb 2002    17089143893    15465325
   129   Apr 2002    19072679701    16769983
   130   Jun 2002    20648748345    17471130
   131   Aug 2002    22616937182    18197119
   132   Oct 2002    26525934656    19808101
   133   Dec 2002    28507990166    22318883
   134   Feb 2003    29358082791    23035823
   135   Apr 2003    31099264455    24027936
   136   Jun 2003    32528249295    25592865
   137   Aug 2003    33865022251    27213748
   138   Oct 2003    35599621471    29819397
   139   Dec 2003    36553368485    30968418
   140   Feb 2004    37893844733    32549400
   141   Apr 2004    38989342565    33676218
   142   Jun 2004    40325321348    35532003
   143   Aug 2004    41808045653    37343937
   144   Oct 2004    43194602655    38941263
   145   Dec 2004    44575745176    40604319
   146   Feb 2005    46849831226    42734478
   147   Apr 2005    48235738567    44202133
   148   Jun 2005    49398852122    45236251
   149   Aug 2005    51674486881    46947388
   150   Oct 2005    53655236500    49152445
   151   Dec 2005    56037734462    52016762
   152   Feb 2006    59750386305    54584635
   153   Apr 2006    61582143971    56620500
   154   Jun 2006    63412609711    58890345
   155   Aug 2006    65369091950    61132599
   156   Oct 2006    66925938907    62765195
   157   Dec 2006    69019290705    64893747
   158   Feb 2007    71292211453    67218344
   159   Apr 2007    75742041056    71802595
   160   Jun 2007    77248690945    73078143
   161   Aug 2007    79525559650    76146236
   162   Oct 2007    81563399765    77632813
   163   Dec 2007    83874179730    80388382
   164   Feb 2008    85759586764    82853685
   165   Apr 2008    89172350468    85500730
   166   Jun 2008    92008611867    88554578
   167   Aug 2008    95033791652    92748599
   168   Oct 2008    97381682336    96400790
   169   Dec 2008    99116431942    98868465
   170   Feb 2009   101467270308   101815678
   171   Apr 2009   102980268709   103335421
   172   Jun 2009   105277306080   106073709
   173   Aug 2009   106533156756   108431692
   174   Oct 2009   108560236506   110946879
   175   Dec 2009   110118557163   112910950
   176   Feb 2010   112326229652   116461672
   177   Apr 2010   114348888771   119112251
   178   Jun 2010   115624497715   120604423
   179   Aug 2010   117476523128   122941883
   180   Oct 2010   118551641086   125764384
   181   Dec 2010   122082812719   129902276
   182   Feb 2011   124277818310   132015054
   183   Apr 2011   126551501141   135440924
   184   Jun 2011   129178292958   140482268
   185   Aug 2011   130671233801   142284608
   186   Oct 2011   132067413372   144458648
   187   Dec 2011   135117731375   146413798
   188   Feb 2012   137384889783   149819246
   189   Apr 2012   139266481398   151824421
   190   Jun 2012   141343240755   154130210
   191   Aug 2012   143081765233   156424033
   192   Oct 2012   145430961262   157889737
   193   Dec 2012   148390863904   161140325
   194   Feb 2013   150141354858   162886727
   195   Apr 2013   151178979155   164136731
   196   Jun 2013   152599230112   165740164
   197   Aug 2013   154192921011   167295840
   198   Oct 2013   155176494699   168335396
   199   Dec 2013   156230531562   169331407
   200   Feb 2014   157943793171   171123749
   201   Apr 2014   159813411760   171744486
   202   Jun 2014   161822845643   173353076
   203   Aug 2014   165722980375   174108750
   204   Oct 2014   181563676918   178322253
   205   Dec 2014   184938063614   179295769
   206   Feb 2015   187893826750   181336445
   207   Apr 2015   189739230107   182188746
   208   Jun 2015   193921042946   185019352
   209   Aug 2015   199823644287   187066846
   210   Oct 2015   202237081559   188372017
   211   Dec 2015   203939111071   189232925
   212   Feb 2016   207018196067   190250235
   213   Apr 2016   211423912047   193739511
   214   Jun 2016   213200907819   194463572
   215   Aug 2016   217971437647   196120831
   216   Oct 2016   220731315250   197390691
   217   Dec 2016   224973060433   198565475
   218   Feb 2017   228719437638   199341377
   219   Apr 2017   231824951552   200877884
   220   Jun 2017   234997362623   201663568
   221   Aug 2017   240343378258   203180606
   222   Oct 2017   244914705468   203953682
   223   Dec 2017   249722163594   206293625
   224   Feb 2018   253630708098   207040555
   225   Apr 2018   260189141631   208452303
   226   Jun 2018   263957884539   209775348
   227   Aug 2018   260806936411   208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
   228   Oct 2018   279668290132   209656636
   229   Dec 2018   285688542186   211281415
   230   Feb 2019   303709510632   212260377
   231   Apr 2019   321680566570   212775414
   232   Jun 2019   329835282370   213383758
   233   Aug 2019   366733917629   213865349
   234   Oct 2019   386197018538   216763706
   235   Dec 2019   388417258009   215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
   236   Feb 2020   399376854872   216214215
   237   Apr 2020   415770027949   216531829
   238   Jun 2020   427823258901   217122233
   239   Aug 2020   654057069549   218642238
   240   Oct 2020   698688094046   219055207
   241   Dec 2020   723003822007   221467827
   242   Feb 2021   776291211106   226241476
   243   Apr 2021   832400799511   227123201
   244   Jun 2021   866009790959   227888889
   245   Aug 2021   940513260726   231982592
   246   Oct 2021  1014763752113   233642893
   247   Dec 2021  1053275115030   234557297
   248   Feb 2022  1173984081721   236338284
   249   Apr 2022  1266154890918   237520318
   250   Jun 2022  1395628631187   239017893
   251   Aug 2022  1492800704497   239915786
   252   Oct 2022  1562963366851   240539282
   253   Dec 2022  1635594138493   241015745
   254   Feb 2023  1731302248418   241830635
   255   Apr 2023  1826746318813   242554936
   256   Jun 2023  1966479976146   243560863
   257   Aug 2023  2112058517945   246119175
   258   Oct 2023  2433391164875   247777761
   259   Dec 2023  2570711588044   249060436
   n/a   Feb 2024  n/a             n/a         No GenBank Release delivered in Feb 2024
   260   Apr 2024  3213818003787   250803006
   261   Jun 2024  3387240663231   251094334
   
  The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously 
available in the WGS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
	  ftp://ftp.ncbi.nih.gov/genbank/wgs

Release      Date     Base Pairs     Entries

  129    Apr 2002      692266338      172768
  130    Jun 2002     3267608441      397502
  131    Aug 2002     3848375582      427771
  132    Oct 2002     3892435593      434224
  133    Dec 2002     6702372564      597042
  134    Feb 2003     6705740844      597345
  135    Apr 2003     6897080355      596818
  136    Jun 2003     6992663962      607155
  137    Aug 2003     7144761762      593801
  138    Oct 2003     8662242833     1683437
  139    Dec 2003    14523454868     2547094
  140    Feb 2004    22804145885     3188754
  141    Apr 2004    24758556215     4112532
  142    Jun 2004    25592758366     4353890
  143    Aug 2004    28128611847     4427773
  144    Oct 2004    30871590379     5285276
  145    Dec 2004    35009256228     5410415
  146    Feb 2005    38076300084     6111782
  147    Apr 2005    39523208346     6685746
  148    Jun 2005    46767232565     8711924
  149    Aug 2005    53346605784    10276161
  150    Oct 2005    56162807647    11169448
  151    Dec 2005    59638900034    12088491
  152    Feb 2006    63183065091    12465546
  153    Apr 2006    67488612571    13573144
  154    Jun 2006    78858635822    17733973
  155    Aug 2006    80369977826    17960667
  156    Oct 2006    81127502509    18500772
  157    Dec 2006    81611376856    18540918
  158    Feb 2007    86043478524    19421576
  159    Apr 2007    93022691867    23446831
  160    Jun 2007    97102606459    23718400
  161    Aug 2007   101964323738    25384475
  162    Oct 2007   102003045298    25354041
  163    Dec 2007   106505691578    26177471
  164    Feb 2008   108635736141    27439206
  165    Apr 2008   110500961400    26931049
  166    Jun 2008   113639291344    39163548
  167    Aug 2008   118593509342    40214247
  168    Oct 2008   136085973423    46108952
  169    Dec 2008   141374971004    48394838
  170    Feb 2009   143797800446    49036947
  171    Apr 2009   144522542010    48948309
  172    Jun 2009   145959997864    49063546
  173    Aug 2009   148165117763    48443067
  174    Oct 2009   149348923035    48119301
  175    Dec 2009   158317168385    54076973
  176    Feb 2010   163991858015    57134273
  177    Apr 2010   165536009514    58361599
  178    Jun 2010   167725292032    58592700
  179    Aug 2010   169253846128    58994334
  180    Oct 2010   175339059129    59397637
  181    Dec 2010   177385297156    59608311
  182    Feb 2011   190034462797    62349795
  183    Apr 2011   191401393188    62715288
  184    Jun 2011   200487078184    63735078
  185    Aug 2011   208315831132    64997137
  186    Oct 2011   218666368056    68330215
  187    Dec 2011   239868309609    73729553
  188    Feb 2012   261370512675    78656704
  189    Apr 2012   272693351548    80905298
  190    Jun 2012   287577367116    82076779
  191    Aug 2012   308196411905    84020064
  192    Oct 2012   333881846451    86480509
  193    Dec 2012   356002922838    92767765
  194    Feb 2013   390900990416   103101291
  195    Apr 2013   418026593606   110509314
  196    Jun 2013   453829752320   112488036
  197    Aug 2013   500420412665   124812020
  198    Oct 2013   535842167741   130203205
  199    Dec 2013   556764321498   133818570
  200    Feb 2014   591378698544   139725795
  201    Apr 2014   621015432437   143446790
  202    Jun 2014   719581958743   175779064
  203    Aug 2014   774052098731   189080419
  204    Oct 2014   805549167708   196049974
  205    Dec 2014   848977922022   200301550
  206    Feb 2015   873281414087   205465046
  207    Apr 2015   969102906813   243779199
  208    Jun 2015  1038937210221   258702138
  209    Aug 2015  1163275601001   302955543
  210    Oct 2015  1222635267498   309198943
  211    Dec 2015  1297865618365   317122157
  212    Feb 2016  1399865495608   333012760
  213    Apr 2016  1452207704949   338922537
  214    Jun 2016  1556175944648   350278081
  215    Aug 2016  1637224970324   359796497
  216    Oct 2016  1676238489250   363213315
  217    Dec 2016  1817189565845   395301176
  218    Feb 2017  1892966308635   409490397
  219    Apr 2017  2035032639807   451840147
  220    Jun 2017  2164683993369   487891767
  221    Aug 2017  2242294609510   499965722
  222    Oct 2017  2318156361999   508825331
  223    Dec 2017  2466098053327   551063065
  224    Feb 2018  2608532210351   564286852
  225    Apr 2018  2784740996536   621379029
  226    Jun 2018  2944617324086   639804105
  227    Aug 2018  3204855013281   665309765
  228    Oct 2018  3444172142207   722438528
  229    Dec 2018  3656719423096   773773190
  230    Feb 2019  4164513961679   945019312
  231    Apr 2019  4421986382065   993732214
  232    Jun 2019  4847677297950  1022913321
  233    Aug 2019  5585922333160  1075272215
  234    Oct 2019  5985250251028  1097629174
  235    Dec 2019  6277551200690  1127023870
  236    Feb 2020  6968991265752  1206720688
  237    Apr 2020  7788133221338  1267547429
  238    Jun 2020  8114046262158  1302852615
  239    Aug 2020  8841649410652  1408122887
  240    Oct 2020  9215815569509  1432874252
  241    Dec 2020 11830842428018  1517995689
  242    Feb 2021 12270717209612  1563938043
  243    Apr 2021 12732048052023  1590670459
  244    Jun 2021 13442974346437  1632796606
  245    Aug 2021 13888187863722  1653427055
  246    Oct 2021 14599101574547  1721064101
  247    Dec 2021 14922033922302  1734664952
  248    Feb 2022 15428122140820  1750505007
  249    Apr 2022 16071520702170  1781374217
  250    Jun 2022 16710373006600  1796349114
  251    Aug 2022 17511809676629  2024099677
  252    Oct 2022 18231960808828  2167900306
  253    Dec 2022 19086596616569  2241439349
  254    Feb 2023 20116642176263  2337838461
  255    Apr 2023 20926504760221  2440470464
  256    Jun 2023 21791125594114  2611654455
  257    Aug 2023 22294446104543  2631493489
  258    Oct 2023 23600199887231  2775205599
  259    Dec 2023 24651580464335  2863228552
  n/a    Feb 2024 n/a             n/a         No GenBank Release delivered in Feb 2024
  260    Apr 2024 27225116587937  3333621823
  261    Jun 2024 27900199328333  3380877515

  The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.

  TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).

  Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.

  Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
	  ftp://ftp.ncbi.nih.gov/genbank/tsa

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.

  Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.

  Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  201    Apr 2014    23632325832    29734989
  202    Jun 2014    31707343431    38011942
  203    Aug 2014    33676182560    40556905
  204    Oct 2014    36279458440    43567759
  205    Dec 2014    46056420903    62635617
  206    Feb 2015    49765340047    66706014
  207    Apr 2015    55796332435    71989588
  208    Jun 2015    60697472570    76974601
  209    Aug 2015    69360654413    87827013
  210    Oct 2015    70917172944    81790031
  211    Dec 2015    77583339176    87488539
  212    Feb 2016    81932555094    92132318
  213    Apr 2016    87811163676    98147566
  214    Jun 2016    94413958919   104677061
  215    Aug 2016   103399742586   113179607
  216    Oct 2016   113209225762   124199597
  217    Dec 2016   125328824508   142094337
  218    Feb 2017   133517212104   151431485
  219    Apr 2017   149038907599   165068542
  220    Jun 2017   158112969073   176812130
  221    Aug 2017   167045663417   186777106
  222    Oct 2017   172909268535   192754804
  223    Dec 2017   181394660188   201559502
  224    Feb 2018   193940551226   214324264
  225    Apr 2018   205232396043   227364990
  226    Jun 2018   216556686631   238788334
  227    Aug 2018   225520004678   249295386
  228    Oct 2018   235875573598   259927414
  229    Dec 2018   248592892188   274845473
  230    Feb 2019   263936885705   294772430
  231    Apr 2019   277118019688   311247136
  232    Jun 2019   285390240861   319927264
  233    Aug 2019   294727165179   331347807
  234    Oct 2019   305371891408   342811151
  235    Dec 2019   325433016129   367193844
  236    Feb 2020   340994289065   386644871
  237    Apr 2020   349692751528   396392280
  238    Jun 2020   359947709062   409725050
  239    Aug 2020   366968951160   417524567
  240    Oct 2020   382996662270   435968379
  241    Dec 2020   392206975386   446397378
  242    Feb 2021   407605409948   463151000
  243    Apr 2021   425076483459   481154920
  244    Jun 2021   436594941165   494641358
  245    Aug 2021   440578422611   498305045
  246    Oct 2021   449891016597   508319391
  247    Dec 2021   455870853358   514158576
  248    Feb 2022   465013156502   524464601
  249    Apr 2022   474421076448   534770586
  250    Jun 2022   485056129761   546991572
  251    Aug 2022   497501380386   560196830
  252    Oct 2022   511476787957   574020080
  253    Dec 2022   611850391049   649918843
  254    Feb 2023   630615054587   672261981
  255    Apr 2023   636291358227   678332682
  256    Jun 2023   643127590034   683922756
  257    Aug 2023   646176166908   686271945
  258    Oct 2023   659924904311   701336089
  259    Dec 2023   668807109326   715803123
  n/a    Feb 2024   n/a            n/a         No GenBank Release delivered in Feb 2024
  260    Apr 2024   689648317082   741066498
  261    Jun 2024   695405769319   746753803

  The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.

  Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:

	  ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
	  ftp://ftp.ncbi.nih.gov/genbank/tls

  Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.

  Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.

Release      Date     Base Pairs     Entries

  217    Dec 2016      584697919     1268690
  218    Feb 2017      636923295     1438349
  219    Apr 2017      636923295     1438349  (unchanged)
  220    Jun 2017      824191338     1628475
  221    Aug 2017      824191338     1628475  (unchanged)
  222    Oct 2017     2993818315     9479460
  223    Dec 2017     4458042616    12695198
  224    Feb 2018     4531966831    12819978
  225    Apr 2018     5612769448    14782654
  226    Jun 2018     5896511468    15393041
  227    Aug 2018     6077824493    15822538
  228    Oct 2018     8435112913    20752288
  229    Dec 2018     8511829281    20924588
  230    Feb 2019     9146836085    23259929
  231    Apr 2019     9623321565    24240761
  232    Jun 2019    10182427815    25530139
  233    Aug 2019    10531800829    26363945
  234    Oct 2019    10848455369    27460978
  235    Dec 2019    11280596614    28227180
  236    Feb 2020    13669678196    34037371
  237    Apr 2020    24615270313    65521132
  238    Jun 2020    27500635128    75063181
  239    Aug 2020    27825059498    75682157
  240    Oct 2020    28814798868    78177358
  241    Dec 2020    33036509446    88039152
  242    Feb 2021    33634122995    90130561
  243    Apr 2021    37998534461   102395753
  244    Jun 2021    38198113354   102662929
  245    Aug 2021    39930167315   106995218
  246    Oct 2021    40168874815   107569935
  247    Dec 2021    41143480750   109379021
  248    Feb 2022    41321107981   109809966
  249    Apr 2022    41324192343   109820387
  250    Jun 2022    41999358847   111142107
  251    Aug 2022    43852280645   115103527
  252    Oct 2022    43860512749   115123306
  253    Dec 2022    44009657455   115552377
  254    Feb 2023    46465508548   121067644
  255    Apr 2023    46567924833   121186672
  256    Jun 2023    47302831210   122798571
  257    Aug 2023    48289699026   124421006
  258    Oct 2023    50868407906   130654568
  259    Dec 2023    51568356978   132355132
  n/a    Feb 2024    n/a           n/a         No GenBank Release delivered in Feb 2024
  260    Apr 2024    53492243256   135115766
  261    Jun 2024    54512778803   135446337

3. FILE FORMATS

  The flat file examples included in this section, while not always from the
current release, are usually fairly recent.  Any differences compared to the
actual records are the result of updates to the entries involved.

3.1 File Header Information

  With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.

  The second line contains the date of the current release in the form
`day month year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ          Genetic Sequence Data Bank
                          June 15 2024

                NCBI-GenBank Flat File Release 261.0

                     Bacterial Sequences (Part 1)

  102016 loci,   184379131 bases, from   102016 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 1. Sample File Header

3.4 Sequence Entry Files

  GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.

3.4.1 File Organization

  Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).

3.4.2  Entry Organization

  In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:

1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).

2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).

3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.

4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.

5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.

6. Two slashes (//) in positions 1 and 2, marking the end of an entry.

  The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.

  The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.

LOCUS	- A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.

DEFINITION	- A concise description of the sequence. Mandatory
keyword/one or more records.

ACCESSION	- The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.

VERSION		- A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.

  NOTE : Presentation of GI sequence identifiers in the GenBank
  flatfile format was discontinued as of March 2017.

NID		- An alternative method of presenting the NCBI GI
identifier (described above).

  NOTE: The NID linetype is obsolete and was removed from the
  GenBank flatfile format in December 1999.

PROJECT		- The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.

  NOTE: The PROJECT linetype is obsolete and was removed from the
  GenBank flatfile format after Release 171.0 in April 2009.

DBLINK		- Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.

KEYWORDS	- Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.

SEGMENT	- Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

SOURCE	- Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.

   ORGANISM	- Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.

   In the event that the organism name exceeds 68 characters (80 - 13 + 1)
   in length, it will be line-wrapped and continue on a second line,
   prior to the taxonomic classification. Unfortunately, very long 
   organism names were not anticipated when the fixed-length GenBank
   flatfile format was defined in the 1980s. The possibility of linewraps
   makes the job of flatfile parsers more difficult : essentially, one
   cannot be sure that the second line is truly a classification/lineage
   unless it consists of multiple tokens, delimited by semi-colons.
   The long-term solution to this problem is to introduce an additional
   subkeyword, possibly 'LINEAGE'. But because changes like this can be
   very disruptive for customers, implementation has not yet been scheduled.

REFERENCE	- Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.

   AUTHORS	- Lists the authors of the citation. Optional
subkeyword/one or more records.

   CONSRTM	- Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.

   TITLE	- Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.

   JOURNAL	- Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.

   MEDLINE	- Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.

   NOTE: The MEDLINE linetype is obsolete and was removed
   from the GenBank flatfile format in April 2005.

    PUBMED 	- Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.

   REMARK	- Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.

COMMENT	- Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.

FEATURES	- Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.

BASE COUNT	- Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record. 

   NOTE: The BASE COUNT linetype is obsolete and was removed
   from the GenBank flatfile format in October 2003.

CONTIG	- This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.

As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.

ORIGIN	- Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.

	- The ORIGIN line is followed by sequence data (multiple records).

// 	- Entry termination symbol. Mandatory at the end of an
entry/exactly one record.

3.4.3 Sample Sequence Data File

  An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ          Genetic Sequence Data Bank
                         December 15 1992

                 GenBank Flat File Release 74.0

                     Structural RNA Sequences

      2 loci,       236 bases, from     2 reported sequences

LOCUS       AAURRA        118 bp ss-rRNA            RNA       16-JUN-1986
DEFINITION  A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION   K03160
VERSION     K03160.1
KEYWORDS    5S ribosomal RNA; ribosomal RNA.
SOURCE      A.auricula-judae (mushroom) ribosomal RNA.
  ORGANISM  Auricularia auricula-judae
            Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
            Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
  TITLE     The nucleotide sequences of the 5S rRNAs of four mushrooms and
            their use in studying the phylogenetic position of basidiomycetes
            among the eukaryotes
  JOURNAL   Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     34 c     34 g     23 t
ORIGIN      5' end of mature rRNA.
        1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
       61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS       ABCRRAA       118 bp ss-rRNA            RNA       15-SEP-1990
DEFINITION  Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION   M34766
VERSION     M34766.1
KEYWORDS    5S ribosomal RNA.
SOURCE      Acetobacter sp. (strain MB 58) rRNA.
  ORGANISM  Acetobacter sp.
            Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
            Azotobacteraceae.
REFERENCE   1  (bases 1 to 118)
  AUTHORS   Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
            Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
  TITLE     Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
            sequencing
  JOURNAL   J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES             Location/Qualifiers
     rRNA            1..118
                     /note="5S ribosomal RNA"
BASE COUNT       27 a     40 c     32 g     17 t      2 others
ORIGIN      
        1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
       61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 9. Sample Sequence Data File


3.4.4 LOCUS Format

3.4.4.1 : Important notice about parsing the LOCUS line

  Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.

  Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.

  Consider this LOCUS line for a typical complete bacterial genome:

LOCUS       CP032762             5868661 bp    DNA     circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:

LOCUS       AZZZAA02123456789 9999999999 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:

LOCUS       AZZZAA0212345678910000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:

LOCUS       AZZZAA02123456789 10000000000 bp    DNA     linear   PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1          13             28 30       40        50        60        70       79

  Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.

3.4.4.2 : Data elements of the LOCUS line

  The data elements of the LOCUS line format and their typical/historical
column positions are as follows:

Positions  Contents
---------  --------
01-05      'LOCUS'
06-12      spaces
13-28      Locus Name (usually identical to the Accession Number)
29-29      space
30-40      Sequence Length, right-justified
41-41      space
42-43      'bp'
44-44      space
45-47      Strandedness : spaces (if not known), ss- (single-stranded),
           ds- (double-stranded), or ms- (mixed-stranded)
48-53      Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA), 
           mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
           Left justified.
54-55      space
56-63      Molecule Topology : 'linear' followed by two spaces,
           or 'circular'
64-64      space
65-67      Division Code
68-68      space
69-79      Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)

  These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.

  The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :

LOCUS       HUMPDNRC                 273 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S125 polymorphic dinucleotide repeat.
ACCESSION   L10620

LOCUS       HUMPDNRG                 169 bp    DNA     linear   PRI 04-OCT-1993
DEFINITION  Human D9S114 polymorphic dinucleotide repeat.
ACCESSION   L10624

  But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:

LOCUS       AF035771                1357 bp    mRNA    linear   PRI 30-JUN-1998
DEFINITION  Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
            complete cds.
ACCESSION   AF035771
	    
  The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :

PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags) 
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites) 
GSS - GSS sequences (Genome Survey Sequences) 
HTG - HTGS sequences (High Throughput Genomic sequences) 
HTC - HTC sequences (High Throughput cDNA sequences) 
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences

  The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.

3.4.5 DEFINITION Format

  The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION.  The last line must end with a period.

3.4.5.1 DEFINITION Format for NLM Entries

  The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database 
that summarize the most important attributes of the sequence.  The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:

NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]

94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]

inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]

cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]

myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]


  The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences.  This can
be gene locus names, protein names and descriptions that replace or augment
actual names.  Gene and gene product are linked by "=".  Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.

  The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length.  The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.

3.4.6 ACCESSION Format

  This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.

  The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.

  Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:

	SecAccession1-SecAccession2

In such cases, the alphabetic prefix letters of the initial and terminal 
accession numbers within the range *MUST* be identical. For example:

	AE000111-AE000510O
        ^^       ^^

Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.

3.4.7.1 VERSION Format

  This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.

LOCUS       AF181452     1294 bp    DNA             PLN       12-OCT-1999
DEFINITION  Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION   AF181452
VERSION     AF181452.1
            ^^^^^^^^^^
            Compound  
            Accession.Version
            Number

  A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.

  An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .

  Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.

  GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:

   http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist

NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.

3.4.7.2 DBLINK Format

  This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:

LOCUS       ANHA01000001             503 bp    DNA     linear   BCT 23-NOV-2012
DEFINITION  Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION   ANHA01000001 ANHA01000000
VERSION     ANHA01000001.1
DBLINK      BioProject: PRJNA177352
            BioSample: SAMN01795900

  A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").

  The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:

DBLINK      BioProject:PRJNA174162,PRJNA999998,PRJNA999999

  And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.

  As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".

  DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:

	http://www.ncbi.nlm.nih.gov/bioproject

  At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:

	http://www.ncbi.nlm.nih.gov/books/NBK54016/

  DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:

	http://www.ncbi.nlm.nih.gov/assembly

  At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:

   http://www.ncbi.nlm.nih.gov/assembly/help/

3.4.8 KEYWORDS Format

  The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.

3.4.9 SEGMENT Format

  NOTE: The SEGMENT linetype is obsolete given the conversion of
  of all segmented sets to gapped CON-division records, completed
  as of GenBank Release 221.0 in August 2017. No new segmented set
  submissions will be accepted by GenBank.

  The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.

3.4.10 SOURCE Format

  The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.

3.4.11 REFERENCE Format

  The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).

  The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.

  The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period.  The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.

  The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.

  For Book citations, the JOURNAL line is specially-formatted, and
includes:

	editor name(s)
	book title
	page number(s)
	publisher-name/publisher-location
	year

For example:

LOCUS       AY277550                1440 bp    DNA     linear   BCT 17-JUN-2003
DEFINITION  Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
            partial sequence.
ACCESSION   AY277550
....
REFERENCE   1  (bases 1 to 1440)
  AUTHORS   Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
  TITLE     Classifying bacterial isolates from hypogean environments:
            Application of a novel fluorimetric method dor the estimation of
            G+C mol% content in microorganisms by thermal denaturation
            temperature
  JOURNAL   (in) Saiz-Jimenez,C. (Ed.);
            MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
            A.A. Balkema, The Netherlands (2003)

  The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.

  The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.

  The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :

       http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed

  Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.

  The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.

3.4.12 FEATURES Format

  GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:

	http://www.insdc.org/documents/feature-table

  The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.

  The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.

  The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.

  Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.

3.4.12.1 Feature Key Names

  The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.2

3.4.12.2 Feature Location

  The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.

  Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.

Location descriptors can be one of the following:

1. A single base;

2. A contiguous span of bases;

3. A site between two bases;

4. A single base chosen from a range of bases;

5. A single base chosen from among two or more specified bases;

6. A joining of sequence spans;

7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;

  A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).

  A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.

  A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.

  Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.

complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.

join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.

order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.

3.4.12.3  Feature Qualifiers

  Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.

  The list of valid feature keys is available at:

	http://www.insdc.org/documents/feature-table#7.3

Qualifiers convey many types of information. Their values can,
therefore, take several forms:

1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;

  Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").

  Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.

  Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.

  A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.

3.4.12.4 Cross-Reference Information

  One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.

3.4.12.5 Feature Table Examples

  In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
     CDS             5..1261
                     /product="alpha-1-antitrypsin precursor"
                     /map="14q32.1"
                     /gene="PI"
     tRNA            1..87
                     /note="Leu-tRNA-CAA (NAR: 1057)"
                     /anticodon=(pos:35..37,aa:Leu)
     mRNA            1..>66
                     /note="alpha-1-acid glycoprotein mRNA"
     transposon      <1..267
                     /note="insertion element IS5"
     misc_recomb     105^106
                     /note="B.subtilis DNA end/IS5 DNA start"
     conflict        258
                     /replace="t"
                     /citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 10. Feature Table Entries


The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:

1       10        20        30        40        50        60        70       79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS       KZ271580              141308 bp    DNA     linear   CON 17-AUG-2017
DEFINITION  Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
            O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION   KZ271580 LQNL01000000
VERSION     KZ271580.1
DBLINK      BioProject: PRJNA230512
            BioSample: SAMN04226856
KEYWORDS    WGS; HIGH_QUALITY_DRAFT.
...
     mRNA            complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /product="hypothetical protein"
     CDS             complement(join(<1..1557,1914..2102,2273..2312))
                     /locus_tag="X798_08235"
                     /codon_start=1
                     /product="hypothetical protein"
                     /protein_id="OZC04795.1"
                     /db_xref="GI:1233056989"
                     /translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
                     SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
                     ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
                     TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
                     LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
                     HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
                     LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
                     IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
                     YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
                     AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
                     IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG      join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
            gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1       10        20        30        40        50        60        70       79

Example 11. Scaffold/CON-division join() sequence


3.4.13 ORIGIN Format

  The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).

3.4.14 SEQUENCE Format

  The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.

3.4.15 CONTIG Format

  As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :

CONTIG      join(AE003590.3:1..305900,AE003589.4:61..306076,
            AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
            AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,

            [ lines removed for brevity ]

            AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)

However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:

	gap()     : Gap of unknown length.

	gap(X)    : Gap with an estimated integer length of X bases.

	            To be represented as a run of n's of length X
	            in the sequence that can be constructed from
	            the CONTIG line join() statement .

	gap(unkX) : Gap of unknown length, which is to be represented
	            as an integer number (X) of n's in the sequence that
	            can be constructed from the CONTIG line join()
	            statement.

	            The value of this gap operator consists of the 
	            literal characters 'unk', followed by an integer.

Here is an example of a CONTIG line join() that utilizes the gap() operator:

CONTIG      join(complement(AADE01002756.1:1..10234),gap(1206),
            AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
            AADE01005641.1:1..2377)

The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.

Consecutive gap() operators are illegal.


4. ALTERNATE RELEASES

  NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format.  Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:

              info@ncbi.nlm.nih.gov

  The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data.  Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features.  Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.

  The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.


5. KNOWN PROBLEMS OF THE GENBANK DATABASE

5.1 Incorrect Gene Symbols in Entries and Index

  The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.


6. GENBANK ADMINISTRATION 

  The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database.  NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services.  For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .

6.1 Registered Trademark Notice

  GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.

6.2 Citing GenBank

  If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.

  When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared.  If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.

  It is also appropriate to list a reference for GenBank itself.  The
following publication, which describes the GenBank database, should
be cited:

   Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
   Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research,
   Volume 52, Issue D1, January 2024, pp. D134-D137.

   PMID:  37889039
   PMCID: PMC10767886
   DOI:   10.1093/nar/gkad903

  The following statement is an example of how one might cite GenBank
data.  It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank.  The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.

`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'

  (1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024)
  (2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)

6.3 GenBank Distribution Formats and Media

  Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:

	ftp://ftp.ncbi.nih.gov

  Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
 ceased as of GenBank Release 106.0 (April, 1998).

6.4 Other Methods of Accessing GenBank Data

  Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).

  Accessing Entrez is easy: Simply direct your web browser of choice to:

	 http://www.ncbi.nlm.nih.gov/

  The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:

	ftp://ftp.ncbi.nih.gov/

Versions are available for PC/Windows, Macintosh and several Unix variants.

  For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .

6.5 Request for Corrections and Comments

  We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data.  BankIt or Genome Workbench can be used to submit revisions to
previous submissions.  In addition, suggestions and corrections can
be sent by electronic mail to:  update@ncbi.nlm.nih.gov.  Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.

6.6  Credits and Acknowledgments

Credits -

GenBank Release Coordination	
	Mark Cavanaugh

GenBank Submission Coordination	
	Ilene Mizrachi

GenBank Annotation Staff
	Michael Baxter, Shelby Bidwell, Lori Black, Larissa Brown,
	Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky, Karen Clark,
	Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
	Andrea Gocke, Anjanette Johnston, Erica Lam,
	Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
	DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
	Beverly Underwood, and Linda Yankie

Data Management and Preparation
	Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
	Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
	Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
	Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
	Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
	Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
	Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
	Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou

Database Administration
	Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
	Benjamin Slade, Constantin Vasilyev

Customer Support
	David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
	Majda Valjavec-Gratian

Project Direction/Leadership
	Steve Sherry      : Acting Director, NLM
	Kim Pruitt        : Acting Director, NCBI
	Valerie Schneider : Acting Branch Chief, NCBI/IEB
	Eugene Yaschenko  : Chief Technology Officer, NCBI/IRB

Acknowledgments - 

  Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.

6.7 Disclaimer

  The United States Government makes no representations or warranties
regarding the content or accuracy of the information.  The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights.  The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.

  For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:

  GenBank
  National Library of Medicine
  Bldg. 38A Rm. 8N-809
  8600 Rockville Pike
  Bethesda, MD 20894
Support Center