Current GenBank Release Notes
GBREL.TXT Genetic Sequence Data Bank
December 15 2024
NCBI-GenBank Flat File Release 264.0
Distribution Release Notes
254365075 sequences, 5085904976338 bases, for traditional GenBank records
5101949186 sequences, 33880196332289 bases, for set-based (WGS/TSA/TLS) records
This document describes the format and content of the flat files that
comprise releases of the GenBank nucleotide sequence database. If you
have any questions or comments about GenBank or this document, please
contact NCBI via email at info@ncbi.nlm.nih.gov or:
GenBank
National Center for Biotechnology Information
National Library of Medicine, 38A, 8N805
8600 Rockville Pike
Bethesda, MD 20894
USA
GenBank releases do not include sequence records that originate from
third-parties (TPA) or from NCBI's Reference Sequence (RefSeq) project.
Rather, GenBank is the archival/primary resource which those other
efforts draw upon. For information about TPA and RefSeq, please visit:
http://www.ncbi.nih.gov/Genbank/TPA.html
http://www.ncbi.nlm.nih.gov/RefSeq
==========================================================================
TABLE OF CONTENTS
==========================================================================
1. INTRODUCTION
1.1 Release 264.0
1.2 Cutoff Date
1.3 Important Changes in Release 264.0
1.4 Upcoming Changes
1.5 Request for Direct Submission of Sequence Data
1.6 Organization of This Document
2. ORGANIZATION OF DATA FILES
2.1 Overview
2.2 Files
2.2.1 File Descriptions
2.2.5 File Sizes
2.2.6 Per-Division Statistics
2.2.7 Selected Per-Organism Statistics
2.2.8 Growth of GenBank
3. FILE FORMATS
3.1 File Header Information
3.4 Sequence Entry Files
3.4.1 File Organization
3.4.2 Entry Organization
3.4.3 Sample Sequence Data File
3.4.4 LOCUS Format
3.4.5 DEFINITION Format
3.4.5.1 DEFINITION Format for NLM Entries
3.4.6 ACCESSION Format
3.4.7 VERSION Format
3.4.8 KEYWORDS Format
3.4.9 SEGMENT Format
3.4.10 SOURCE Format
3.4.11 REFERENCE Format
3.4.12 FEATURES Format
3.4.12.1 Feature Key Names
3.4.12.2 Feature Location
3.4.12.3 Feature Qualifiers
3.4.12.4 Cross-Reference Information
3.4.12.5 Feature Table Examples
3.4.13 ORIGIN Format
3.4.14 SEQUENCE Format
3.4.15 CONTIG Format
4. ALTERNATE RELEASES
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries
6. GENBANK ADMINISTRATION
6.1 Registered Trademark Notice
6.2 Citing GenBank
6.3 GenBank Distribution Formats and Media
6.4 Other Methods of Accessing GenBank Data
6.5 Request for Corrections and Comments
6.6 Credits and Acknowledgments
6.7 Disclaimer
==========================================================================
1. INTRODUCTION
1.1 Release 264.0
The National Center for Biotechnology Information (NCBI) at the National
Library of Medicine (NLM), National Institutes of Health (NIH) is responsible
for producing and distributing the GenBank Sequence Database. NCBI handles
all GenBank direct submissions and authors are advised to use the address
below. Submitters are encouraged to use Submission Portal or BankIt for
sending sequence data.
*****************************************************************************
The address for direct submissions to GenBank is:
GenBank Submissions
National Center for Biotechnology Information
Bldg 38A, Rm. 8N-803
8600 Rockville Pike
Bethesda, MD 20894
Email: gb-sub@ncbi.nlm.nih.gov
Updates and changes to existing GenBank records:
https://www.ncbi.nlm.nih.gov/genbank/update/
Email: update@ncbi.nlm.nih.gov
URLs for GenBank's web-based submission tools:
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
See Section 1.5 for additional details about submitting data to GenBank.
*****************************************************************************
GenBank Release 264.0 is a release of sequence data by NCBI in the GenBank
Flatfile format. GenBank is a component of a tri-partite collaboration of
sequence databases in the U.S., Europe, and Japan, known as the International
Nucleotide Sequence Database Collaboration (INSDC). The collaborating databases
are the European Nucleotide Archive (ENA) at Hinxton Hall, UK, and
the DNA Database of Japan (DDBJ) in Mishima. Japan. Patent sequences are
incorporated through arrangements with the U.S. Patent and Trademark Office,
and via the collaborating international databases from other international
patent offices. The database is converted to various output formats, including
the GenBank Flatfile and Abstract Syntax Notation 1 (ASN.1) versions. The ASN.1
and Flatfile forms of the data are available at NCBI's anonymous FTP server :
ftp://ftp.ncbi.nih.gov/ncbi-asn1
ftp://ftp.ncbi.nih.gov/genbank
GenBank releases do not contain sequence records that originate from
unfinished Whole Genome Shotgun (WGS) genome sequencing projects,
Transcriptome Shotgun Assembly (TSA) RNA sequencing projects, or from
Targeted Locus Study (TLS) sequencing projects. The sequence data from
those efforts are made available separately, on a per-project basis:
ftp://ftp.ncbi.nih.gov/genbank/wgs
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/tsa
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tls
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
See the README files in those areas for more information.
1.2 Cutoff Date
This full release, 264.0, incorporates data processed by the INSDC databases
as of Friday December 13, 8:22PM EDT. For more recent data, users are
advised to:
o Download GenBank Incremental Update (GIU) files by anonymous FTP from NCBI:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/daily-nc (ASN.1 format)
ftp://ftp.ncbi.nih.gov/genbank/daily-nc (flatfile format)
o Use the interactive Network-Entrez or Web-Entrez applications to query
the 'Entrez: Nucleotide' database (see Section 6.4 of this document).
1.3 Important Changes in Release 264.0
1.3.1 Organizational changes
The total number of sequence data files for traditional GenBank records
(non-WGS/TSA/TLS) increased by 777 with this release:
- the BCT division is now composed of 412 files (+18)
- the ENV division is now composed of 27 files (-2)
- the EST division is now composed of 164 files (+1)
- the INV division is now composed of 1082 files (+148)
- the MAM division is now composed of 165 files (+9)
- the PAT division is now composed of 80 files (+2)
- the PLN division is now composed of 1875 files (+215)
- the PRI division is now composed of 678 files (+353)
- the ROD division is now composed of 115 files (+2)
- the VRL division is now composed of 333 files (+2)
- the VRT division is now composed of 317 files (+29)
The decrease in the number of ENV-division files is due to the suppression
of 8233 sequence records with OY accession prefixes, which were erroneously
submitted as chromosomes. Further details can be obtained from the European
Nucleotide Archive.
1.4 Upcoming Changes
1.4.1 New allowed values for the /geo_loc_name and /collection_date qualifiers
The INSDC will begin to mandate inclusion of /geo_loc_name (formerly /country)
and /collection_date for sequence submissions, in alignment with its goal of
increasing the number of sequences for which the origin of a sample can be
precisely located in time and space. This requirement is expected to take
effect by the end of December 2024, and further details can be found at:
https://www.insdc.org/news/insdc-spatiotemporal-metadata-minimum-standards-update-03-03-2023/
Because there are valid circumstances in which location and/or the
collection date for a sequenced sample cannot be provided, the domain
of allowed values for these two source-feature qualifiers will be expanded
to include a variety of "null terms". They are:
missing
not applicable
not collected
not provided
restricted access
missing: control sample
missing: sample group
missing: synthetic construct
missing: lab stock
missing: third party data
missing: data agreement established pre-2023
missing: endangered species
missing: human-identifiable
The timeframe for introducing these new values is still uncertain, but the
earliest possible date for their appearance was June 15 2023, and they will
definitely be encountered after Dec 31 2024, when /geo_loc_name and
/collection_date have become mandatory.
1.5 Request for Direct Submission of Sequence Data
A successful GenBank requires that sequence data enter the database as
soon as possible after publication, that the annotations be as complete as
possible, and that the sequence and annotation data be accurate. All
three of these requirements are best met if authors of sequence data
submit their data directly to GenBank utilizing the tools summarized below.
GenBank must rely on direct author submission of data to ensure that
it achieves its goals of completeness, accuracy, and timeliness. General
information for submitting to Genbank is available online:
https://www.ncbi.nlm.nih.gov/genbank/submit/
To assist researchers in entering their own sequence data, GenBank
provides Web-based submission tools: Submission Portal and Bankit.
Submission Portal https://submit.ncbi.nlm.nih.gov/
BankIt https://www.ncbi.nlm.nih.gov/WebSub/
Submission Portal provides an efficient submission pathway for high
frequency submission types (e.g., 16S rRNA, rRNA-ITS, metazoan COX1,
SARS-CoV-2, etc.).
BankIt is an easy-to-use program that enables authors to enter one
or more sequences, annotate, and submit to GenBank. BankIt provides
a simple forms-based approach for submitting your sequence and the
relevant associated metadata to GenBank.
Genbank also provides submission preparation tools which require uploading
via the Submission Portal or email to gb-sub@ncbi.nlm.nih.gov when relevant:
table2asn: https://www.ncbi.nlm.nih.gov/genbank/table2asn/
table2asn is a command-line program that automates the creation of sequence
records for submission to GenBank. It is used primarily for submission of
complete genomes and large batches of sequences and is available by FTP
for use on MAC, PC and Unix platforms:
https://ftp.ncbi.nlm.nih.gov/asn1-converters/by_program/table2asn/
Genome Workbench offers a rich set of integrated tools for studying
and analyzing genetic data. The Submission Wizard allows you to prepare
submissions of single eukaryotic and prokaryotic genomes. You can also
use Genome Workbench to edit and visualize an ASN.1 file created by table2asn.
Genome Workbench: https://www.ncbi.nlm.nih.gov/tools/gbench/
Through the international collaboration of DNA sequence databases,
GenBank submissions are forwarded daily for inclusion in the European
Nucleotide Archive (ENA) and the DNA Databank of Japan (DDBJ).
AUTHORIN. Authorin sequence submissions are no longer accepted by
GenBank, and the Authorin application is no longer distributed by NCBI.
SEQUIN. As of January 2021, Sequin sequence submissions are no longer
accepted by GenBank, and the Sequin application is no longer distributed
by NCBI. See: https://ncbiinsights.ncbi.nlm.nih.gov/tag/sequin/
If you have questions about GenBank submissions or any of the data
submission tools, contact NCBI at: info@ncbi.nlm.nih.gov .
1.6 Organization of This Document
The second section describes the contents of GenBank releases. The third
section illustrates the formats of the flat files. The fourth section
describes other versions of the data, the fifth section identifies known prob-
lems, and the sixth contains administrative details.
2. ORGANIZATION OF DATA FILES
2.1 Overview
GenBank releases consist of a set of ASCII text files, most of which
contain sequence data. A few supplemental files are also supplied,
containing lists of new, modified, and deleted sequence records.
The line-lengths of these files is variable.
2.2 Files
This GenBank flat file release consists of 5480 files. The lists
that follow describe each of the files included in the distribution.
Their sizes and base pair content are also summarized.
2.2.1 File Descriptions
Files included in this release are:
1. gbbct1.seq - Bacterial sequence entries, part 1.
2. gbbct10.seq - Bacterial sequence entries, part 10.
3. gbbct100.seq - Bacterial sequence entries, part 100.
4. gbbct101.seq - Bacterial sequence entries, part 101.
5. gbbct102.seq - Bacterial sequence entries, part 102.
6. gbbct103.seq - Bacterial sequence entries, part 103.
7. gbbct104.seq - Bacterial sequence entries, part 104.
8. gbbct105.seq - Bacterial sequence entries, part 105.
9. gbbct106.seq - Bacterial sequence entries, part 106.
10. gbbct107.seq - Bacterial sequence entries, part 107.
11. gbbct108.seq - Bacterial sequence entries, part 108.
12. gbbct109.seq - Bacterial sequence entries, part 109.
13. gbbct11.seq - Bacterial sequence entries, part 11.
14. gbbct110.seq - Bacterial sequence entries, part 110.
15. gbbct111.seq - Bacterial sequence entries, part 111.
16. gbbct112.seq - Bacterial sequence entries, part 112.
17. gbbct113.seq - Bacterial sequence entries, part 113.
18. gbbct114.seq - Bacterial sequence entries, part 114.
19. gbbct115.seq - Bacterial sequence entries, part 115.
20. gbbct116.seq - Bacterial sequence entries, part 116.
21. gbbct117.seq - Bacterial sequence entries, part 117.
22. gbbct118.seq - Bacterial sequence entries, part 118.
23. gbbct119.seq - Bacterial sequence entries, part 119.
24. gbbct12.seq - Bacterial sequence entries, part 12.
25. gbbct120.seq - Bacterial sequence entries, part 120.
26. gbbct121.seq - Bacterial sequence entries, part 121.
27. gbbct122.seq - Bacterial sequence entries, part 122.
28. gbbct123.seq - Bacterial sequence entries, part 123.
29. gbbct124.seq - Bacterial sequence entries, part 124.
30. gbbct125.seq - Bacterial sequence entries, part 125.
31. gbbct126.seq - Bacterial sequence entries, part 126.
32. gbbct127.seq - Bacterial sequence entries, part 127.
33. gbbct128.seq - Bacterial sequence entries, part 128.
34. gbbct129.seq - Bacterial sequence entries, part 129.
35. gbbct13.seq - Bacterial sequence entries, part 13.
36. gbbct130.seq - Bacterial sequence entries, part 130.
37. gbbct131.seq - Bacterial sequence entries, part 131.
38. gbbct132.seq - Bacterial sequence entries, part 132.
39. gbbct133.seq - Bacterial sequence entries, part 133.
40. gbbct134.seq - Bacterial sequence entries, part 134.
41. gbbct135.seq - Bacterial sequence entries, part 135.
42. gbbct136.seq - Bacterial sequence entries, part 136.
43. gbbct137.seq - Bacterial sequence entries, part 137.
44. gbbct138.seq - Bacterial sequence entries, part 138.
45. gbbct139.seq - Bacterial sequence entries, part 139.
46. gbbct14.seq - Bacterial sequence entries, part 14.
47. gbbct140.seq - Bacterial sequence entries, part 140.
48. gbbct141.seq - Bacterial sequence entries, part 141.
49. gbbct142.seq - Bacterial sequence entries, part 142.
50. gbbct143.seq - Bacterial sequence entries, part 143.
51. gbbct144.seq - Bacterial sequence entries, part 144.
52. gbbct145.seq - Bacterial sequence entries, part 145.
53. gbbct146.seq - Bacterial sequence entries, part 146.
54. gbbct147.seq - Bacterial sequence entries, part 147.
55. gbbct148.seq - Bacterial sequence entries, part 148.
56. gbbct149.seq - Bacterial sequence entries, part 149.
57. gbbct15.seq - Bacterial sequence entries, part 15.
58. gbbct150.seq - Bacterial sequence entries, part 150.
59. gbbct151.seq - Bacterial sequence entries, part 151.
60. gbbct152.seq - Bacterial sequence entries, part 152.
61. gbbct153.seq - Bacterial sequence entries, part 153.
62. gbbct154.seq - Bacterial sequence entries, part 154.
63. gbbct155.seq - Bacterial sequence entries, part 155.
64. gbbct156.seq - Bacterial sequence entries, part 156.
65. gbbct157.seq - Bacterial sequence entries, part 157.
66. gbbct158.seq - Bacterial sequence entries, part 158.
67. gbbct159.seq - Bacterial sequence entries, part 159.
68. gbbct16.seq - Bacterial sequence entries, part 16.
69. gbbct160.seq - Bacterial sequence entries, part 160.
70. gbbct161.seq - Bacterial sequence entries, part 161.
71. gbbct162.seq - Bacterial sequence entries, part 162.
72. gbbct163.seq - Bacterial sequence entries, part 163.
73. gbbct164.seq - Bacterial sequence entries, part 164.
74. gbbct165.seq - Bacterial sequence entries, part 165.
75. gbbct166.seq - Bacterial sequence entries, part 166.
76. gbbct167.seq - Bacterial sequence entries, part 167.
77. gbbct168.seq - Bacterial sequence entries, part 168.
78. gbbct169.seq - Bacterial sequence entries, part 169.
79. gbbct17.seq - Bacterial sequence entries, part 17.
80. gbbct170.seq - Bacterial sequence entries, part 170.
81. gbbct171.seq - Bacterial sequence entries, part 171.
82. gbbct172.seq - Bacterial sequence entries, part 172.
83. gbbct173.seq - Bacterial sequence entries, part 173.
84. gbbct174.seq - Bacterial sequence entries, part 174.
85. gbbct175.seq - Bacterial sequence entries, part 175.
86. gbbct176.seq - Bacterial sequence entries, part 176.
87. gbbct177.seq - Bacterial sequence entries, part 177.
88. gbbct178.seq - Bacterial sequence entries, part 178.
89. gbbct179.seq - Bacterial sequence entries, part 179.
90. gbbct18.seq - Bacterial sequence entries, part 18.
91. gbbct180.seq - Bacterial sequence entries, part 180.
92. gbbct181.seq - Bacterial sequence entries, part 181.
93. gbbct182.seq - Bacterial sequence entries, part 182.
94. gbbct183.seq - Bacterial sequence entries, part 183.
95. gbbct184.seq - Bacterial sequence entries, part 184.
96. gbbct185.seq - Bacterial sequence entries, part 185.
97. gbbct186.seq - Bacterial sequence entries, part 186.
98. gbbct187.seq - Bacterial sequence entries, part 187.
99. gbbct188.seq - Bacterial sequence entries, part 188.
100. gbbct189.seq - Bacterial sequence entries, part 189.
101. gbbct19.seq - Bacterial sequence entries, part 19.
102. gbbct190.seq - Bacterial sequence entries, part 190.
103. gbbct191.seq - Bacterial sequence entries, part 191.
104. gbbct192.seq - Bacterial sequence entries, part 192.
105. gbbct193.seq - Bacterial sequence entries, part 193.
106. gbbct194.seq - Bacterial sequence entries, part 194.
107. gbbct195.seq - Bacterial sequence entries, part 195.
108. gbbct196.seq - Bacterial sequence entries, part 196.
109. gbbct197.seq - Bacterial sequence entries, part 197.
110. gbbct198.seq - Bacterial sequence entries, part 198.
111. gbbct199.seq - Bacterial sequence entries, part 199.
112. gbbct2.seq - Bacterial sequence entries, part 2.
113. gbbct20.seq - Bacterial sequence entries, part 20.
114. gbbct200.seq - Bacterial sequence entries, part 200.
115. gbbct201.seq - Bacterial sequence entries, part 201.
116. gbbct202.seq - Bacterial sequence entries, part 202.
117. gbbct203.seq - Bacterial sequence entries, part 203.
118. gbbct204.seq - Bacterial sequence entries, part 204.
119. gbbct205.seq - Bacterial sequence entries, part 205.
120. gbbct206.seq - Bacterial sequence entries, part 206.
121. gbbct207.seq - Bacterial sequence entries, part 207.
122. gbbct208.seq - Bacterial sequence entries, part 208.
123. gbbct209.seq - Bacterial sequence entries, part 209.
124. gbbct21.seq - Bacterial sequence entries, part 21.
125. gbbct210.seq - Bacterial sequence entries, part 210.
126. gbbct211.seq - Bacterial sequence entries, part 211.
127. gbbct212.seq - Bacterial sequence entries, part 212.
128. gbbct213.seq - Bacterial sequence entries, part 213.
129. gbbct214.seq - Bacterial sequence entries, part 214.
130. gbbct215.seq - Bacterial sequence entries, part 215.
131. gbbct216.seq - Bacterial sequence entries, part 216.
132. gbbct217.seq - Bacterial sequence entries, part 217.
133. gbbct218.seq - Bacterial sequence entries, part 218.
134. gbbct219.seq - Bacterial sequence entries, part 219.
135. gbbct22.seq - Bacterial sequence entries, part 22.
136. gbbct220.seq - Bacterial sequence entries, part 220.
137. gbbct221.seq - Bacterial sequence entries, part 221.
138. gbbct222.seq - Bacterial sequence entries, part 222.
139. gbbct223.seq - Bacterial sequence entries, part 223.
140. gbbct224.seq - Bacterial sequence entries, part 224.
141. gbbct225.seq - Bacterial sequence entries, part 225.
142. gbbct226.seq - Bacterial sequence entries, part 226.
143. gbbct227.seq - Bacterial sequence entries, part 227.
144. gbbct228.seq - Bacterial sequence entries, part 228.
145. gbbct229.seq - Bacterial sequence entries, part 229.
146. gbbct23.seq - Bacterial sequence entries, part 23.
147. gbbct230.seq - Bacterial sequence entries, part 230.
148. gbbct231.seq - Bacterial sequence entries, part 231.
149. gbbct232.seq - Bacterial sequence entries, part 232.
150. gbbct233.seq - Bacterial sequence entries, part 233.
151. gbbct234.seq - Bacterial sequence entries, part 234.
152. gbbct235.seq - Bacterial sequence entries, part 235.
153. gbbct236.seq - Bacterial sequence entries, part 236.
154. gbbct237.seq - Bacterial sequence entries, part 237.
155. gbbct238.seq - Bacterial sequence entries, part 238.
156. gbbct239.seq - Bacterial sequence entries, part 239.
157. gbbct24.seq - Bacterial sequence entries, part 24.
158. gbbct240.seq - Bacterial sequence entries, part 240.
159. gbbct241.seq - Bacterial sequence entries, part 241.
160. gbbct242.seq - Bacterial sequence entries, part 242.
161. gbbct243.seq - Bacterial sequence entries, part 243.
162. gbbct244.seq - Bacterial sequence entries, part 244.
163. gbbct245.seq - Bacterial sequence entries, part 245.
164. gbbct246.seq - Bacterial sequence entries, part 246.
165. gbbct247.seq - Bacterial sequence entries, part 247.
166. gbbct248.seq - Bacterial sequence entries, part 248.
167. gbbct249.seq - Bacterial sequence entries, part 249.
168. gbbct25.seq - Bacterial sequence entries, part 25.
169. gbbct250.seq - Bacterial sequence entries, part 250.
170. gbbct251.seq - Bacterial sequence entries, part 251.
171. gbbct252.seq - Bacterial sequence entries, part 252.
172. gbbct253.seq - Bacterial sequence entries, part 253.
173. gbbct254.seq - Bacterial sequence entries, part 254.
174. gbbct255.seq - Bacterial sequence entries, part 255.
175. gbbct256.seq - Bacterial sequence entries, part 256.
176. gbbct257.seq - Bacterial sequence entries, part 257.
177. gbbct258.seq - Bacterial sequence entries, part 258.
178. gbbct259.seq - Bacterial sequence entries, part 259.
179. gbbct26.seq - Bacterial sequence entries, part 26.
180. gbbct260.seq - Bacterial sequence entries, part 260.
181. gbbct261.seq - Bacterial sequence entries, part 261.
182. gbbct262.seq - Bacterial sequence entries, part 262.
183. gbbct263.seq - Bacterial sequence entries, part 263.
184. gbbct264.seq - Bacterial sequence entries, part 264.
185. gbbct265.seq - Bacterial sequence entries, part 265.
186. gbbct266.seq - Bacterial sequence entries, part 266.
187. gbbct267.seq - Bacterial sequence entries, part 267.
188. gbbct268.seq - Bacterial sequence entries, part 268.
189. gbbct269.seq - Bacterial sequence entries, part 269.
190. gbbct27.seq - Bacterial sequence entries, part 27.
191. gbbct270.seq - Bacterial sequence entries, part 270.
192. gbbct271.seq - Bacterial sequence entries, part 271.
193. gbbct272.seq - Bacterial sequence entries, part 272.
194. gbbct273.seq - Bacterial sequence entries, part 273.
195. gbbct274.seq - Bacterial sequence entries, part 274.
196. gbbct275.seq - Bacterial sequence entries, part 275.
197. gbbct276.seq - Bacterial sequence entries, part 276.
198. gbbct277.seq - Bacterial sequence entries, part 277.
199. gbbct278.seq - Bacterial sequence entries, part 278.
200. gbbct279.seq - Bacterial sequence entries, part 279.
201. gbbct28.seq - Bacterial sequence entries, part 28.
202. gbbct280.seq - Bacterial sequence entries, part 280.
203. gbbct281.seq - Bacterial sequence entries, part 281.
204. gbbct282.seq - Bacterial sequence entries, part 282.
205. gbbct283.seq - Bacterial sequence entries, part 283.
206. gbbct284.seq - Bacterial sequence entries, part 284.
207. gbbct285.seq - Bacterial sequence entries, part 285.
208. gbbct286.seq - Bacterial sequence entries, part 286.
209. gbbct287.seq - Bacterial sequence entries, part 287.
210. gbbct288.seq - Bacterial sequence entries, part 288.
211. gbbct289.seq - Bacterial sequence entries, part 289.
212. gbbct29.seq - Bacterial sequence entries, part 29.
213. gbbct290.seq - Bacterial sequence entries, part 290.
214. gbbct291.seq - Bacterial sequence entries, part 291.
215. gbbct292.seq - Bacterial sequence entries, part 292.
216. gbbct293.seq - Bacterial sequence entries, part 293.
217. gbbct294.seq - Bacterial sequence entries, part 294.
218. gbbct295.seq - Bacterial sequence entries, part 295.
219. gbbct296.seq - Bacterial sequence entries, part 296.
220. gbbct297.seq - Bacterial sequence entries, part 297.
221. gbbct298.seq - Bacterial sequence entries, part 298.
222. gbbct299.seq - Bacterial sequence entries, part 299.
223. gbbct3.seq - Bacterial sequence entries, part 3.
224. gbbct30.seq - Bacterial sequence entries, part 30.
225. gbbct300.seq - Bacterial sequence entries, part 300.
226. gbbct301.seq - Bacterial sequence entries, part 301.
227. gbbct302.seq - Bacterial sequence entries, part 302.
228. gbbct303.seq - Bacterial sequence entries, part 303.
229. gbbct304.seq - Bacterial sequence entries, part 304.
230. gbbct305.seq - Bacterial sequence entries, part 305.
231. gbbct306.seq - Bacterial sequence entries, part 306.
232. gbbct307.seq - Bacterial sequence entries, part 307.
233. gbbct308.seq - Bacterial sequence entries, part 308.
234. gbbct309.seq - Bacterial sequence entries, part 309.
235. gbbct31.seq - Bacterial sequence entries, part 31.
236. gbbct310.seq - Bacterial sequence entries, part 310.
237. gbbct311.seq - Bacterial sequence entries, part 311.
238. gbbct312.seq - Bacterial sequence entries, part 312.
239. gbbct313.seq - Bacterial sequence entries, part 313.
240. gbbct314.seq - Bacterial sequence entries, part 314.
241. gbbct315.seq - Bacterial sequence entries, part 315.
242. gbbct316.seq - Bacterial sequence entries, part 316.
243. gbbct317.seq - Bacterial sequence entries, part 317.
244. gbbct318.seq - Bacterial sequence entries, part 318.
245. gbbct319.seq - Bacterial sequence entries, part 319.
246. gbbct32.seq - Bacterial sequence entries, part 32.
247. gbbct320.seq - Bacterial sequence entries, part 320.
248. gbbct321.seq - Bacterial sequence entries, part 321.
249. gbbct322.seq - Bacterial sequence entries, part 322.
250. gbbct323.seq - Bacterial sequence entries, part 323.
251. gbbct324.seq - Bacterial sequence entries, part 324.
252. gbbct325.seq - Bacterial sequence entries, part 325.
253. gbbct326.seq - Bacterial sequence entries, part 326.
254. gbbct327.seq - Bacterial sequence entries, part 327.
255. gbbct328.seq - Bacterial sequence entries, part 328.
256. gbbct329.seq - Bacterial sequence entries, part 329.
257. gbbct33.seq - Bacterial sequence entries, part 33.
258. gbbct330.seq - Bacterial sequence entries, part 330.
259. gbbct331.seq - Bacterial sequence entries, part 331.
260. gbbct332.seq - Bacterial sequence entries, part 332.
261. gbbct333.seq - Bacterial sequence entries, part 333.
262. gbbct334.seq - Bacterial sequence entries, part 334.
263. gbbct335.seq - Bacterial sequence entries, part 335.
264. gbbct336.seq - Bacterial sequence entries, part 336.
265. gbbct337.seq - Bacterial sequence entries, part 337.
266. gbbct338.seq - Bacterial sequence entries, part 338.
267. gbbct339.seq - Bacterial sequence entries, part 339.
268. gbbct34.seq - Bacterial sequence entries, part 34.
269. gbbct340.seq - Bacterial sequence entries, part 340.
270. gbbct341.seq - Bacterial sequence entries, part 341.
271. gbbct342.seq - Bacterial sequence entries, part 342.
272. gbbct343.seq - Bacterial sequence entries, part 343.
273. gbbct344.seq - Bacterial sequence entries, part 344.
274. gbbct345.seq - Bacterial sequence entries, part 345.
275. gbbct346.seq - Bacterial sequence entries, part 346.
276. gbbct347.seq - Bacterial sequence entries, part 347.
277. gbbct348.seq - Bacterial sequence entries, part 348.
278. gbbct349.seq - Bacterial sequence entries, part 349.
279. gbbct35.seq - Bacterial sequence entries, part 35.
280. gbbct350.seq - Bacterial sequence entries, part 350.
281. gbbct351.seq - Bacterial sequence entries, part 351.
282. gbbct352.seq - Bacterial sequence entries, part 352.
283. gbbct353.seq - Bacterial sequence entries, part 353.
284. gbbct354.seq - Bacterial sequence entries, part 354.
285. gbbct355.seq - Bacterial sequence entries, part 355.
286. gbbct356.seq - Bacterial sequence entries, part 356.
287. gbbct357.seq - Bacterial sequence entries, part 357.
288. gbbct358.seq - Bacterial sequence entries, part 358.
289. gbbct359.seq - Bacterial sequence entries, part 359.
290. gbbct36.seq - Bacterial sequence entries, part 36.
291. gbbct360.seq - Bacterial sequence entries, part 360.
292. gbbct361.seq - Bacterial sequence entries, part 361.
293. gbbct362.seq - Bacterial sequence entries, part 362.
294. gbbct363.seq - Bacterial sequence entries, part 363.
295. gbbct364.seq - Bacterial sequence entries, part 364.
296. gbbct365.seq - Bacterial sequence entries, part 365.
297. gbbct366.seq - Bacterial sequence entries, part 366.
298. gbbct367.seq - Bacterial sequence entries, part 367.
299. gbbct368.seq - Bacterial sequence entries, part 368.
300. gbbct369.seq - Bacterial sequence entries, part 369.
301. gbbct37.seq - Bacterial sequence entries, part 37.
302. gbbct370.seq - Bacterial sequence entries, part 370.
303. gbbct371.seq - Bacterial sequence entries, part 371.
304. gbbct372.seq - Bacterial sequence entries, part 372.
305. gbbct373.seq - Bacterial sequence entries, part 373.
306. gbbct374.seq - Bacterial sequence entries, part 374.
307. gbbct375.seq - Bacterial sequence entries, part 375.
308. gbbct376.seq - Bacterial sequence entries, part 376.
309. gbbct377.seq - Bacterial sequence entries, part 377.
310. gbbct378.seq - Bacterial sequence entries, part 378.
311. gbbct379.seq - Bacterial sequence entries, part 379.
312. gbbct38.seq - Bacterial sequence entries, part 38.
313. gbbct380.seq - Bacterial sequence entries, part 380.
314. gbbct381.seq - Bacterial sequence entries, part 381.
315. gbbct382.seq - Bacterial sequence entries, part 382.
316. gbbct383.seq - Bacterial sequence entries, part 383.
317. gbbct384.seq - Bacterial sequence entries, part 384.
318. gbbct385.seq - Bacterial sequence entries, part 385.
319. gbbct386.seq - Bacterial sequence entries, part 386.
320. gbbct387.seq - Bacterial sequence entries, part 387.
321. gbbct388.seq - Bacterial sequence entries, part 388.
322. gbbct389.seq - Bacterial sequence entries, part 389.
323. gbbct39.seq - Bacterial sequence entries, part 39.
324. gbbct390.seq - Bacterial sequence entries, part 390.
325. gbbct391.seq - Bacterial sequence entries, part 391.
326. gbbct392.seq - Bacterial sequence entries, part 392.
327. gbbct393.seq - Bacterial sequence entries, part 393.
328. gbbct394.seq - Bacterial sequence entries, part 394.
329. gbbct395.seq - Bacterial sequence entries, part 395.
330. gbbct396.seq - Bacterial sequence entries, part 396.
331. gbbct397.seq - Bacterial sequence entries, part 397.
332. gbbct398.seq - Bacterial sequence entries, part 398.
333. gbbct399.seq - Bacterial sequence entries, part 399.
334. gbbct4.seq - Bacterial sequence entries, part 4.
335. gbbct40.seq - Bacterial sequence entries, part 40.
336. gbbct400.seq - Bacterial sequence entries, part 400.
337. gbbct401.seq - Bacterial sequence entries, part 401.
338. gbbct402.seq - Bacterial sequence entries, part 402.
339. gbbct403.seq - Bacterial sequence entries, part 403.
340. gbbct404.seq - Bacterial sequence entries, part 404.
341. gbbct405.seq - Bacterial sequence entries, part 405.
342. gbbct406.seq - Bacterial sequence entries, part 406.
343. gbbct407.seq - Bacterial sequence entries, part 407.
344. gbbct408.seq - Bacterial sequence entries, part 408.
345. gbbct409.seq - Bacterial sequence entries, part 409.
346. gbbct41.seq - Bacterial sequence entries, part 41.
347. gbbct410.seq - Bacterial sequence entries, part 410.
348. gbbct411.seq - Bacterial sequence entries, part 411.
349. gbbct412.seq - Bacterial sequence entries, part 412.
350. gbbct42.seq - Bacterial sequence entries, part 42.
351. gbbct43.seq - Bacterial sequence entries, part 43.
352. gbbct44.seq - Bacterial sequence entries, part 44.
353. gbbct45.seq - Bacterial sequence entries, part 45.
354. gbbct46.seq - Bacterial sequence entries, part 46.
355. gbbct47.seq - Bacterial sequence entries, part 47.
356. gbbct48.seq - Bacterial sequence entries, part 48.
357. gbbct49.seq - Bacterial sequence entries, part 49.
358. gbbct5.seq - Bacterial sequence entries, part 5.
359. gbbct50.seq - Bacterial sequence entries, part 50.
360. gbbct51.seq - Bacterial sequence entries, part 51.
361. gbbct52.seq - Bacterial sequence entries, part 52.
362. gbbct53.seq - Bacterial sequence entries, part 53.
363. gbbct54.seq - Bacterial sequence entries, part 54.
364. gbbct55.seq - Bacterial sequence entries, part 55.
365. gbbct56.seq - Bacterial sequence entries, part 56.
366. gbbct57.seq - Bacterial sequence entries, part 57.
367. gbbct58.seq - Bacterial sequence entries, part 58.
368. gbbct59.seq - Bacterial sequence entries, part 59.
369. gbbct6.seq - Bacterial sequence entries, part 6.
370. gbbct60.seq - Bacterial sequence entries, part 60.
371. gbbct61.seq - Bacterial sequence entries, part 61.
372. gbbct62.seq - Bacterial sequence entries, part 62.
373. gbbct63.seq - Bacterial sequence entries, part 63.
374. gbbct64.seq - Bacterial sequence entries, part 64.
375. gbbct65.seq - Bacterial sequence entries, part 65.
376. gbbct66.seq - Bacterial sequence entries, part 66.
377. gbbct67.seq - Bacterial sequence entries, part 67.
378. gbbct68.seq - Bacterial sequence entries, part 68.
379. gbbct69.seq - Bacterial sequence entries, part 69.
380. gbbct7.seq - Bacterial sequence entries, part 7.
381. gbbct70.seq - Bacterial sequence entries, part 70.
382. gbbct71.seq - Bacterial sequence entries, part 71.
383. gbbct72.seq - Bacterial sequence entries, part 72.
384. gbbct73.seq - Bacterial sequence entries, part 73.
385. gbbct74.seq - Bacterial sequence entries, part 74.
386. gbbct75.seq - Bacterial sequence entries, part 75.
387. gbbct76.seq - Bacterial sequence entries, part 76.
388. gbbct77.seq - Bacterial sequence entries, part 77.
389. gbbct78.seq - Bacterial sequence entries, part 78.
390. gbbct79.seq - Bacterial sequence entries, part 79.
391. gbbct8.seq - Bacterial sequence entries, part 8.
392. gbbct80.seq - Bacterial sequence entries, part 80.
393. gbbct81.seq - Bacterial sequence entries, part 81.
394. gbbct82.seq - Bacterial sequence entries, part 82.
395. gbbct83.seq - Bacterial sequence entries, part 83.
396. gbbct84.seq - Bacterial sequence entries, part 84.
397. gbbct85.seq - Bacterial sequence entries, part 85.
398. gbbct86.seq - Bacterial sequence entries, part 86.
399. gbbct87.seq - Bacterial sequence entries, part 87.
400. gbbct88.seq - Bacterial sequence entries, part 88.
401. gbbct89.seq - Bacterial sequence entries, part 89.
402. gbbct9.seq - Bacterial sequence entries, part 9.
403. gbbct90.seq - Bacterial sequence entries, part 90.
404. gbbct91.seq - Bacterial sequence entries, part 91.
405. gbbct92.seq - Bacterial sequence entries, part 92.
406. gbbct93.seq - Bacterial sequence entries, part 93.
407. gbbct94.seq - Bacterial sequence entries, part 94.
408. gbbct95.seq - Bacterial sequence entries, part 95.
409. gbbct96.seq - Bacterial sequence entries, part 96.
410. gbbct97.seq - Bacterial sequence entries, part 97.
411. gbbct98.seq - Bacterial sequence entries, part 98.
412. gbbct99.seq - Bacterial sequence entries, part 99.
413. gbchg.txt - Accession numbers of entries updated since the previous release.
414. gbcon1.seq - Constructed sequence entries, part 1.
415. gbcon10.seq - Constructed sequence entries, part 10.
416. gbcon11.seq - Constructed sequence entries, part 11.
417. gbcon12.seq - Constructed sequence entries, part 12.
418. gbcon13.seq - Constructed sequence entries, part 13.
419. gbcon14.seq - Constructed sequence entries, part 14.
420. gbcon15.seq - Constructed sequence entries, part 15.
421. gbcon16.seq - Constructed sequence entries, part 16.
422. gbcon17.seq - Constructed sequence entries, part 17.
423. gbcon18.seq - Constructed sequence entries, part 18.
424. gbcon19.seq - Constructed sequence entries, part 19.
425. gbcon2.seq - Constructed sequence entries, part 2.
426. gbcon20.seq - Constructed sequence entries, part 20.
427. gbcon21.seq - Constructed sequence entries, part 21.
428. gbcon22.seq - Constructed sequence entries, part 22.
429. gbcon23.seq - Constructed sequence entries, part 23.
430. gbcon24.seq - Constructed sequence entries, part 24.
431. gbcon25.seq - Constructed sequence entries, part 25.
432. gbcon26.seq - Constructed sequence entries, part 26.
433. gbcon27.seq - Constructed sequence entries, part 27.
434. gbcon28.seq - Constructed sequence entries, part 28.
435. gbcon29.seq - Constructed sequence entries, part 29.
436. gbcon3.seq - Constructed sequence entries, part 3.
437. gbcon30.seq - Constructed sequence entries, part 30.
438. gbcon31.seq - Constructed sequence entries, part 31.
439. gbcon32.seq - Constructed sequence entries, part 32.
440. gbcon33.seq - Constructed sequence entries, part 33.
441. gbcon34.seq - Constructed sequence entries, part 34.
442. gbcon35.seq - Constructed sequence entries, part 35.
443. gbcon36.seq - Constructed sequence entries, part 36.
444. gbcon37.seq - Constructed sequence entries, part 37.
445. gbcon38.seq - Constructed sequence entries, part 38.
446. gbcon39.seq - Constructed sequence entries, part 39.
447. gbcon4.seq - Constructed sequence entries, part 4.
448. gbcon40.seq - Constructed sequence entries, part 40.
449. gbcon41.seq - Constructed sequence entries, part 41.
450. gbcon42.seq - Constructed sequence entries, part 42.
451. gbcon43.seq - Constructed sequence entries, part 43.
452. gbcon44.seq - Constructed sequence entries, part 44.
453. gbcon45.seq - Constructed sequence entries, part 45.
454. gbcon46.seq - Constructed sequence entries, part 46.
455. gbcon47.seq - Constructed sequence entries, part 47.
456. gbcon48.seq - Constructed sequence entries, part 48.
457. gbcon49.seq - Constructed sequence entries, part 49.
458. gbcon5.seq - Constructed sequence entries, part 5.
459. gbcon50.seq - Constructed sequence entries, part 50.
460. gbcon51.seq - Constructed sequence entries, part 51.
461. gbcon52.seq - Constructed sequence entries, part 52.
462. gbcon53.seq - Constructed sequence entries, part 53.
463. gbcon54.seq - Constructed sequence entries, part 54.
464. gbcon55.seq - Constructed sequence entries, part 55.
465. gbcon56.seq - Constructed sequence entries, part 56.
466. gbcon57.seq - Constructed sequence entries, part 57.
467. gbcon58.seq - Constructed sequence entries, part 58.
468. gbcon59.seq - Constructed sequence entries, part 59.
469. gbcon6.seq - Constructed sequence entries, part 6.
470. gbcon60.seq - Constructed sequence entries, part 60.
471. gbcon61.seq - Constructed sequence entries, part 61.
472. gbcon62.seq - Constructed sequence entries, part 62.
473. gbcon63.seq - Constructed sequence entries, part 63.
474. gbcon64.seq - Constructed sequence entries, part 64.
475. gbcon65.seq - Constructed sequence entries, part 65.
476. gbcon66.seq - Constructed sequence entries, part 66.
477. gbcon67.seq - Constructed sequence entries, part 67.
478. gbcon68.seq - Constructed sequence entries, part 68.
479. gbcon7.seq - Constructed sequence entries, part 7.
480. gbcon8.seq - Constructed sequence entries, part 8.
481. gbcon9.seq - Constructed sequence entries, part 9.
482. gbdel.txt - Accession numbers of entries deleted since the previous release.
483. gbenv1.seq - Environmental sampling sequence entries, part 1.
484. gbenv10.seq - Environmental sampling sequence entries, part 10.
485. gbenv11.seq - Environmental sampling sequence entries, part 11.
486. gbenv12.seq - Environmental sampling sequence entries, part 12.
487. gbenv13.seq - Environmental sampling sequence entries, part 13.
488. gbenv14.seq - Environmental sampling sequence entries, part 14.
489. gbenv15.seq - Environmental sampling sequence entries, part 15.
490. gbenv16.seq - Environmental sampling sequence entries, part 16.
491. gbenv17.seq - Environmental sampling sequence entries, part 17.
492. gbenv18.seq - Environmental sampling sequence entries, part 18.
493. gbenv19.seq - Environmental sampling sequence entries, part 19.
494. gbenv2.seq - Environmental sampling sequence entries, part 2.
495. gbenv20.seq - Environmental sampling sequence entries, part 20.
496. gbenv21.seq - Environmental sampling sequence entries, part 21.
497. gbenv22.seq - Environmental sampling sequence entries, part 22.
498. gbenv23.seq - Environmental sampling sequence entries, part 23.
499. gbenv24.seq - Environmental sampling sequence entries, part 24.
500. gbenv25.seq - Environmental sampling sequence entries, part 25.
501. gbenv26.seq - Environmental sampling sequence entries, part 26.
502. gbenv27.seq - Environmental sampling sequence entries, part 27.
503. gbenv3.seq - Environmental sampling sequence entries, part 3.
504. gbenv4.seq - Environmental sampling sequence entries, part 4.
505. gbenv5.seq - Environmental sampling sequence entries, part 5.
506. gbenv6.seq - Environmental sampling sequence entries, part 6.
507. gbenv7.seq - Environmental sampling sequence entries, part 7.
508. gbenv8.seq - Environmental sampling sequence entries, part 8.
509. gbenv9.seq - Environmental sampling sequence entries, part 9.
510. gbest1.seq - EST (expressed sequence tag) sequence entries, part 1.
511. gbest10.seq - EST (expressed sequence tag) sequence entries, part 10.
512. gbest100.seq - EST (expressed sequence tag) sequence entries, part 100.
513. gbest101.seq - EST (expressed sequence tag) sequence entries, part 101.
514. gbest102.seq - EST (expressed sequence tag) sequence entries, part 102.
515. gbest103.seq - EST (expressed sequence tag) sequence entries, part 103.
516. gbest104.seq - EST (expressed sequence tag) sequence entries, part 104.
517. gbest105.seq - EST (expressed sequence tag) sequence entries, part 105.
518. gbest106.seq - EST (expressed sequence tag) sequence entries, part 106.
519. gbest107.seq - EST (expressed sequence tag) sequence entries, part 107.
520. gbest108.seq - EST (expressed sequence tag) sequence entries, part 108.
521. gbest109.seq - EST (expressed sequence tag) sequence entries, part 109.
522. gbest11.seq - EST (expressed sequence tag) sequence entries, part 11.
523. gbest110.seq - EST (expressed sequence tag) sequence entries, part 110.
524. gbest111.seq - EST (expressed sequence tag) sequence entries, part 111.
525. gbest112.seq - EST (expressed sequence tag) sequence entries, part 112.
526. gbest113.seq - EST (expressed sequence tag) sequence entries, part 113.
527. gbest114.seq - EST (expressed sequence tag) sequence entries, part 114.
528. gbest115.seq - EST (expressed sequence tag) sequence entries, part 115.
529. gbest116.seq - EST (expressed sequence tag) sequence entries, part 116.
530. gbest117.seq - EST (expressed sequence tag) sequence entries, part 117.
531. gbest118.seq - EST (expressed sequence tag) sequence entries, part 118.
532. gbest119.seq - EST (expressed sequence tag) sequence entries, part 119.
533. gbest12.seq - EST (expressed sequence tag) sequence entries, part 12.
534. gbest120.seq - EST (expressed sequence tag) sequence entries, part 120.
535. gbest121.seq - EST (expressed sequence tag) sequence entries, part 121.
536. gbest122.seq - EST (expressed sequence tag) sequence entries, part 122.
537. gbest123.seq - EST (expressed sequence tag) sequence entries, part 123.
538. gbest124.seq - EST (expressed sequence tag) sequence entries, part 124.
539. gbest125.seq - EST (expressed sequence tag) sequence entries, part 125.
540. gbest126.seq - EST (expressed sequence tag) sequence entries, part 126.
541. gbest127.seq - EST (expressed sequence tag) sequence entries, part 127.
542. gbest128.seq - EST (expressed sequence tag) sequence entries, part 128.
543. gbest129.seq - EST (expressed sequence tag) sequence entries, part 129.
544. gbest13.seq - EST (expressed sequence tag) sequence entries, part 13.
545. gbest130.seq - EST (expressed sequence tag) sequence entries, part 130.
546. gbest131.seq - EST (expressed sequence tag) sequence entries, part 131.
547. gbest132.seq - EST (expressed sequence tag) sequence entries, part 132.
548. gbest133.seq - EST (expressed sequence tag) sequence entries, part 133.
549. gbest134.seq - EST (expressed sequence tag) sequence entries, part 134.
550. gbest135.seq - EST (expressed sequence tag) sequence entries, part 135.
551. gbest136.seq - EST (expressed sequence tag) sequence entries, part 136.
552. gbest137.seq - EST (expressed sequence tag) sequence entries, part 137.
553. gbest138.seq - EST (expressed sequence tag) sequence entries, part 138.
554. gbest139.seq - EST (expressed sequence tag) sequence entries, part 139.
555. gbest14.seq - EST (expressed sequence tag) sequence entries, part 14.
556. gbest140.seq - EST (expressed sequence tag) sequence entries, part 140.
557. gbest141.seq - EST (expressed sequence tag) sequence entries, part 141.
558. gbest142.seq - EST (expressed sequence tag) sequence entries, part 142.
559. gbest143.seq - EST (expressed sequence tag) sequence entries, part 143.
560. gbest144.seq - EST (expressed sequence tag) sequence entries, part 144.
561. gbest145.seq - EST (expressed sequence tag) sequence entries, part 145.
562. gbest146.seq - EST (expressed sequence tag) sequence entries, part 146.
563. gbest147.seq - EST (expressed sequence tag) sequence entries, part 147.
564. gbest148.seq - EST (expressed sequence tag) sequence entries, part 148.
565. gbest149.seq - EST (expressed sequence tag) sequence entries, part 149.
566. gbest15.seq - EST (expressed sequence tag) sequence entries, part 15.
567. gbest150.seq - EST (expressed sequence tag) sequence entries, part 150.
568. gbest151.seq - EST (expressed sequence tag) sequence entries, part 151.
569. gbest152.seq - EST (expressed sequence tag) sequence entries, part 152.
570. gbest153.seq - EST (expressed sequence tag) sequence entries, part 153.
571. gbest154.seq - EST (expressed sequence tag) sequence entries, part 154.
572. gbest155.seq - EST (expressed sequence tag) sequence entries, part 155.
573. gbest156.seq - EST (expressed sequence tag) sequence entries, part 156.
574. gbest157.seq - EST (expressed sequence tag) sequence entries, part 157.
575. gbest158.seq - EST (expressed sequence tag) sequence entries, part 158.
576. gbest159.seq - EST (expressed sequence tag) sequence entries, part 159.
577. gbest16.seq - EST (expressed sequence tag) sequence entries, part 16.
578. gbest160.seq - EST (expressed sequence tag) sequence entries, part 160.
579. gbest161.seq - EST (expressed sequence tag) sequence entries, part 161.
580. gbest162.seq - EST (expressed sequence tag) sequence entries, part 162.
581. gbest163.seq - EST (expressed sequence tag) sequence entries, part 163.
582. gbest164.seq - EST (expressed sequence tag) sequence entries, part 164.
583. gbest17.seq - EST (expressed sequence tag) sequence entries, part 17.
584. gbest18.seq - EST (expressed sequence tag) sequence entries, part 18.
585. gbest19.seq - EST (expressed sequence tag) sequence entries, part 19.
586. gbest2.seq - EST (expressed sequence tag) sequence entries, part 2.
587. gbest20.seq - EST (expressed sequence tag) sequence entries, part 20.
588. gbest21.seq - EST (expressed sequence tag) sequence entries, part 21.
589. gbest22.seq - EST (expressed sequence tag) sequence entries, part 22.
590. gbest23.seq - EST (expressed sequence tag) sequence entries, part 23.
591. gbest24.seq - EST (expressed sequence tag) sequence entries, part 24.
592. gbest25.seq - EST (expressed sequence tag) sequence entries, part 25.
593. gbest26.seq - EST (expressed sequence tag) sequence entries, part 26.
594. gbest27.seq - EST (expressed sequence tag) sequence entries, part 27.
595. gbest28.seq - EST (expressed sequence tag) sequence entries, part 28.
596. gbest29.seq - EST (expressed sequence tag) sequence entries, part 29.
597. gbest3.seq - EST (expressed sequence tag) sequence entries, part 3.
598. gbest30.seq - EST (expressed sequence tag) sequence entries, part 30.
599. gbest31.seq - EST (expressed sequence tag) sequence entries, part 31.
600. gbest32.seq - EST (expressed sequence tag) sequence entries, part 32.
601. gbest33.seq - EST (expressed sequence tag) sequence entries, part 33.
602. gbest34.seq - EST (expressed sequence tag) sequence entries, part 34.
603. gbest35.seq - EST (expressed sequence tag) sequence entries, part 35.
604. gbest36.seq - EST (expressed sequence tag) sequence entries, part 36.
605. gbest37.seq - EST (expressed sequence tag) sequence entries, part 37.
606. gbest38.seq - EST (expressed sequence tag) sequence entries, part 38.
607. gbest39.seq - EST (expressed sequence tag) sequence entries, part 39.
608. gbest4.seq - EST (expressed sequence tag) sequence entries, part 4.
609. gbest40.seq - EST (expressed sequence tag) sequence entries, part 40.
610. gbest41.seq - EST (expressed sequence tag) sequence entries, part 41.
611. gbest42.seq - EST (expressed sequence tag) sequence entries, part 42.
612. gbest43.seq - EST (expressed sequence tag) sequence entries, part 43.
613. gbest44.seq - EST (expressed sequence tag) sequence entries, part 44.
614. gbest45.seq - EST (expressed sequence tag) sequence entries, part 45.
615. gbest46.seq - EST (expressed sequence tag) sequence entries, part 46.
616. gbest47.seq - EST (expressed sequence tag) sequence entries, part 47.
617. gbest48.seq - EST (expressed sequence tag) sequence entries, part 48.
618. gbest49.seq - EST (expressed sequence tag) sequence entries, part 49.
619. gbest5.seq - EST (expressed sequence tag) sequence entries, part 5.
620. gbest50.seq - EST (expressed sequence tag) sequence entries, part 50.
621. gbest51.seq - EST (expressed sequence tag) sequence entries, part 51.
622. gbest52.seq - EST (expressed sequence tag) sequence entries, part 52.
623. gbest53.seq - EST (expressed sequence tag) sequence entries, part 53.
624. gbest54.seq - EST (expressed sequence tag) sequence entries, part 54.
625. gbest55.seq - EST (expressed sequence tag) sequence entries, part 55.
626. gbest56.seq - EST (expressed sequence tag) sequence entries, part 56.
627. gbest57.seq - EST (expressed sequence tag) sequence entries, part 57.
628. gbest58.seq - EST (expressed sequence tag) sequence entries, part 58.
629. gbest59.seq - EST (expressed sequence tag) sequence entries, part 59.
630. gbest6.seq - EST (expressed sequence tag) sequence entries, part 6.
631. gbest60.seq - EST (expressed sequence tag) sequence entries, part 60.
632. gbest61.seq - EST (expressed sequence tag) sequence entries, part 61.
633. gbest62.seq - EST (expressed sequence tag) sequence entries, part 62.
634. gbest63.seq - EST (expressed sequence tag) sequence entries, part 63.
635. gbest64.seq - EST (expressed sequence tag) sequence entries, part 64.
636. gbest65.seq - EST (expressed sequence tag) sequence entries, part 65.
637. gbest66.seq - EST (expressed sequence tag) sequence entries, part 66.
638. gbest67.seq - EST (expressed sequence tag) sequence entries, part 67.
639. gbest68.seq - EST (expressed sequence tag) sequence entries, part 68.
640. gbest69.seq - EST (expressed sequence tag) sequence entries, part 69.
641. gbest7.seq - EST (expressed sequence tag) sequence entries, part 7.
642. gbest70.seq - EST (expressed sequence tag) sequence entries, part 70.
643. gbest71.seq - EST (expressed sequence tag) sequence entries, part 71.
644. gbest72.seq - EST (expressed sequence tag) sequence entries, part 72.
645. gbest73.seq - EST (expressed sequence tag) sequence entries, part 73.
646. gbest74.seq - EST (expressed sequence tag) sequence entries, part 74.
647. gbest75.seq - EST (expressed sequence tag) sequence entries, part 75.
648. gbest76.seq - EST (expressed sequence tag) sequence entries, part 76.
649. gbest77.seq - EST (expressed sequence tag) sequence entries, part 77.
650. gbest78.seq - EST (expressed sequence tag) sequence entries, part 78.
651. gbest79.seq - EST (expressed sequence tag) sequence entries, part 79.
652. gbest8.seq - EST (expressed sequence tag) sequence entries, part 8.
653. gbest80.seq - EST (expressed sequence tag) sequence entries, part 80.
654. gbest81.seq - EST (expressed sequence tag) sequence entries, part 81.
655. gbest82.seq - EST (expressed sequence tag) sequence entries, part 82.
656. gbest83.seq - EST (expressed sequence tag) sequence entries, part 83.
657. gbest84.seq - EST (expressed sequence tag) sequence entries, part 84.
658. gbest85.seq - EST (expressed sequence tag) sequence entries, part 85.
659. gbest86.seq - EST (expressed sequence tag) sequence entries, part 86.
660. gbest87.seq - EST (expressed sequence tag) sequence entries, part 87.
661. gbest88.seq - EST (expressed sequence tag) sequence entries, part 88.
662. gbest89.seq - EST (expressed sequence tag) sequence entries, part 89.
663. gbest9.seq - EST (expressed sequence tag) sequence entries, part 9.
664. gbest90.seq - EST (expressed sequence tag) sequence entries, part 90.
665. gbest91.seq - EST (expressed sequence tag) sequence entries, part 91.
666. gbest92.seq - EST (expressed sequence tag) sequence entries, part 92.
667. gbest93.seq - EST (expressed sequence tag) sequence entries, part 93.
668. gbest94.seq - EST (expressed sequence tag) sequence entries, part 94.
669. gbest95.seq - EST (expressed sequence tag) sequence entries, part 95.
670. gbest96.seq - EST (expressed sequence tag) sequence entries, part 96.
671. gbest97.seq - EST (expressed sequence tag) sequence entries, part 97.
672. gbest98.seq - EST (expressed sequence tag) sequence entries, part 98.
673. gbest99.seq - EST (expressed sequence tag) sequence entries, part 99.
674. gbgss1.seq - GSS (genome survey sequence) sequence entries, part 1.
675. gbgss10.seq - GSS (genome survey sequence) sequence entries, part 10.
676. gbgss11.seq - GSS (genome survey sequence) sequence entries, part 11.
677. gbgss12.seq - GSS (genome survey sequence) sequence entries, part 12.
678. gbgss13.seq - GSS (genome survey sequence) sequence entries, part 13.
679. gbgss14.seq - GSS (genome survey sequence) sequence entries, part 14.
680. gbgss15.seq - GSS (genome survey sequence) sequence entries, part 15.
681. gbgss16.seq - GSS (genome survey sequence) sequence entries, part 16.
682. gbgss17.seq - GSS (genome survey sequence) sequence entries, part 17.
683. gbgss18.seq - GSS (genome survey sequence) sequence entries, part 18.
684. gbgss19.seq - GSS (genome survey sequence) sequence entries, part 19.
685. gbgss2.seq - GSS (genome survey sequence) sequence entries, part 2.
686. gbgss20.seq - GSS (genome survey sequence) sequence entries, part 20.
687. gbgss21.seq - GSS (genome survey sequence) sequence entries, part 21.
688. gbgss22.seq - GSS (genome survey sequence) sequence entries, part 22.
689. gbgss23.seq - GSS (genome survey sequence) sequence entries, part 23.
690. gbgss24.seq - GSS (genome survey sequence) sequence entries, part 24.
691. gbgss25.seq - GSS (genome survey sequence) sequence entries, part 25.
692. gbgss26.seq - GSS (genome survey sequence) sequence entries, part 26.
693. gbgss27.seq - GSS (genome survey sequence) sequence entries, part 27.
694. gbgss28.seq - GSS (genome survey sequence) sequence entries, part 28.
695. gbgss29.seq - GSS (genome survey sequence) sequence entries, part 29.
696. gbgss3.seq - GSS (genome survey sequence) sequence entries, part 3.
697. gbgss30.seq - GSS (genome survey sequence) sequence entries, part 30.
698. gbgss31.seq - GSS (genome survey sequence) sequence entries, part 31.
699. gbgss32.seq - GSS (genome survey sequence) sequence entries, part 32.
700. gbgss33.seq - GSS (genome survey sequence) sequence entries, part 33.
701. gbgss34.seq - GSS (genome survey sequence) sequence entries, part 34.
702. gbgss35.seq - GSS (genome survey sequence) sequence entries, part 35.
703. gbgss36.seq - GSS (genome survey sequence) sequence entries, part 36.
704. gbgss37.seq - GSS (genome survey sequence) sequence entries, part 37.
705. gbgss38.seq - GSS (genome survey sequence) sequence entries, part 38.
706. gbgss39.seq - GSS (genome survey sequence) sequence entries, part 39.
707. gbgss4.seq - GSS (genome survey sequence) sequence entries, part 4.
708. gbgss40.seq - GSS (genome survey sequence) sequence entries, part 40.
709. gbgss41.seq - GSS (genome survey sequence) sequence entries, part 41.
710. gbgss42.seq - GSS (genome survey sequence) sequence entries, part 42.
711. gbgss43.seq - GSS (genome survey sequence) sequence entries, part 43.
712. gbgss44.seq - GSS (genome survey sequence) sequence entries, part 44.
713. gbgss45.seq - GSS (genome survey sequence) sequence entries, part 45.
714. gbgss46.seq - GSS (genome survey sequence) sequence entries, part 46.
715. gbgss47.seq - GSS (genome survey sequence) sequence entries, part 47.
716. gbgss48.seq - GSS (genome survey sequence) sequence entries, part 48.
717. gbgss49.seq - GSS (genome survey sequence) sequence entries, part 49.
718. gbgss5.seq - GSS (genome survey sequence) sequence entries, part 5.
719. gbgss50.seq - GSS (genome survey sequence) sequence entries, part 50.
720. gbgss51.seq - GSS (genome survey sequence) sequence entries, part 51.
721. gbgss52.seq - GSS (genome survey sequence) sequence entries, part 52.
722. gbgss53.seq - GSS (genome survey sequence) sequence entries, part 53.
723. gbgss54.seq - GSS (genome survey sequence) sequence entries, part 54.
724. gbgss55.seq - GSS (genome survey sequence) sequence entries, part 55.
725. gbgss56.seq - GSS (genome survey sequence) sequence entries, part 56.
726. gbgss57.seq - GSS (genome survey sequence) sequence entries, part 57.
727. gbgss58.seq - GSS (genome survey sequence) sequence entries, part 58.
728. gbgss59.seq - GSS (genome survey sequence) sequence entries, part 59.
729. gbgss6.seq - GSS (genome survey sequence) sequence entries, part 6.
730. gbgss60.seq - GSS (genome survey sequence) sequence entries, part 60.
731. gbgss61.seq - GSS (genome survey sequence) sequence entries, part 61.
732. gbgss62.seq - GSS (genome survey sequence) sequence entries, part 62.
733. gbgss63.seq - GSS (genome survey sequence) sequence entries, part 63.
734. gbgss64.seq - GSS (genome survey sequence) sequence entries, part 64.
735. gbgss65.seq - GSS (genome survey sequence) sequence entries, part 65.
736. gbgss66.seq - GSS (genome survey sequence) sequence entries, part 66.
737. gbgss67.seq - GSS (genome survey sequence) sequence entries, part 67.
738. gbgss68.seq - GSS (genome survey sequence) sequence entries, part 68.
739. gbgss69.seq - GSS (genome survey sequence) sequence entries, part 69.
740. gbgss7.seq - GSS (genome survey sequence) sequence entries, part 7.
741. gbgss70.seq - GSS (genome survey sequence) sequence entries, part 70.
742. gbgss71.seq - GSS (genome survey sequence) sequence entries, part 71.
743. gbgss72.seq - GSS (genome survey sequence) sequence entries, part 72.
744. gbgss73.seq - GSS (genome survey sequence) sequence entries, part 73.
745. gbgss74.seq - GSS (genome survey sequence) sequence entries, part 74.
746. gbgss75.seq - GSS (genome survey sequence) sequence entries, part 75.
747. gbgss76.seq - GSS (genome survey sequence) sequence entries, part 76.
748. gbgss77.seq - GSS (genome survey sequence) sequence entries, part 77.
749. gbgss78.seq - GSS (genome survey sequence) sequence entries, part 78.
750. gbgss79.seq - GSS (genome survey sequence) sequence entries, part 79.
751. gbgss8.seq - GSS (genome survey sequence) sequence entries, part 8.
752. gbgss9.seq - GSS (genome survey sequence) sequence entries, part 9.
753. gbhtc1.seq - HTC (high throughput cDNA sequencing) sequence entries, part 1.
754. gbhtc2.seq - HTC (high throughput cDNA sequencing) sequence entries, part 2.
755. gbhtc3.seq - HTC (high throughput cDNA sequencing) sequence entries, part 3.
756. gbhtg1.seq - HTGS (high throughput genomic sequencing) sequence entries, part 1.
757. gbhtg10.seq - HTGS (high throughput genomic sequencing) sequence entries, part 10.
758. gbhtg11.seq - HTGS (high throughput genomic sequencing) sequence entries, part 11.
759. gbhtg12.seq - HTGS (high throughput genomic sequencing) sequence entries, part 12.
760. gbhtg13.seq - HTGS (high throughput genomic sequencing) sequence entries, part 13.
761. gbhtg14.seq - HTGS (high throughput genomic sequencing) sequence entries, part 14.
762. gbhtg15.seq - HTGS (high throughput genomic sequencing) sequence entries, part 15.
763. gbhtg16.seq - HTGS (high throughput genomic sequencing) sequence entries, part 16.
764. gbhtg17.seq - HTGS (high throughput genomic sequencing) sequence entries, part 17.
765. gbhtg18.seq - HTGS (high throughput genomic sequencing) sequence entries, part 18.
766. gbhtg19.seq - HTGS (high throughput genomic sequencing) sequence entries, part 19.
767. gbhtg2.seq - HTGS (high throughput genomic sequencing) sequence entries, part 2.
768. gbhtg20.seq - HTGS (high throughput genomic sequencing) sequence entries, part 20.
769. gbhtg21.seq - HTGS (high throughput genomic sequencing) sequence entries, part 21.
770. gbhtg22.seq - HTGS (high throughput genomic sequencing) sequence entries, part 22.
771. gbhtg23.seq - HTGS (high throughput genomic sequencing) sequence entries, part 23.
772. gbhtg24.seq - HTGS (high throughput genomic sequencing) sequence entries, part 24.
773. gbhtg25.seq - HTGS (high throughput genomic sequencing) sequence entries, part 25.
774. gbhtg3.seq - HTGS (high throughput genomic sequencing) sequence entries, part 3.
775. gbhtg4.seq - HTGS (high throughput genomic sequencing) sequence entries, part 4.
776. gbhtg5.seq - HTGS (high throughput genomic sequencing) sequence entries, part 5.
777. gbhtg6.seq - HTGS (high throughput genomic sequencing) sequence entries, part 6.
778. gbhtg7.seq - HTGS (high throughput genomic sequencing) sequence entries, part 7.
779. gbhtg8.seq - HTGS (high throughput genomic sequencing) sequence entries, part 8.
780. gbhtg9.seq - HTGS (high throughput genomic sequencing) sequence entries, part 9.
781. gbinv1.seq - Invertebrate sequence entries, part 1.
782. gbinv10.seq - Invertebrate sequence entries, part 10.
783. gbinv100.seq - Invertebrate sequence entries, part 100.
784. gbinv1000.seq - Invertebrate sequence entries, part 1000.
785. gbinv1001.seq - Invertebrate sequence entries, part 1001.
786. gbinv1002.seq - Invertebrate sequence entries, part 1002.
787. gbinv1003.seq - Invertebrate sequence entries, part 1003.
788. gbinv1004.seq - Invertebrate sequence entries, part 1004.
789. gbinv1005.seq - Invertebrate sequence entries, part 1005.
790. gbinv1006.seq - Invertebrate sequence entries, part 1006.
791. gbinv1007.seq - Invertebrate sequence entries, part 1007.
792. gbinv1008.seq - Invertebrate sequence entries, part 1008.
793. gbinv1009.seq - Invertebrate sequence entries, part 1009.
794. gbinv101.seq - Invertebrate sequence entries, part 101.
795. gbinv1010.seq - Invertebrate sequence entries, part 1010.
796. gbinv1011.seq - Invertebrate sequence entries, part 1011.
797. gbinv1012.seq - Invertebrate sequence entries, part 1012.
798. gbinv1013.seq - Invertebrate sequence entries, part 1013.
799. gbinv1014.seq - Invertebrate sequence entries, part 1014.
800. gbinv1015.seq - Invertebrate sequence entries, part 1015.
801. gbinv1016.seq - Invertebrate sequence entries, part 1016.
802. gbinv1017.seq - Invertebrate sequence entries, part 1017.
803. gbinv1018.seq - Invertebrate sequence entries, part 1018.
804. gbinv1019.seq - Invertebrate sequence entries, part 1019.
805. gbinv102.seq - Invertebrate sequence entries, part 102.
806. gbinv1020.seq - Invertebrate sequence entries, part 1020.
807. gbinv1021.seq - Invertebrate sequence entries, part 1021.
808. gbinv1022.seq - Invertebrate sequence entries, part 1022.
809. gbinv1023.seq - Invertebrate sequence entries, part 1023.
810. gbinv1024.seq - Invertebrate sequence entries, part 1024.
811. gbinv1025.seq - Invertebrate sequence entries, part 1025.
812. gbinv1026.seq - Invertebrate sequence entries, part 1026.
813. gbinv1027.seq - Invertebrate sequence entries, part 1027.
814. gbinv1028.seq - Invertebrate sequence entries, part 1028.
815. gbinv1029.seq - Invertebrate sequence entries, part 1029.
816. gbinv103.seq - Invertebrate sequence entries, part 103.
817. gbinv1030.seq - Invertebrate sequence entries, part 1030.
818. gbinv1031.seq - Invertebrate sequence entries, part 1031.
819. gbinv1032.seq - Invertebrate sequence entries, part 1032.
820. gbinv1033.seq - Invertebrate sequence entries, part 1033.
821. gbinv1034.seq - Invertebrate sequence entries, part 1034.
822. gbinv1035.seq - Invertebrate sequence entries, part 1035.
823. gbinv1036.seq - Invertebrate sequence entries, part 1036.
824. gbinv1037.seq - Invertebrate sequence entries, part 1037.
825. gbinv1038.seq - Invertebrate sequence entries, part 1038.
826. gbinv1039.seq - Invertebrate sequence entries, part 1039.
827. gbinv104.seq - Invertebrate sequence entries, part 104.
828. gbinv1040.seq - Invertebrate sequence entries, part 1040.
829. gbinv1041.seq - Invertebrate sequence entries, part 1041.
830. gbinv1042.seq - Invertebrate sequence entries, part 1042.
831. gbinv1043.seq - Invertebrate sequence entries, part 1043.
832. gbinv1044.seq - Invertebrate sequence entries, part 1044.
833. gbinv1045.seq - Invertebrate sequence entries, part 1045.
834. gbinv1046.seq - Invertebrate sequence entries, part 1046.
835. gbinv1047.seq - Invertebrate sequence entries, part 1047.
836. gbinv1048.seq - Invertebrate sequence entries, part 1048.
837. gbinv1049.seq - Invertebrate sequence entries, part 1049.
838. gbinv105.seq - Invertebrate sequence entries, part 105.
839. gbinv1050.seq - Invertebrate sequence entries, part 1050.
840. gbinv1051.seq - Invertebrate sequence entries, part 1051.
841. gbinv1052.seq - Invertebrate sequence entries, part 1052.
842. gbinv1053.seq - Invertebrate sequence entries, part 1053.
843. gbinv1054.seq - Invertebrate sequence entries, part 1054.
844. gbinv1055.seq - Invertebrate sequence entries, part 1055.
845. gbinv1056.seq - Invertebrate sequence entries, part 1056.
846. gbinv1057.seq - Invertebrate sequence entries, part 1057.
847. gbinv1058.seq - Invertebrate sequence entries, part 1058.
848. gbinv1059.seq - Invertebrate sequence entries, part 1059.
849. gbinv106.seq - Invertebrate sequence entries, part 106.
850. gbinv1060.seq - Invertebrate sequence entries, part 1060.
851. gbinv1061.seq - Invertebrate sequence entries, part 1061.
852. gbinv1062.seq - Invertebrate sequence entries, part 1062.
853. gbinv1063.seq - Invertebrate sequence entries, part 1063.
854. gbinv1064.seq - Invertebrate sequence entries, part 1064.
855. gbinv1065.seq - Invertebrate sequence entries, part 1065.
856. gbinv1066.seq - Invertebrate sequence entries, part 1066.
857. gbinv1067.seq - Invertebrate sequence entries, part 1067.
858. gbinv1068.seq - Invertebrate sequence entries, part 1068.
859. gbinv1069.seq - Invertebrate sequence entries, part 1069.
860. gbinv107.seq - Invertebrate sequence entries, part 107.
861. gbinv1070.seq - Invertebrate sequence entries, part 1070.
862. gbinv1071.seq - Invertebrate sequence entries, part 1071.
863. gbinv1072.seq - Invertebrate sequence entries, part 1072.
864. gbinv1073.seq - Invertebrate sequence entries, part 1073.
865. gbinv1074.seq - Invertebrate sequence entries, part 1074.
866. gbinv1075.seq - Invertebrate sequence entries, part 1075.
867. gbinv1076.seq - Invertebrate sequence entries, part 1076.
868. gbinv1077.seq - Invertebrate sequence entries, part 1077.
869. gbinv1078.seq - Invertebrate sequence entries, part 1078.
870. gbinv1079.seq - Invertebrate sequence entries, part 1079.
871. gbinv108.seq - Invertebrate sequence entries, part 108.
872. gbinv1080.seq - Invertebrate sequence entries, part 1080.
873. gbinv1081.seq - Invertebrate sequence entries, part 1081.
874. gbinv1082.seq - Invertebrate sequence entries, part 1082.
875. gbinv109.seq - Invertebrate sequence entries, part 109.
876. gbinv11.seq - Invertebrate sequence entries, part 11.
877. gbinv110.seq - Invertebrate sequence entries, part 110.
878. gbinv111.seq - Invertebrate sequence entries, part 111.
879. gbinv112.seq - Invertebrate sequence entries, part 112.
880. gbinv113.seq - Invertebrate sequence entries, part 113.
881. gbinv114.seq - Invertebrate sequence entries, part 114.
882. gbinv115.seq - Invertebrate sequence entries, part 115.
883. gbinv116.seq - Invertebrate sequence entries, part 116.
884. gbinv117.seq - Invertebrate sequence entries, part 117.
885. gbinv118.seq - Invertebrate sequence entries, part 118.
886. gbinv119.seq - Invertebrate sequence entries, part 119.
887. gbinv12.seq - Invertebrate sequence entries, part 12.
888. gbinv120.seq - Invertebrate sequence entries, part 120.
889. gbinv121.seq - Invertebrate sequence entries, part 121.
890. gbinv122.seq - Invertebrate sequence entries, part 122.
891. gbinv123.seq - Invertebrate sequence entries, part 123.
892. gbinv124.seq - Invertebrate sequence entries, part 124.
893. gbinv125.seq - Invertebrate sequence entries, part 125.
894. gbinv126.seq - Invertebrate sequence entries, part 126.
895. gbinv127.seq - Invertebrate sequence entries, part 127.
896. gbinv128.seq - Invertebrate sequence entries, part 128.
897. gbinv129.seq - Invertebrate sequence entries, part 129.
898. gbinv13.seq - Invertebrate sequence entries, part 13.
899. gbinv130.seq - Invertebrate sequence entries, part 130.
900. gbinv131.seq - Invertebrate sequence entries, part 131.
901. gbinv132.seq - Invertebrate sequence entries, part 132.
902. gbinv133.seq - Invertebrate sequence entries, part 133.
903. gbinv134.seq - Invertebrate sequence entries, part 134.
904. gbinv135.seq - Invertebrate sequence entries, part 135.
905. gbinv136.seq - Invertebrate sequence entries, part 136.
906. gbinv137.seq - Invertebrate sequence entries, part 137.
907. gbinv138.seq - Invertebrate sequence entries, part 138.
908. gbinv139.seq - Invertebrate sequence entries, part 139.
909. gbinv14.seq - Invertebrate sequence entries, part 14.
910. gbinv140.seq - Invertebrate sequence entries, part 140.
911. gbinv141.seq - Invertebrate sequence entries, part 141.
912. gbinv142.seq - Invertebrate sequence entries, part 142.
913. gbinv143.seq - Invertebrate sequence entries, part 143.
914. gbinv144.seq - Invertebrate sequence entries, part 144.
915. gbinv145.seq - Invertebrate sequence entries, part 145.
916. gbinv146.seq - Invertebrate sequence entries, part 146.
917. gbinv147.seq - Invertebrate sequence entries, part 147.
918. gbinv148.seq - Invertebrate sequence entries, part 148.
919. gbinv149.seq - Invertebrate sequence entries, part 149.
920. gbinv15.seq - Invertebrate sequence entries, part 15.
921. gbinv150.seq - Invertebrate sequence entries, part 150.
922. gbinv151.seq - Invertebrate sequence entries, part 151.
923. gbinv152.seq - Invertebrate sequence entries, part 152.
924. gbinv153.seq - Invertebrate sequence entries, part 153.
925. gbinv154.seq - Invertebrate sequence entries, part 154.
926. gbinv155.seq - Invertebrate sequence entries, part 155.
927. gbinv156.seq - Invertebrate sequence entries, part 156.
928. gbinv157.seq - Invertebrate sequence entries, part 157.
929. gbinv158.seq - Invertebrate sequence entries, part 158.
930. gbinv159.seq - Invertebrate sequence entries, part 159.
931. gbinv16.seq - Invertebrate sequence entries, part 16.
932. gbinv160.seq - Invertebrate sequence entries, part 160.
933. gbinv161.seq - Invertebrate sequence entries, part 161.
934. gbinv162.seq - Invertebrate sequence entries, part 162.
935. gbinv163.seq - Invertebrate sequence entries, part 163.
936. gbinv164.seq - Invertebrate sequence entries, part 164.
937. gbinv165.seq - Invertebrate sequence entries, part 165.
938. gbinv166.seq - Invertebrate sequence entries, part 166.
939. gbinv167.seq - Invertebrate sequence entries, part 167.
940. gbinv168.seq - Invertebrate sequence entries, part 168.
941. gbinv169.seq - Invertebrate sequence entries, part 169.
942. gbinv17.seq - Invertebrate sequence entries, part 17.
943. gbinv170.seq - Invertebrate sequence entries, part 170.
944. gbinv171.seq - Invertebrate sequence entries, part 171.
945. gbinv172.seq - Invertebrate sequence entries, part 172.
946. gbinv173.seq - Invertebrate sequence entries, part 173.
947. gbinv174.seq - Invertebrate sequence entries, part 174.
948. gbinv175.seq - Invertebrate sequence entries, part 175.
949. gbinv176.seq - Invertebrate sequence entries, part 176.
950. gbinv177.seq - Invertebrate sequence entries, part 177.
951. gbinv178.seq - Invertebrate sequence entries, part 178.
952. gbinv179.seq - Invertebrate sequence entries, part 179.
953. gbinv18.seq - Invertebrate sequence entries, part 18.
954. gbinv180.seq - Invertebrate sequence entries, part 180.
955. gbinv181.seq - Invertebrate sequence entries, part 181.
956. gbinv182.seq - Invertebrate sequence entries, part 182.
957. gbinv183.seq - Invertebrate sequence entries, part 183.
958. gbinv184.seq - Invertebrate sequence entries, part 184.
959. gbinv185.seq - Invertebrate sequence entries, part 185.
960. gbinv186.seq - Invertebrate sequence entries, part 186.
961. gbinv187.seq - Invertebrate sequence entries, part 187.
962. gbinv188.seq - Invertebrate sequence entries, part 188.
963. gbinv189.seq - Invertebrate sequence entries, part 189.
964. gbinv19.seq - Invertebrate sequence entries, part 19.
965. gbinv190.seq - Invertebrate sequence entries, part 190.
966. gbinv191.seq - Invertebrate sequence entries, part 191.
967. gbinv192.seq - Invertebrate sequence entries, part 192.
968. gbinv193.seq - Invertebrate sequence entries, part 193.
969. gbinv194.seq - Invertebrate sequence entries, part 194.
970. gbinv195.seq - Invertebrate sequence entries, part 195.
971. gbinv196.seq - Invertebrate sequence entries, part 196.
972. gbinv197.seq - Invertebrate sequence entries, part 197.
973. gbinv198.seq - Invertebrate sequence entries, part 198.
974. gbinv199.seq - Invertebrate sequence entries, part 199.
975. gbinv2.seq - Invertebrate sequence entries, part 2.
976. gbinv20.seq - Invertebrate sequence entries, part 20.
977. gbinv200.seq - Invertebrate sequence entries, part 200.
978. gbinv201.seq - Invertebrate sequence entries, part 201.
979. gbinv202.seq - Invertebrate sequence entries, part 202.
980. gbinv203.seq - Invertebrate sequence entries, part 203.
981. gbinv204.seq - Invertebrate sequence entries, part 204.
982. gbinv205.seq - Invertebrate sequence entries, part 205.
983. gbinv206.seq - Invertebrate sequence entries, part 206.
984. gbinv207.seq - Invertebrate sequence entries, part 207.
985. gbinv208.seq - Invertebrate sequence entries, part 208.
986. gbinv209.seq - Invertebrate sequence entries, part 209.
987. gbinv21.seq - Invertebrate sequence entries, part 21.
988. gbinv210.seq - Invertebrate sequence entries, part 210.
989. gbinv211.seq - Invertebrate sequence entries, part 211.
990. gbinv212.seq - Invertebrate sequence entries, part 212.
991. gbinv213.seq - Invertebrate sequence entries, part 213.
992. gbinv214.seq - Invertebrate sequence entries, part 214.
993. gbinv215.seq - Invertebrate sequence entries, part 215.
994. gbinv216.seq - Invertebrate sequence entries, part 216.
995. gbinv217.seq - Invertebrate sequence entries, part 217.
996. gbinv218.seq - Invertebrate sequence entries, part 218.
997. gbinv219.seq - Invertebrate sequence entries, part 219.
998. gbinv22.seq - Invertebrate sequence entries, part 22.
999. gbinv220.seq - Invertebrate sequence entries, part 220.
1000. gbinv221.seq - Invertebrate sequence entries, part 221.
1001. gbinv222.seq - Invertebrate sequence entries, part 222.
1002. gbinv223.seq - Invertebrate sequence entries, part 223.
1003. gbinv224.seq - Invertebrate sequence entries, part 224.
1004. gbinv225.seq - Invertebrate sequence entries, part 225.
1005. gbinv226.seq - Invertebrate sequence entries, part 226.
1006. gbinv227.seq - Invertebrate sequence entries, part 227.
1007. gbinv228.seq - Invertebrate sequence entries, part 228.
1008. gbinv229.seq - Invertebrate sequence entries, part 229.
1009. gbinv23.seq - Invertebrate sequence entries, part 23.
1010. gbinv230.seq - Invertebrate sequence entries, part 230.
1011. gbinv231.seq - Invertebrate sequence entries, part 231.
1012. gbinv232.seq - Invertebrate sequence entries, part 232.
1013. gbinv233.seq - Invertebrate sequence entries, part 233.
1014. gbinv234.seq - Invertebrate sequence entries, part 234.
1015. gbinv235.seq - Invertebrate sequence entries, part 235.
1016. gbinv236.seq - Invertebrate sequence entries, part 236.
1017. gbinv237.seq - Invertebrate sequence entries, part 237.
1018. gbinv238.seq - Invertebrate sequence entries, part 238.
1019. gbinv239.seq - Invertebrate sequence entries, part 239.
1020. gbinv24.seq - Invertebrate sequence entries, part 24.
1021. gbinv240.seq - Invertebrate sequence entries, part 240.
1022. gbinv241.seq - Invertebrate sequence entries, part 241.
1023. gbinv242.seq - Invertebrate sequence entries, part 242.
1024. gbinv243.seq - Invertebrate sequence entries, part 243.
1025. gbinv244.seq - Invertebrate sequence entries, part 244.
1026. gbinv245.seq - Invertebrate sequence entries, part 245.
1027. gbinv246.seq - Invertebrate sequence entries, part 246.
1028. gbinv247.seq - Invertebrate sequence entries, part 247.
1029. gbinv248.seq - Invertebrate sequence entries, part 248.
1030. gbinv249.seq - Invertebrate sequence entries, part 249.
1031. gbinv25.seq - Invertebrate sequence entries, part 25.
1032. gbinv250.seq - Invertebrate sequence entries, part 250.
1033. gbinv251.seq - Invertebrate sequence entries, part 251.
1034. gbinv252.seq - Invertebrate sequence entries, part 252.
1035. gbinv253.seq - Invertebrate sequence entries, part 253.
1036. gbinv254.seq - Invertebrate sequence entries, part 254.
1037. gbinv255.seq - Invertebrate sequence entries, part 255.
1038. gbinv256.seq - Invertebrate sequence entries, part 256.
1039. gbinv257.seq - Invertebrate sequence entries, part 257.
1040. gbinv258.seq - Invertebrate sequence entries, part 258.
1041. gbinv259.seq - Invertebrate sequence entries, part 259.
1042. gbinv26.seq - Invertebrate sequence entries, part 26.
1043. gbinv260.seq - Invertebrate sequence entries, part 260.
1044. gbinv261.seq - Invertebrate sequence entries, part 261.
1045. gbinv262.seq - Invertebrate sequence entries, part 262.
1046. gbinv263.seq - Invertebrate sequence entries, part 263.
1047. gbinv264.seq - Invertebrate sequence entries, part 264.
1048. gbinv265.seq - Invertebrate sequence entries, part 265.
1049. gbinv266.seq - Invertebrate sequence entries, part 266.
1050. gbinv267.seq - Invertebrate sequence entries, part 267.
1051. gbinv268.seq - Invertebrate sequence entries, part 268.
1052. gbinv269.seq - Invertebrate sequence entries, part 269.
1053. gbinv27.seq - Invertebrate sequence entries, part 27.
1054. gbinv270.seq - Invertebrate sequence entries, part 270.
1055. gbinv271.seq - Invertebrate sequence entries, part 271.
1056. gbinv272.seq - Invertebrate sequence entries, part 272.
1057. gbinv273.seq - Invertebrate sequence entries, part 273.
1058. gbinv274.seq - Invertebrate sequence entries, part 274.
1059. gbinv275.seq - Invertebrate sequence entries, part 275.
1060. gbinv276.seq - Invertebrate sequence entries, part 276.
1061. gbinv277.seq - Invertebrate sequence entries, part 277.
1062. gbinv278.seq - Invertebrate sequence entries, part 278.
1063. gbinv279.seq - Invertebrate sequence entries, part 279.
1064. gbinv28.seq - Invertebrate sequence entries, part 28.
1065. gbinv280.seq - Invertebrate sequence entries, part 280.
1066. gbinv281.seq - Invertebrate sequence entries, part 281.
1067. gbinv282.seq - Invertebrate sequence entries, part 282.
1068. gbinv283.seq - Invertebrate sequence entries, part 283.
1069. gbinv284.seq - Invertebrate sequence entries, part 284.
1070. gbinv285.seq - Invertebrate sequence entries, part 285.
1071. gbinv286.seq - Invertebrate sequence entries, part 286.
1072. gbinv287.seq - Invertebrate sequence entries, part 287.
1073. gbinv288.seq - Invertebrate sequence entries, part 288.
1074. gbinv289.seq - Invertebrate sequence entries, part 289.
1075. gbinv29.seq - Invertebrate sequence entries, part 29.
1076. gbinv290.seq - Invertebrate sequence entries, part 290.
1077. gbinv291.seq - Invertebrate sequence entries, part 291.
1078. gbinv292.seq - Invertebrate sequence entries, part 292.
1079. gbinv293.seq - Invertebrate sequence entries, part 293.
1080. gbinv294.seq - Invertebrate sequence entries, part 294.
1081. gbinv295.seq - Invertebrate sequence entries, part 295.
1082. gbinv296.seq - Invertebrate sequence entries, part 296.
1083. gbinv297.seq - Invertebrate sequence entries, part 297.
1084. gbinv298.seq - Invertebrate sequence entries, part 298.
1085. gbinv299.seq - Invertebrate sequence entries, part 299.
1086. gbinv3.seq - Invertebrate sequence entries, part 3.
1087. gbinv30.seq - Invertebrate sequence entries, part 30.
1088. gbinv300.seq - Invertebrate sequence entries, part 300.
1089. gbinv301.seq - Invertebrate sequence entries, part 301.
1090. gbinv302.seq - Invertebrate sequence entries, part 302.
1091. gbinv303.seq - Invertebrate sequence entries, part 303.
1092. gbinv304.seq - Invertebrate sequence entries, part 304.
1093. gbinv305.seq - Invertebrate sequence entries, part 305.
1094. gbinv306.seq - Invertebrate sequence entries, part 306.
1095. gbinv307.seq - Invertebrate sequence entries, part 307.
1096. gbinv308.seq - Invertebrate sequence entries, part 308.
1097. gbinv309.seq - Invertebrate sequence entries, part 309.
1098. gbinv31.seq - Invertebrate sequence entries, part 31.
1099. gbinv310.seq - Invertebrate sequence entries, part 310.
1100. gbinv311.seq - Invertebrate sequence entries, part 311.
1101. gbinv312.seq - Invertebrate sequence entries, part 312.
1102. gbinv313.seq - Invertebrate sequence entries, part 313.
1103. gbinv314.seq - Invertebrate sequence entries, part 314.
1104. gbinv315.seq - Invertebrate sequence entries, part 315.
1105. gbinv316.seq - Invertebrate sequence entries, part 316.
1106. gbinv317.seq - Invertebrate sequence entries, part 317.
1107. gbinv318.seq - Invertebrate sequence entries, part 318.
1108. gbinv319.seq - Invertebrate sequence entries, part 319.
1109. gbinv32.seq - Invertebrate sequence entries, part 32.
1110. gbinv320.seq - Invertebrate sequence entries, part 320.
1111. gbinv321.seq - Invertebrate sequence entries, part 321.
1112. gbinv322.seq - Invertebrate sequence entries, part 322.
1113. gbinv323.seq - Invertebrate sequence entries, part 323.
1114. gbinv324.seq - Invertebrate sequence entries, part 324.
1115. gbinv325.seq - Invertebrate sequence entries, part 325.
1116. gbinv326.seq - Invertebrate sequence entries, part 326.
1117. gbinv327.seq - Invertebrate sequence entries, part 327.
1118. gbinv328.seq - Invertebrate sequence entries, part 328.
1119. gbinv329.seq - Invertebrate sequence entries, part 329.
1120. gbinv33.seq - Invertebrate sequence entries, part 33.
1121. gbinv330.seq - Invertebrate sequence entries, part 330.
1122. gbinv331.seq - Invertebrate sequence entries, part 331.
1123. gbinv332.seq - Invertebrate sequence entries, part 332.
1124. gbinv333.seq - Invertebrate sequence entries, part 333.
1125. gbinv334.seq - Invertebrate sequence entries, part 334.
1126. gbinv335.seq - Invertebrate sequence entries, part 335.
1127. gbinv336.seq - Invertebrate sequence entries, part 336.
1128. gbinv337.seq - Invertebrate sequence entries, part 337.
1129. gbinv338.seq - Invertebrate sequence entries, part 338.
1130. gbinv339.seq - Invertebrate sequence entries, part 339.
1131. gbinv34.seq - Invertebrate sequence entries, part 34.
1132. gbinv340.seq - Invertebrate sequence entries, part 340.
1133. gbinv341.seq - Invertebrate sequence entries, part 341.
1134. gbinv342.seq - Invertebrate sequence entries, part 342.
1135. gbinv343.seq - Invertebrate sequence entries, part 343.
1136. gbinv344.seq - Invertebrate sequence entries, part 344.
1137. gbinv345.seq - Invertebrate sequence entries, part 345.
1138. gbinv346.seq - Invertebrate sequence entries, part 346.
1139. gbinv347.seq - Invertebrate sequence entries, part 347.
1140. gbinv348.seq - Invertebrate sequence entries, part 348.
1141. gbinv349.seq - Invertebrate sequence entries, part 349.
1142. gbinv35.seq - Invertebrate sequence entries, part 35.
1143. gbinv350.seq - Invertebrate sequence entries, part 350.
1144. gbinv351.seq - Invertebrate sequence entries, part 351.
1145. gbinv352.seq - Invertebrate sequence entries, part 352.
1146. gbinv353.seq - Invertebrate sequence entries, part 353.
1147. gbinv354.seq - Invertebrate sequence entries, part 354.
1148. gbinv355.seq - Invertebrate sequence entries, part 355.
1149. gbinv356.seq - Invertebrate sequence entries, part 356.
1150. gbinv357.seq - Invertebrate sequence entries, part 357.
1151. gbinv358.seq - Invertebrate sequence entries, part 358.
1152. gbinv359.seq - Invertebrate sequence entries, part 359.
1153. gbinv36.seq - Invertebrate sequence entries, part 36.
1154. gbinv360.seq - Invertebrate sequence entries, part 360.
1155. gbinv361.seq - Invertebrate sequence entries, part 361.
1156. gbinv362.seq - Invertebrate sequence entries, part 362.
1157. gbinv363.seq - Invertebrate sequence entries, part 363.
1158. gbinv364.seq - Invertebrate sequence entries, part 364.
1159. gbinv365.seq - Invertebrate sequence entries, part 365.
1160. gbinv366.seq - Invertebrate sequence entries, part 366.
1161. gbinv367.seq - Invertebrate sequence entries, part 367.
1162. gbinv368.seq - Invertebrate sequence entries, part 368.
1163. gbinv369.seq - Invertebrate sequence entries, part 369.
1164. gbinv37.seq - Invertebrate sequence entries, part 37.
1165. gbinv370.seq - Invertebrate sequence entries, part 370.
1166. gbinv371.seq - Invertebrate sequence entries, part 371.
1167. gbinv372.seq - Invertebrate sequence entries, part 372.
1168. gbinv373.seq - Invertebrate sequence entries, part 373.
1169. gbinv374.seq - Invertebrate sequence entries, part 374.
1170. gbinv375.seq - Invertebrate sequence entries, part 375.
1171. gbinv376.seq - Invertebrate sequence entries, part 376.
1172. gbinv377.seq - Invertebrate sequence entries, part 377.
1173. gbinv378.seq - Invertebrate sequence entries, part 378.
1174. gbinv379.seq - Invertebrate sequence entries, part 379.
1175. gbinv38.seq - Invertebrate sequence entries, part 38.
1176. gbinv380.seq - Invertebrate sequence entries, part 380.
1177. gbinv381.seq - Invertebrate sequence entries, part 381.
1178. gbinv382.seq - Invertebrate sequence entries, part 382.
1179. gbinv383.seq - Invertebrate sequence entries, part 383.
1180. gbinv384.seq - Invertebrate sequence entries, part 384.
1181. gbinv385.seq - Invertebrate sequence entries, part 385.
1182. gbinv386.seq - Invertebrate sequence entries, part 386.
1183. gbinv387.seq - Invertebrate sequence entries, part 387.
1184. gbinv388.seq - Invertebrate sequence entries, part 388.
1185. gbinv389.seq - Invertebrate sequence entries, part 389.
1186. gbinv39.seq - Invertebrate sequence entries, part 39.
1187. gbinv390.seq - Invertebrate sequence entries, part 390.
1188. gbinv391.seq - Invertebrate sequence entries, part 391.
1189. gbinv392.seq - Invertebrate sequence entries, part 392.
1190. gbinv393.seq - Invertebrate sequence entries, part 393.
1191. gbinv394.seq - Invertebrate sequence entries, part 394.
1192. gbinv395.seq - Invertebrate sequence entries, part 395.
1193. gbinv396.seq - Invertebrate sequence entries, part 396.
1194. gbinv397.seq - Invertebrate sequence entries, part 397.
1195. gbinv398.seq - Invertebrate sequence entries, part 398.
1196. gbinv399.seq - Invertebrate sequence entries, part 399.
1197. gbinv4.seq - Invertebrate sequence entries, part 4.
1198. gbinv40.seq - Invertebrate sequence entries, part 40.
1199. gbinv400.seq - Invertebrate sequence entries, part 400.
1200. gbinv401.seq - Invertebrate sequence entries, part 401.
1201. gbinv402.seq - Invertebrate sequence entries, part 402.
1202. gbinv403.seq - Invertebrate sequence entries, part 403.
1203. gbinv404.seq - Invertebrate sequence entries, part 404.
1204. gbinv405.seq - Invertebrate sequence entries, part 405.
1205. gbinv406.seq - Invertebrate sequence entries, part 406.
1206. gbinv407.seq - Invertebrate sequence entries, part 407.
1207. gbinv408.seq - Invertebrate sequence entries, part 408.
1208. gbinv409.seq - Invertebrate sequence entries, part 409.
1209. gbinv41.seq - Invertebrate sequence entries, part 41.
1210. gbinv410.seq - Invertebrate sequence entries, part 410.
1211. gbinv411.seq - Invertebrate sequence entries, part 411.
1212. gbinv412.seq - Invertebrate sequence entries, part 412.
1213. gbinv413.seq - Invertebrate sequence entries, part 413.
1214. gbinv414.seq - Invertebrate sequence entries, part 414.
1215. gbinv415.seq - Invertebrate sequence entries, part 415.
1216. gbinv416.seq - Invertebrate sequence entries, part 416.
1217. gbinv417.seq - Invertebrate sequence entries, part 417.
1218. gbinv418.seq - Invertebrate sequence entries, part 418.
1219. gbinv419.seq - Invertebrate sequence entries, part 419.
1220. gbinv42.seq - Invertebrate sequence entries, part 42.
1221. gbinv420.seq - Invertebrate sequence entries, part 420.
1222. gbinv421.seq - Invertebrate sequence entries, part 421.
1223. gbinv422.seq - Invertebrate sequence entries, part 422.
1224. gbinv423.seq - Invertebrate sequence entries, part 423.
1225. gbinv424.seq - Invertebrate sequence entries, part 424.
1226. gbinv425.seq - Invertebrate sequence entries, part 425.
1227. gbinv426.seq - Invertebrate sequence entries, part 426.
1228. gbinv427.seq - Invertebrate sequence entries, part 427.
1229. gbinv428.seq - Invertebrate sequence entries, part 428.
1230. gbinv429.seq - Invertebrate sequence entries, part 429.
1231. gbinv43.seq - Invertebrate sequence entries, part 43.
1232. gbinv430.seq - Invertebrate sequence entries, part 430.
1233. gbinv431.seq - Invertebrate sequence entries, part 431.
1234. gbinv432.seq - Invertebrate sequence entries, part 432.
1235. gbinv433.seq - Invertebrate sequence entries, part 433.
1236. gbinv434.seq - Invertebrate sequence entries, part 434.
1237. gbinv435.seq - Invertebrate sequence entries, part 435.
1238. gbinv436.seq - Invertebrate sequence entries, part 436.
1239. gbinv437.seq - Invertebrate sequence entries, part 437.
1240. gbinv438.seq - Invertebrate sequence entries, part 438.
1241. gbinv439.seq - Invertebrate sequence entries, part 439.
1242. gbinv44.seq - Invertebrate sequence entries, part 44.
1243. gbinv440.seq - Invertebrate sequence entries, part 440.
1244. gbinv441.seq - Invertebrate sequence entries, part 441.
1245. gbinv442.seq - Invertebrate sequence entries, part 442.
1246. gbinv443.seq - Invertebrate sequence entries, part 443.
1247. gbinv444.seq - Invertebrate sequence entries, part 444.
1248. gbinv445.seq - Invertebrate sequence entries, part 445.
1249. gbinv446.seq - Invertebrate sequence entries, part 446.
1250. gbinv447.seq - Invertebrate sequence entries, part 447.
1251. gbinv448.seq - Invertebrate sequence entries, part 448.
1252. gbinv449.seq - Invertebrate sequence entries, part 449.
1253. gbinv45.seq - Invertebrate sequence entries, part 45.
1254. gbinv450.seq - Invertebrate sequence entries, part 450.
1255. gbinv451.seq - Invertebrate sequence entries, part 451.
1256. gbinv452.seq - Invertebrate sequence entries, part 452.
1257. gbinv453.seq - Invertebrate sequence entries, part 453.
1258. gbinv454.seq - Invertebrate sequence entries, part 454.
1259. gbinv455.seq - Invertebrate sequence entries, part 455.
1260. gbinv456.seq - Invertebrate sequence entries, part 456.
1261. gbinv457.seq - Invertebrate sequence entries, part 457.
1262. gbinv458.seq - Invertebrate sequence entries, part 458.
1263. gbinv459.seq - Invertebrate sequence entries, part 459.
1264. gbinv46.seq - Invertebrate sequence entries, part 46.
1265. gbinv460.seq - Invertebrate sequence entries, part 460.
1266. gbinv461.seq - Invertebrate sequence entries, part 461.
1267. gbinv462.seq - Invertebrate sequence entries, part 462.
1268. gbinv463.seq - Invertebrate sequence entries, part 463.
1269. gbinv464.seq - Invertebrate sequence entries, part 464.
1270. gbinv465.seq - Invertebrate sequence entries, part 465.
1271. gbinv466.seq - Invertebrate sequence entries, part 466.
1272. gbinv467.seq - Invertebrate sequence entries, part 467.
1273. gbinv468.seq - Invertebrate sequence entries, part 468.
1274. gbinv469.seq - Invertebrate sequence entries, part 469.
1275. gbinv47.seq - Invertebrate sequence entries, part 47.
1276. gbinv470.seq - Invertebrate sequence entries, part 470.
1277. gbinv471.seq - Invertebrate sequence entries, part 471.
1278. gbinv472.seq - Invertebrate sequence entries, part 472.
1279. gbinv473.seq - Invertebrate sequence entries, part 473.
1280. gbinv474.seq - Invertebrate sequence entries, part 474.
1281. gbinv475.seq - Invertebrate sequence entries, part 475.
1282. gbinv476.seq - Invertebrate sequence entries, part 476.
1283. gbinv477.seq - Invertebrate sequence entries, part 477.
1284. gbinv478.seq - Invertebrate sequence entries, part 478.
1285. gbinv479.seq - Invertebrate sequence entries, part 479.
1286. gbinv48.seq - Invertebrate sequence entries, part 48.
1287. gbinv480.seq - Invertebrate sequence entries, part 480.
1288. gbinv481.seq - Invertebrate sequence entries, part 481.
1289. gbinv482.seq - Invertebrate sequence entries, part 482.
1290. gbinv483.seq - Invertebrate sequence entries, part 483.
1291. gbinv484.seq - Invertebrate sequence entries, part 484.
1292. gbinv485.seq - Invertebrate sequence entries, part 485.
1293. gbinv486.seq - Invertebrate sequence entries, part 486.
1294. gbinv487.seq - Invertebrate sequence entries, part 487.
1295. gbinv488.seq - Invertebrate sequence entries, part 488.
1296. gbinv489.seq - Invertebrate sequence entries, part 489.
1297. gbinv49.seq - Invertebrate sequence entries, part 49.
1298. gbinv490.seq - Invertebrate sequence entries, part 490.
1299. gbinv491.seq - Invertebrate sequence entries, part 491.
1300. gbinv492.seq - Invertebrate sequence entries, part 492.
1301. gbinv493.seq - Invertebrate sequence entries, part 493.
1302. gbinv494.seq - Invertebrate sequence entries, part 494.
1303. gbinv495.seq - Invertebrate sequence entries, part 495.
1304. gbinv496.seq - Invertebrate sequence entries, part 496.
1305. gbinv497.seq - Invertebrate sequence entries, part 497.
1306. gbinv498.seq - Invertebrate sequence entries, part 498.
1307. gbinv499.seq - Invertebrate sequence entries, part 499.
1308. gbinv5.seq - Invertebrate sequence entries, part 5.
1309. gbinv50.seq - Invertebrate sequence entries, part 50.
1310. gbinv500.seq - Invertebrate sequence entries, part 500.
1311. gbinv501.seq - Invertebrate sequence entries, part 501.
1312. gbinv502.seq - Invertebrate sequence entries, part 502.
1313. gbinv503.seq - Invertebrate sequence entries, part 503.
1314. gbinv504.seq - Invertebrate sequence entries, part 504.
1315. gbinv505.seq - Invertebrate sequence entries, part 505.
1316. gbinv506.seq - Invertebrate sequence entries, part 506.
1317. gbinv507.seq - Invertebrate sequence entries, part 507.
1318. gbinv508.seq - Invertebrate sequence entries, part 508.
1319. gbinv509.seq - Invertebrate sequence entries, part 509.
1320. gbinv51.seq - Invertebrate sequence entries, part 51.
1321. gbinv510.seq - Invertebrate sequence entries, part 510.
1322. gbinv511.seq - Invertebrate sequence entries, part 511.
1323. gbinv512.seq - Invertebrate sequence entries, part 512.
1324. gbinv513.seq - Invertebrate sequence entries, part 513.
1325. gbinv514.seq - Invertebrate sequence entries, part 514.
1326. gbinv515.seq - Invertebrate sequence entries, part 515.
1327. gbinv516.seq - Invertebrate sequence entries, part 516.
1328. gbinv517.seq - Invertebrate sequence entries, part 517.
1329. gbinv518.seq - Invertebrate sequence entries, part 518.
1330. gbinv519.seq - Invertebrate sequence entries, part 519.
1331. gbinv52.seq - Invertebrate sequence entries, part 52.
1332. gbinv520.seq - Invertebrate sequence entries, part 520.
1333. gbinv521.seq - Invertebrate sequence entries, part 521.
1334. gbinv522.seq - Invertebrate sequence entries, part 522.
1335. gbinv523.seq - Invertebrate sequence entries, part 523.
1336. gbinv524.seq - Invertebrate sequence entries, part 524.
1337. gbinv525.seq - Invertebrate sequence entries, part 525.
1338. gbinv526.seq - Invertebrate sequence entries, part 526.
1339. gbinv527.seq - Invertebrate sequence entries, part 527.
1340. gbinv528.seq - Invertebrate sequence entries, part 528.
1341. gbinv529.seq - Invertebrate sequence entries, part 529.
1342. gbinv53.seq - Invertebrate sequence entries, part 53.
1343. gbinv530.seq - Invertebrate sequence entries, part 530.
1344. gbinv531.seq - Invertebrate sequence entries, part 531.
1345. gbinv532.seq - Invertebrate sequence entries, part 532.
1346. gbinv533.seq - Invertebrate sequence entries, part 533.
1347. gbinv534.seq - Invertebrate sequence entries, part 534.
1348. gbinv535.seq - Invertebrate sequence entries, part 535.
1349. gbinv536.seq - Invertebrate sequence entries, part 536.
1350. gbinv537.seq - Invertebrate sequence entries, part 537.
1351. gbinv538.seq - Invertebrate sequence entries, part 538.
1352. gbinv539.seq - Invertebrate sequence entries, part 539.
1353. gbinv54.seq - Invertebrate sequence entries, part 54.
1354. gbinv540.seq - Invertebrate sequence entries, part 540.
1355. gbinv541.seq - Invertebrate sequence entries, part 541.
1356. gbinv542.seq - Invertebrate sequence entries, part 542.
1357. gbinv543.seq - Invertebrate sequence entries, part 543.
1358. gbinv544.seq - Invertebrate sequence entries, part 544.
1359. gbinv545.seq - Invertebrate sequence entries, part 545.
1360. gbinv546.seq - Invertebrate sequence entries, part 546.
1361. gbinv547.seq - Invertebrate sequence entries, part 547.
1362. gbinv548.seq - Invertebrate sequence entries, part 548.
1363. gbinv549.seq - Invertebrate sequence entries, part 549.
1364. gbinv55.seq - Invertebrate sequence entries, part 55.
1365. gbinv550.seq - Invertebrate sequence entries, part 550.
1366. gbinv551.seq - Invertebrate sequence entries, part 551.
1367. gbinv552.seq - Invertebrate sequence entries, part 552.
1368. gbinv553.seq - Invertebrate sequence entries, part 553.
1369. gbinv554.seq - Invertebrate sequence entries, part 554.
1370. gbinv555.seq - Invertebrate sequence entries, part 555.
1371. gbinv556.seq - Invertebrate sequence entries, part 556.
1372. gbinv557.seq - Invertebrate sequence entries, part 557.
1373. gbinv558.seq - Invertebrate sequence entries, part 558.
1374. gbinv559.seq - Invertebrate sequence entries, part 559.
1375. gbinv56.seq - Invertebrate sequence entries, part 56.
1376. gbinv560.seq - Invertebrate sequence entries, part 560.
1377. gbinv561.seq - Invertebrate sequence entries, part 561.
1378. gbinv562.seq - Invertebrate sequence entries, part 562.
1379. gbinv563.seq - Invertebrate sequence entries, part 563.
1380. gbinv564.seq - Invertebrate sequence entries, part 564.
1381. gbinv565.seq - Invertebrate sequence entries, part 565.
1382. gbinv566.seq - Invertebrate sequence entries, part 566.
1383. gbinv567.seq - Invertebrate sequence entries, part 567.
1384. gbinv568.seq - Invertebrate sequence entries, part 568.
1385. gbinv569.seq - Invertebrate sequence entries, part 569.
1386. gbinv57.seq - Invertebrate sequence entries, part 57.
1387. gbinv570.seq - Invertebrate sequence entries, part 570.
1388. gbinv571.seq - Invertebrate sequence entries, part 571.
1389. gbinv572.seq - Invertebrate sequence entries, part 572.
1390. gbinv573.seq - Invertebrate sequence entries, part 573.
1391. gbinv574.seq - Invertebrate sequence entries, part 574.
1392. gbinv575.seq - Invertebrate sequence entries, part 575.
1393. gbinv576.seq - Invertebrate sequence entries, part 576.
1394. gbinv577.seq - Invertebrate sequence entries, part 577.
1395. gbinv578.seq - Invertebrate sequence entries, part 578.
1396. gbinv579.seq - Invertebrate sequence entries, part 579.
1397. gbinv58.seq - Invertebrate sequence entries, part 58.
1398. gbinv580.seq - Invertebrate sequence entries, part 580.
1399. gbinv581.seq - Invertebrate sequence entries, part 581.
1400. gbinv582.seq - Invertebrate sequence entries, part 582.
1401. gbinv583.seq - Invertebrate sequence entries, part 583.
1402. gbinv584.seq - Invertebrate sequence entries, part 584.
1403. gbinv585.seq - Invertebrate sequence entries, part 585.
1404. gbinv586.seq - Invertebrate sequence entries, part 586.
1405. gbinv587.seq - Invertebrate sequence entries, part 587.
1406. gbinv588.seq - Invertebrate sequence entries, part 588.
1407. gbinv589.seq - Invertebrate sequence entries, part 589.
1408. gbinv59.seq - Invertebrate sequence entries, part 59.
1409. gbinv590.seq - Invertebrate sequence entries, part 590.
1410. gbinv591.seq - Invertebrate sequence entries, part 591.
1411. gbinv592.seq - Invertebrate sequence entries, part 592.
1412. gbinv593.seq - Invertebrate sequence entries, part 593.
1413. gbinv594.seq - Invertebrate sequence entries, part 594.
1414. gbinv595.seq - Invertebrate sequence entries, part 595.
1415. gbinv596.seq - Invertebrate sequence entries, part 596.
1416. gbinv597.seq - Invertebrate sequence entries, part 597.
1417. gbinv598.seq - Invertebrate sequence entries, part 598.
1418. gbinv599.seq - Invertebrate sequence entries, part 599.
1419. gbinv6.seq - Invertebrate sequence entries, part 6.
1420. gbinv60.seq - Invertebrate sequence entries, part 60.
1421. gbinv600.seq - Invertebrate sequence entries, part 600.
1422. gbinv601.seq - Invertebrate sequence entries, part 601.
1423. gbinv602.seq - Invertebrate sequence entries, part 602.
1424. gbinv603.seq - Invertebrate sequence entries, part 603.
1425. gbinv604.seq - Invertebrate sequence entries, part 604.
1426. gbinv605.seq - Invertebrate sequence entries, part 605.
1427. gbinv606.seq - Invertebrate sequence entries, part 606.
1428. gbinv607.seq - Invertebrate sequence entries, part 607.
1429. gbinv608.seq - Invertebrate sequence entries, part 608.
1430. gbinv609.seq - Invertebrate sequence entries, part 609.
1431. gbinv61.seq - Invertebrate sequence entries, part 61.
1432. gbinv610.seq - Invertebrate sequence entries, part 610.
1433. gbinv611.seq - Invertebrate sequence entries, part 611.
1434. gbinv612.seq - Invertebrate sequence entries, part 612.
1435. gbinv613.seq - Invertebrate sequence entries, part 613.
1436. gbinv614.seq - Invertebrate sequence entries, part 614.
1437. gbinv615.seq - Invertebrate sequence entries, part 615.
1438. gbinv616.seq - Invertebrate sequence entries, part 616.
1439. gbinv617.seq - Invertebrate sequence entries, part 617.
1440. gbinv618.seq - Invertebrate sequence entries, part 618.
1441. gbinv619.seq - Invertebrate sequence entries, part 619.
1442. gbinv62.seq - Invertebrate sequence entries, part 62.
1443. gbinv620.seq - Invertebrate sequence entries, part 620.
1444. gbinv621.seq - Invertebrate sequence entries, part 621.
1445. gbinv622.seq - Invertebrate sequence entries, part 622.
1446. gbinv623.seq - Invertebrate sequence entries, part 623.
1447. gbinv624.seq - Invertebrate sequence entries, part 624.
1448. gbinv625.seq - Invertebrate sequence entries, part 625.
1449. gbinv626.seq - Invertebrate sequence entries, part 626.
1450. gbinv627.seq - Invertebrate sequence entries, part 627.
1451. gbinv628.seq - Invertebrate sequence entries, part 628.
1452. gbinv629.seq - Invertebrate sequence entries, part 629.
1453. gbinv63.seq - Invertebrate sequence entries, part 63.
1454. gbinv630.seq - Invertebrate sequence entries, part 630.
1455. gbinv631.seq - Invertebrate sequence entries, part 631.
1456. gbinv632.seq - Invertebrate sequence entries, part 632.
1457. gbinv633.seq - Invertebrate sequence entries, part 633.
1458. gbinv634.seq - Invertebrate sequence entries, part 634.
1459. gbinv635.seq - Invertebrate sequence entries, part 635.
1460. gbinv636.seq - Invertebrate sequence entries, part 636.
1461. gbinv637.seq - Invertebrate sequence entries, part 637.
1462. gbinv638.seq - Invertebrate sequence entries, part 638.
1463. gbinv639.seq - Invertebrate sequence entries, part 639.
1464. gbinv64.seq - Invertebrate sequence entries, part 64.
1465. gbinv640.seq - Invertebrate sequence entries, part 640.
1466. gbinv641.seq - Invertebrate sequence entries, part 641.
1467. gbinv642.seq - Invertebrate sequence entries, part 642.
1468. gbinv643.seq - Invertebrate sequence entries, part 643.
1469. gbinv644.seq - Invertebrate sequence entries, part 644.
1470. gbinv645.seq - Invertebrate sequence entries, part 645.
1471. gbinv646.seq - Invertebrate sequence entries, part 646.
1472. gbinv647.seq - Invertebrate sequence entries, part 647.
1473. gbinv648.seq - Invertebrate sequence entries, part 648.
1474. gbinv649.seq - Invertebrate sequence entries, part 649.
1475. gbinv65.seq - Invertebrate sequence entries, part 65.
1476. gbinv650.seq - Invertebrate sequence entries, part 650.
1477. gbinv651.seq - Invertebrate sequence entries, part 651.
1478. gbinv652.seq - Invertebrate sequence entries, part 652.
1479. gbinv653.seq - Invertebrate sequence entries, part 653.
1480. gbinv654.seq - Invertebrate sequence entries, part 654.
1481. gbinv655.seq - Invertebrate sequence entries, part 655.
1482. gbinv656.seq - Invertebrate sequence entries, part 656.
1483. gbinv657.seq - Invertebrate sequence entries, part 657.
1484. gbinv658.seq - Invertebrate sequence entries, part 658.
1485. gbinv659.seq - Invertebrate sequence entries, part 659.
1486. gbinv66.seq - Invertebrate sequence entries, part 66.
1487. gbinv660.seq - Invertebrate sequence entries, part 660.
1488. gbinv661.seq - Invertebrate sequence entries, part 661.
1489. gbinv662.seq - Invertebrate sequence entries, part 662.
1490. gbinv663.seq - Invertebrate sequence entries, part 663.
1491. gbinv664.seq - Invertebrate sequence entries, part 664.
1492. gbinv665.seq - Invertebrate sequence entries, part 665.
1493. gbinv666.seq - Invertebrate sequence entries, part 666.
1494. gbinv667.seq - Invertebrate sequence entries, part 667.
1495. gbinv668.seq - Invertebrate sequence entries, part 668.
1496. gbinv669.seq - Invertebrate sequence entries, part 669.
1497. gbinv67.seq - Invertebrate sequence entries, part 67.
1498. gbinv670.seq - Invertebrate sequence entries, part 670.
1499. gbinv671.seq - Invertebrate sequence entries, part 671.
1500. gbinv672.seq - Invertebrate sequence entries, part 672.
1501. gbinv673.seq - Invertebrate sequence entries, part 673.
1502. gbinv674.seq - Invertebrate sequence entries, part 674.
1503. gbinv675.seq - Invertebrate sequence entries, part 675.
1504. gbinv676.seq - Invertebrate sequence entries, part 676.
1505. gbinv677.seq - Invertebrate sequence entries, part 677.
1506. gbinv678.seq - Invertebrate sequence entries, part 678.
1507. gbinv679.seq - Invertebrate sequence entries, part 679.
1508. gbinv68.seq - Invertebrate sequence entries, part 68.
1509. gbinv680.seq - Invertebrate sequence entries, part 680.
1510. gbinv681.seq - Invertebrate sequence entries, part 681.
1511. gbinv682.seq - Invertebrate sequence entries, part 682.
1512. gbinv683.seq - Invertebrate sequence entries, part 683.
1513. gbinv684.seq - Invertebrate sequence entries, part 684.
1514. gbinv685.seq - Invertebrate sequence entries, part 685.
1515. gbinv686.seq - Invertebrate sequence entries, part 686.
1516. gbinv687.seq - Invertebrate sequence entries, part 687.
1517. gbinv688.seq - Invertebrate sequence entries, part 688.
1518. gbinv689.seq - Invertebrate sequence entries, part 689.
1519. gbinv69.seq - Invertebrate sequence entries, part 69.
1520. gbinv690.seq - Invertebrate sequence entries, part 690.
1521. gbinv691.seq - Invertebrate sequence entries, part 691.
1522. gbinv692.seq - Invertebrate sequence entries, part 692.
1523. gbinv693.seq - Invertebrate sequence entries, part 693.
1524. gbinv694.seq - Invertebrate sequence entries, part 694.
1525. gbinv695.seq - Invertebrate sequence entries, part 695.
1526. gbinv696.seq - Invertebrate sequence entries, part 696.
1527. gbinv697.seq - Invertebrate sequence entries, part 697.
1528. gbinv698.seq - Invertebrate sequence entries, part 698.
1529. gbinv699.seq - Invertebrate sequence entries, part 699.
1530. gbinv7.seq - Invertebrate sequence entries, part 7.
1531. gbinv70.seq - Invertebrate sequence entries, part 70.
1532. gbinv700.seq - Invertebrate sequence entries, part 700.
1533. gbinv701.seq - Invertebrate sequence entries, part 701.
1534. gbinv702.seq - Invertebrate sequence entries, part 702.
1535. gbinv703.seq - Invertebrate sequence entries, part 703.
1536. gbinv704.seq - Invertebrate sequence entries, part 704.
1537. gbinv705.seq - Invertebrate sequence entries, part 705.
1538. gbinv706.seq - Invertebrate sequence entries, part 706.
1539. gbinv707.seq - Invertebrate sequence entries, part 707.
1540. gbinv708.seq - Invertebrate sequence entries, part 708.
1541. gbinv709.seq - Invertebrate sequence entries, part 709.
1542. gbinv71.seq - Invertebrate sequence entries, part 71.
1543. gbinv710.seq - Invertebrate sequence entries, part 710.
1544. gbinv711.seq - Invertebrate sequence entries, part 711.
1545. gbinv712.seq - Invertebrate sequence entries, part 712.
1546. gbinv713.seq - Invertebrate sequence entries, part 713.
1547. gbinv714.seq - Invertebrate sequence entries, part 714.
1548. gbinv715.seq - Invertebrate sequence entries, part 715.
1549. gbinv716.seq - Invertebrate sequence entries, part 716.
1550. gbinv717.seq - Invertebrate sequence entries, part 717.
1551. gbinv718.seq - Invertebrate sequence entries, part 718.
1552. gbinv719.seq - Invertebrate sequence entries, part 719.
1553. gbinv72.seq - Invertebrate sequence entries, part 72.
1554. gbinv720.seq - Invertebrate sequence entries, part 720.
1555. gbinv721.seq - Invertebrate sequence entries, part 721.
1556. gbinv722.seq - Invertebrate sequence entries, part 722.
1557. gbinv723.seq - Invertebrate sequence entries, part 723.
1558. gbinv724.seq - Invertebrate sequence entries, part 724.
1559. gbinv725.seq - Invertebrate sequence entries, part 725.
1560. gbinv726.seq - Invertebrate sequence entries, part 726.
1561. gbinv727.seq - Invertebrate sequence entries, part 727.
1562. gbinv728.seq - Invertebrate sequence entries, part 728.
1563. gbinv729.seq - Invertebrate sequence entries, part 729.
1564. gbinv73.seq - Invertebrate sequence entries, part 73.
1565. gbinv730.seq - Invertebrate sequence entries, part 730.
1566. gbinv731.seq - Invertebrate sequence entries, part 731.
1567. gbinv732.seq - Invertebrate sequence entries, part 732.
1568. gbinv733.seq - Invertebrate sequence entries, part 733.
1569. gbinv734.seq - Invertebrate sequence entries, part 734.
1570. gbinv735.seq - Invertebrate sequence entries, part 735.
1571. gbinv736.seq - Invertebrate sequence entries, part 736.
1572. gbinv737.seq - Invertebrate sequence entries, part 737.
1573. gbinv738.seq - Invertebrate sequence entries, part 738.
1574. gbinv739.seq - Invertebrate sequence entries, part 739.
1575. gbinv74.seq - Invertebrate sequence entries, part 74.
1576. gbinv740.seq - Invertebrate sequence entries, part 740.
1577. gbinv741.seq - Invertebrate sequence entries, part 741.
1578. gbinv742.seq - Invertebrate sequence entries, part 742.
1579. gbinv743.seq - Invertebrate sequence entries, part 743.
1580. gbinv744.seq - Invertebrate sequence entries, part 744.
1581. gbinv745.seq - Invertebrate sequence entries, part 745.
1582. gbinv746.seq - Invertebrate sequence entries, part 746.
1583. gbinv747.seq - Invertebrate sequence entries, part 747.
1584. gbinv748.seq - Invertebrate sequence entries, part 748.
1585. gbinv749.seq - Invertebrate sequence entries, part 749.
1586. gbinv75.seq - Invertebrate sequence entries, part 75.
1587. gbinv750.seq - Invertebrate sequence entries, part 750.
1588. gbinv751.seq - Invertebrate sequence entries, part 751.
1589. gbinv752.seq - Invertebrate sequence entries, part 752.
1590. gbinv753.seq - Invertebrate sequence entries, part 753.
1591. gbinv754.seq - Invertebrate sequence entries, part 754.
1592. gbinv755.seq - Invertebrate sequence entries, part 755.
1593. gbinv756.seq - Invertebrate sequence entries, part 756.
1594. gbinv757.seq - Invertebrate sequence entries, part 757.
1595. gbinv758.seq - Invertebrate sequence entries, part 758.
1596. gbinv759.seq - Invertebrate sequence entries, part 759.
1597. gbinv76.seq - Invertebrate sequence entries, part 76.
1598. gbinv760.seq - Invertebrate sequence entries, part 760.
1599. gbinv761.seq - Invertebrate sequence entries, part 761.
1600. gbinv762.seq - Invertebrate sequence entries, part 762.
1601. gbinv763.seq - Invertebrate sequence entries, part 763.
1602. gbinv764.seq - Invertebrate sequence entries, part 764.
1603. gbinv765.seq - Invertebrate sequence entries, part 765.
1604. gbinv766.seq - Invertebrate sequence entries, part 766.
1605. gbinv767.seq - Invertebrate sequence entries, part 767.
1606. gbinv768.seq - Invertebrate sequence entries, part 768.
1607. gbinv769.seq - Invertebrate sequence entries, part 769.
1608. gbinv77.seq - Invertebrate sequence entries, part 77.
1609. gbinv770.seq - Invertebrate sequence entries, part 770.
1610. gbinv771.seq - Invertebrate sequence entries, part 771.
1611. gbinv772.seq - Invertebrate sequence entries, part 772.
1612. gbinv773.seq - Invertebrate sequence entries, part 773.
1613. gbinv774.seq - Invertebrate sequence entries, part 774.
1614. gbinv775.seq - Invertebrate sequence entries, part 775.
1615. gbinv776.seq - Invertebrate sequence entries, part 776.
1616. gbinv777.seq - Invertebrate sequence entries, part 777.
1617. gbinv778.seq - Invertebrate sequence entries, part 778.
1618. gbinv779.seq - Invertebrate sequence entries, part 779.
1619. gbinv78.seq - Invertebrate sequence entries, part 78.
1620. gbinv780.seq - Invertebrate sequence entries, part 780.
1621. gbinv781.seq - Invertebrate sequence entries, part 781.
1622. gbinv782.seq - Invertebrate sequence entries, part 782.
1623. gbinv783.seq - Invertebrate sequence entries, part 783.
1624. gbinv784.seq - Invertebrate sequence entries, part 784.
1625. gbinv785.seq - Invertebrate sequence entries, part 785.
1626. gbinv786.seq - Invertebrate sequence entries, part 786.
1627. gbinv787.seq - Invertebrate sequence entries, part 787.
1628. gbinv788.seq - Invertebrate sequence entries, part 788.
1629. gbinv789.seq - Invertebrate sequence entries, part 789.
1630. gbinv79.seq - Invertebrate sequence entries, part 79.
1631. gbinv790.seq - Invertebrate sequence entries, part 790.
1632. gbinv791.seq - Invertebrate sequence entries, part 791.
1633. gbinv792.seq - Invertebrate sequence entries, part 792.
1634. gbinv793.seq - Invertebrate sequence entries, part 793.
1635. gbinv794.seq - Invertebrate sequence entries, part 794.
1636. gbinv795.seq - Invertebrate sequence entries, part 795.
1637. gbinv796.seq - Invertebrate sequence entries, part 796.
1638. gbinv797.seq - Invertebrate sequence entries, part 797.
1639. gbinv798.seq - Invertebrate sequence entries, part 798.
1640. gbinv799.seq - Invertebrate sequence entries, part 799.
1641. gbinv8.seq - Invertebrate sequence entries, part 8.
1642. gbinv80.seq - Invertebrate sequence entries, part 80.
1643. gbinv800.seq - Invertebrate sequence entries, part 800.
1644. gbinv801.seq - Invertebrate sequence entries, part 801.
1645. gbinv802.seq - Invertebrate sequence entries, part 802.
1646. gbinv803.seq - Invertebrate sequence entries, part 803.
1647. gbinv804.seq - Invertebrate sequence entries, part 804.
1648. gbinv805.seq - Invertebrate sequence entries, part 805.
1649. gbinv806.seq - Invertebrate sequence entries, part 806.
1650. gbinv807.seq - Invertebrate sequence entries, part 807.
1651. gbinv808.seq - Invertebrate sequence entries, part 808.
1652. gbinv809.seq - Invertebrate sequence entries, part 809.
1653. gbinv81.seq - Invertebrate sequence entries, part 81.
1654. gbinv810.seq - Invertebrate sequence entries, part 810.
1655. gbinv811.seq - Invertebrate sequence entries, part 811.
1656. gbinv812.seq - Invertebrate sequence entries, part 812.
1657. gbinv813.seq - Invertebrate sequence entries, part 813.
1658. gbinv814.seq - Invertebrate sequence entries, part 814.
1659. gbinv815.seq - Invertebrate sequence entries, part 815.
1660. gbinv816.seq - Invertebrate sequence entries, part 816.
1661. gbinv817.seq - Invertebrate sequence entries, part 817.
1662. gbinv818.seq - Invertebrate sequence entries, part 818.
1663. gbinv819.seq - Invertebrate sequence entries, part 819.
1664. gbinv82.seq - Invertebrate sequence entries, part 82.
1665. gbinv820.seq - Invertebrate sequence entries, part 820.
1666. gbinv821.seq - Invertebrate sequence entries, part 821.
1667. gbinv822.seq - Invertebrate sequence entries, part 822.
1668. gbinv823.seq - Invertebrate sequence entries, part 823.
1669. gbinv824.seq - Invertebrate sequence entries, part 824.
1670. gbinv825.seq - Invertebrate sequence entries, part 825.
1671. gbinv826.seq - Invertebrate sequence entries, part 826.
1672. gbinv827.seq - Invertebrate sequence entries, part 827.
1673. gbinv828.seq - Invertebrate sequence entries, part 828.
1674. gbinv829.seq - Invertebrate sequence entries, part 829.
1675. gbinv83.seq - Invertebrate sequence entries, part 83.
1676. gbinv830.seq - Invertebrate sequence entries, part 830.
1677. gbinv831.seq - Invertebrate sequence entries, part 831.
1678. gbinv832.seq - Invertebrate sequence entries, part 832.
1679. gbinv833.seq - Invertebrate sequence entries, part 833.
1680. gbinv834.seq - Invertebrate sequence entries, part 834.
1681. gbinv835.seq - Invertebrate sequence entries, part 835.
1682. gbinv836.seq - Invertebrate sequence entries, part 836.
1683. gbinv837.seq - Invertebrate sequence entries, part 837.
1684. gbinv838.seq - Invertebrate sequence entries, part 838.
1685. gbinv839.seq - Invertebrate sequence entries, part 839.
1686. gbinv84.seq - Invertebrate sequence entries, part 84.
1687. gbinv840.seq - Invertebrate sequence entries, part 840.
1688. gbinv841.seq - Invertebrate sequence entries, part 841.
1689. gbinv842.seq - Invertebrate sequence entries, part 842.
1690. gbinv843.seq - Invertebrate sequence entries, part 843.
1691. gbinv844.seq - Invertebrate sequence entries, part 844.
1692. gbinv845.seq - Invertebrate sequence entries, part 845.
1693. gbinv846.seq - Invertebrate sequence entries, part 846.
1694. gbinv847.seq - Invertebrate sequence entries, part 847.
1695. gbinv848.seq - Invertebrate sequence entries, part 848.
1696. gbinv849.seq - Invertebrate sequence entries, part 849.
1697. gbinv85.seq - Invertebrate sequence entries, part 85.
1698. gbinv850.seq - Invertebrate sequence entries, part 850.
1699. gbinv851.seq - Invertebrate sequence entries, part 851.
1700. gbinv852.seq - Invertebrate sequence entries, part 852.
1701. gbinv853.seq - Invertebrate sequence entries, part 853.
1702. gbinv854.seq - Invertebrate sequence entries, part 854.
1703. gbinv855.seq - Invertebrate sequence entries, part 855.
1704. gbinv856.seq - Invertebrate sequence entries, part 856.
1705. gbinv857.seq - Invertebrate sequence entries, part 857.
1706. gbinv858.seq - Invertebrate sequence entries, part 858.
1707. gbinv859.seq - Invertebrate sequence entries, part 859.
1708. gbinv86.seq - Invertebrate sequence entries, part 86.
1709. gbinv860.seq - Invertebrate sequence entries, part 860.
1710. gbinv861.seq - Invertebrate sequence entries, part 861.
1711. gbinv862.seq - Invertebrate sequence entries, part 862.
1712. gbinv863.seq - Invertebrate sequence entries, part 863.
1713. gbinv864.seq - Invertebrate sequence entries, part 864.
1714. gbinv865.seq - Invertebrate sequence entries, part 865.
1715. gbinv866.seq - Invertebrate sequence entries, part 866.
1716. gbinv867.seq - Invertebrate sequence entries, part 867.
1717. gbinv868.seq - Invertebrate sequence entries, part 868.
1718. gbinv869.seq - Invertebrate sequence entries, part 869.
1719. gbinv87.seq - Invertebrate sequence entries, part 87.
1720. gbinv870.seq - Invertebrate sequence entries, part 870.
1721. gbinv871.seq - Invertebrate sequence entries, part 871.
1722. gbinv872.seq - Invertebrate sequence entries, part 872.
1723. gbinv873.seq - Invertebrate sequence entries, part 873.
1724. gbinv874.seq - Invertebrate sequence entries, part 874.
1725. gbinv875.seq - Invertebrate sequence entries, part 875.
1726. gbinv876.seq - Invertebrate sequence entries, part 876.
1727. gbinv877.seq - Invertebrate sequence entries, part 877.
1728. gbinv878.seq - Invertebrate sequence entries, part 878.
1729. gbinv879.seq - Invertebrate sequence entries, part 879.
1730. gbinv88.seq - Invertebrate sequence entries, part 88.
1731. gbinv880.seq - Invertebrate sequence entries, part 880.
1732. gbinv881.seq - Invertebrate sequence entries, part 881.
1733. gbinv882.seq - Invertebrate sequence entries, part 882.
1734. gbinv883.seq - Invertebrate sequence entries, part 883.
1735. gbinv884.seq - Invertebrate sequence entries, part 884.
1736. gbinv885.seq - Invertebrate sequence entries, part 885.
1737. gbinv886.seq - Invertebrate sequence entries, part 886.
1738. gbinv887.seq - Invertebrate sequence entries, part 887.
1739. gbinv888.seq - Invertebrate sequence entries, part 888.
1740. gbinv889.seq - Invertebrate sequence entries, part 889.
1741. gbinv89.seq - Invertebrate sequence entries, part 89.
1742. gbinv890.seq - Invertebrate sequence entries, part 890.
1743. gbinv891.seq - Invertebrate sequence entries, part 891.
1744. gbinv892.seq - Invertebrate sequence entries, part 892.
1745. gbinv893.seq - Invertebrate sequence entries, part 893.
1746. gbinv894.seq - Invertebrate sequence entries, part 894.
1747. gbinv895.seq - Invertebrate sequence entries, part 895.
1748. gbinv896.seq - Invertebrate sequence entries, part 896.
1749. gbinv897.seq - Invertebrate sequence entries, part 897.
1750. gbinv898.seq - Invertebrate sequence entries, part 898.
1751. gbinv899.seq - Invertebrate sequence entries, part 899.
1752. gbinv9.seq - Invertebrate sequence entries, part 9.
1753. gbinv90.seq - Invertebrate sequence entries, part 90.
1754. gbinv900.seq - Invertebrate sequence entries, part 900.
1755. gbinv901.seq - Invertebrate sequence entries, part 901.
1756. gbinv902.seq - Invertebrate sequence entries, part 902.
1757. gbinv903.seq - Invertebrate sequence entries, part 903.
1758. gbinv904.seq - Invertebrate sequence entries, part 904.
1759. gbinv905.seq - Invertebrate sequence entries, part 905.
1760. gbinv906.seq - Invertebrate sequence entries, part 906.
1761. gbinv907.seq - Invertebrate sequence entries, part 907.
1762. gbinv908.seq - Invertebrate sequence entries, part 908.
1763. gbinv909.seq - Invertebrate sequence entries, part 909.
1764. gbinv91.seq - Invertebrate sequence entries, part 91.
1765. gbinv910.seq - Invertebrate sequence entries, part 910.
1766. gbinv911.seq - Invertebrate sequence entries, part 911.
1767. gbinv912.seq - Invertebrate sequence entries, part 912.
1768. gbinv913.seq - Invertebrate sequence entries, part 913.
1769. gbinv914.seq - Invertebrate sequence entries, part 914.
1770. gbinv915.seq - Invertebrate sequence entries, part 915.
1771. gbinv916.seq - Invertebrate sequence entries, part 916.
1772. gbinv917.seq - Invertebrate sequence entries, part 917.
1773. gbinv918.seq - Invertebrate sequence entries, part 918.
1774. gbinv919.seq - Invertebrate sequence entries, part 919.
1775. gbinv92.seq - Invertebrate sequence entries, part 92.
1776. gbinv920.seq - Invertebrate sequence entries, part 920.
1777. gbinv921.seq - Invertebrate sequence entries, part 921.
1778. gbinv922.seq - Invertebrate sequence entries, part 922.
1779. gbinv923.seq - Invertebrate sequence entries, part 923.
1780. gbinv924.seq - Invertebrate sequence entries, part 924.
1781. gbinv925.seq - Invertebrate sequence entries, part 925.
1782. gbinv926.seq - Invertebrate sequence entries, part 926.
1783. gbinv927.seq - Invertebrate sequence entries, part 927.
1784. gbinv928.seq - Invertebrate sequence entries, part 928.
1785. gbinv929.seq - Invertebrate sequence entries, part 929.
1786. gbinv93.seq - Invertebrate sequence entries, part 93.
1787. gbinv930.seq - Invertebrate sequence entries, part 930.
1788. gbinv931.seq - Invertebrate sequence entries, part 931.
1789. gbinv932.seq - Invertebrate sequence entries, part 932.
1790. gbinv933.seq - Invertebrate sequence entries, part 933.
1791. gbinv934.seq - Invertebrate sequence entries, part 934.
1792. gbinv935.seq - Invertebrate sequence entries, part 935.
1793. gbinv936.seq - Invertebrate sequence entries, part 936.
1794. gbinv937.seq - Invertebrate sequence entries, part 937.
1795. gbinv938.seq - Invertebrate sequence entries, part 938.
1796. gbinv939.seq - Invertebrate sequence entries, part 939.
1797. gbinv94.seq - Invertebrate sequence entries, part 94.
1798. gbinv940.seq - Invertebrate sequence entries, part 940.
1799. gbinv941.seq - Invertebrate sequence entries, part 941.
1800. gbinv942.seq - Invertebrate sequence entries, part 942.
1801. gbinv943.seq - Invertebrate sequence entries, part 943.
1802. gbinv944.seq - Invertebrate sequence entries, part 944.
1803. gbinv945.seq - Invertebrate sequence entries, part 945.
1804. gbinv946.seq - Invertebrate sequence entries, part 946.
1805. gbinv947.seq - Invertebrate sequence entries, part 947.
1806. gbinv948.seq - Invertebrate sequence entries, part 948.
1807. gbinv949.seq - Invertebrate sequence entries, part 949.
1808. gbinv95.seq - Invertebrate sequence entries, part 95.
1809. gbinv950.seq - Invertebrate sequence entries, part 950.
1810. gbinv951.seq - Invertebrate sequence entries, part 951.
1811. gbinv952.seq - Invertebrate sequence entries, part 952.
1812. gbinv953.seq - Invertebrate sequence entries, part 953.
1813. gbinv954.seq - Invertebrate sequence entries, part 954.
1814. gbinv955.seq - Invertebrate sequence entries, part 955.
1815. gbinv956.seq - Invertebrate sequence entries, part 956.
1816. gbinv957.seq - Invertebrate sequence entries, part 957.
1817. gbinv958.seq - Invertebrate sequence entries, part 958.
1818. gbinv959.seq - Invertebrate sequence entries, part 959.
1819. gbinv96.seq - Invertebrate sequence entries, part 96.
1820. gbinv960.seq - Invertebrate sequence entries, part 960.
1821. gbinv961.seq - Invertebrate sequence entries, part 961.
1822. gbinv962.seq - Invertebrate sequence entries, part 962.
1823. gbinv963.seq - Invertebrate sequence entries, part 963.
1824. gbinv964.seq - Invertebrate sequence entries, part 964.
1825. gbinv965.seq - Invertebrate sequence entries, part 965.
1826. gbinv966.seq - Invertebrate sequence entries, part 966.
1827. gbinv967.seq - Invertebrate sequence entries, part 967.
1828. gbinv968.seq - Invertebrate sequence entries, part 968.
1829. gbinv969.seq - Invertebrate sequence entries, part 969.
1830. gbinv97.seq - Invertebrate sequence entries, part 97.
1831. gbinv970.seq - Invertebrate sequence entries, part 970.
1832. gbinv971.seq - Invertebrate sequence entries, part 971.
1833. gbinv972.seq - Invertebrate sequence entries, part 972.
1834. gbinv973.seq - Invertebrate sequence entries, part 973.
1835. gbinv974.seq - Invertebrate sequence entries, part 974.
1836. gbinv975.seq - Invertebrate sequence entries, part 975.
1837. gbinv976.seq - Invertebrate sequence entries, part 976.
1838. gbinv977.seq - Invertebrate sequence entries, part 977.
1839. gbinv978.seq - Invertebrate sequence entries, part 978.
1840. gbinv979.seq - Invertebrate sequence entries, part 979.
1841. gbinv98.seq - Invertebrate sequence entries, part 98.
1842. gbinv980.seq - Invertebrate sequence entries, part 980.
1843. gbinv981.seq - Invertebrate sequence entries, part 981.
1844. gbinv982.seq - Invertebrate sequence entries, part 982.
1845. gbinv983.seq - Invertebrate sequence entries, part 983.
1846. gbinv984.seq - Invertebrate sequence entries, part 984.
1847. gbinv985.seq - Invertebrate sequence entries, part 985.
1848. gbinv986.seq - Invertebrate sequence entries, part 986.
1849. gbinv987.seq - Invertebrate sequence entries, part 987.
1850. gbinv988.seq - Invertebrate sequence entries, part 988.
1851. gbinv989.seq - Invertebrate sequence entries, part 989.
1852. gbinv99.seq - Invertebrate sequence entries, part 99.
1853. gbinv990.seq - Invertebrate sequence entries, part 990.
1854. gbinv991.seq - Invertebrate sequence entries, part 991.
1855. gbinv992.seq - Invertebrate sequence entries, part 992.
1856. gbinv993.seq - Invertebrate sequence entries, part 993.
1857. gbinv994.seq - Invertebrate sequence entries, part 994.
1858. gbinv995.seq - Invertebrate sequence entries, part 995.
1859. gbinv996.seq - Invertebrate sequence entries, part 996.
1860. gbinv997.seq - Invertebrate sequence entries, part 997.
1861. gbinv998.seq - Invertebrate sequence entries, part 998.
1862. gbinv999.seq - Invertebrate sequence entries, part 999.
1863. gbmam1.seq - Other mammalian sequence entries, part 1.
1864. gbmam10.seq - Other mammalian sequence entries, part 10.
1865. gbmam100.seq - Other mammalian sequence entries, part 100.
1866. gbmam101.seq - Other mammalian sequence entries, part 101.
1867. gbmam102.seq - Other mammalian sequence entries, part 102.
1868. gbmam103.seq - Other mammalian sequence entries, part 103.
1869. gbmam104.seq - Other mammalian sequence entries, part 104.
1870. gbmam105.seq - Other mammalian sequence entries, part 105.
1871. gbmam106.seq - Other mammalian sequence entries, part 106.
1872. gbmam107.seq - Other mammalian sequence entries, part 107.
1873. gbmam108.seq - Other mammalian sequence entries, part 108.
1874. gbmam109.seq - Other mammalian sequence entries, part 109.
1875. gbmam11.seq - Other mammalian sequence entries, part 11.
1876. gbmam110.seq - Other mammalian sequence entries, part 110.
1877. gbmam111.seq - Other mammalian sequence entries, part 111.
1878. gbmam112.seq - Other mammalian sequence entries, part 112.
1879. gbmam113.seq - Other mammalian sequence entries, part 113.
1880. gbmam114.seq - Other mammalian sequence entries, part 114.
1881. gbmam115.seq - Other mammalian sequence entries, part 115.
1882. gbmam116.seq - Other mammalian sequence entries, part 116.
1883. gbmam117.seq - Other mammalian sequence entries, part 117.
1884. gbmam118.seq - Other mammalian sequence entries, part 118.
1885. gbmam119.seq - Other mammalian sequence entries, part 119.
1886. gbmam12.seq - Other mammalian sequence entries, part 12.
1887. gbmam120.seq - Other mammalian sequence entries, part 120.
1888. gbmam121.seq - Other mammalian sequence entries, part 121.
1889. gbmam122.seq - Other mammalian sequence entries, part 122.
1890. gbmam123.seq - Other mammalian sequence entries, part 123.
1891. gbmam124.seq - Other mammalian sequence entries, part 124.
1892. gbmam125.seq - Other mammalian sequence entries, part 125.
1893. gbmam126.seq - Other mammalian sequence entries, part 126.
1894. gbmam127.seq - Other mammalian sequence entries, part 127.
1895. gbmam128.seq - Other mammalian sequence entries, part 128.
1896. gbmam129.seq - Other mammalian sequence entries, part 129.
1897. gbmam13.seq - Other mammalian sequence entries, part 13.
1898. gbmam130.seq - Other mammalian sequence entries, part 130.
1899. gbmam131.seq - Other mammalian sequence entries, part 131.
1900. gbmam132.seq - Other mammalian sequence entries, part 132.
1901. gbmam133.seq - Other mammalian sequence entries, part 133.
1902. gbmam134.seq - Other mammalian sequence entries, part 134.
1903. gbmam135.seq - Other mammalian sequence entries, part 135.
1904. gbmam136.seq - Other mammalian sequence entries, part 136.
1905. gbmam137.seq - Other mammalian sequence entries, part 137.
1906. gbmam138.seq - Other mammalian sequence entries, part 138.
1907. gbmam139.seq - Other mammalian sequence entries, part 139.
1908. gbmam14.seq - Other mammalian sequence entries, part 14.
1909. gbmam140.seq - Other mammalian sequence entries, part 140.
1910. gbmam141.seq - Other mammalian sequence entries, part 141.
1911. gbmam142.seq - Other mammalian sequence entries, part 142.
1912. gbmam143.seq - Other mammalian sequence entries, part 143.
1913. gbmam144.seq - Other mammalian sequence entries, part 144.
1914. gbmam145.seq - Other mammalian sequence entries, part 145.
1915. gbmam146.seq - Other mammalian sequence entries, part 146.
1916. gbmam147.seq - Other mammalian sequence entries, part 147.
1917. gbmam148.seq - Other mammalian sequence entries, part 148.
1918. gbmam149.seq - Other mammalian sequence entries, part 149.
1919. gbmam15.seq - Other mammalian sequence entries, part 15.
1920. gbmam150.seq - Other mammalian sequence entries, part 150.
1921. gbmam151.seq - Other mammalian sequence entries, part 151.
1922. gbmam152.seq - Other mammalian sequence entries, part 152.
1923. gbmam153.seq - Other mammalian sequence entries, part 153.
1924. gbmam154.seq - Other mammalian sequence entries, part 154.
1925. gbmam155.seq - Other mammalian sequence entries, part 155.
1926. gbmam156.seq - Other mammalian sequence entries, part 156.
1927. gbmam157.seq - Other mammalian sequence entries, part 157.
1928. gbmam158.seq - Other mammalian sequence entries, part 158.
1929. gbmam159.seq - Other mammalian sequence entries, part 159.
1930. gbmam16.seq - Other mammalian sequence entries, part 16.
1931. gbmam160.seq - Other mammalian sequence entries, part 160.
1932. gbmam161.seq - Other mammalian sequence entries, part 161.
1933. gbmam162.seq - Other mammalian sequence entries, part 162.
1934. gbmam163.seq - Other mammalian sequence entries, part 163.
1935. gbmam164.seq - Other mammalian sequence entries, part 164.
1936. gbmam165.seq - Other mammalian sequence entries, part 165.
1937. gbmam17.seq - Other mammalian sequence entries, part 17.
1938. gbmam18.seq - Other mammalian sequence entries, part 18.
1939. gbmam19.seq - Other mammalian sequence entries, part 19.
1940. gbmam2.seq - Other mammalian sequence entries, part 2.
1941. gbmam20.seq - Other mammalian sequence entries, part 20.
1942. gbmam21.seq - Other mammalian sequence entries, part 21.
1943. gbmam22.seq - Other mammalian sequence entries, part 22.
1944. gbmam23.seq - Other mammalian sequence entries, part 23.
1945. gbmam24.seq - Other mammalian sequence entries, part 24.
1946. gbmam25.seq - Other mammalian sequence entries, part 25.
1947. gbmam26.seq - Other mammalian sequence entries, part 26.
1948. gbmam27.seq - Other mammalian sequence entries, part 27.
1949. gbmam28.seq - Other mammalian sequence entries, part 28.
1950. gbmam29.seq - Other mammalian sequence entries, part 29.
1951. gbmam3.seq - Other mammalian sequence entries, part 3.
1952. gbmam30.seq - Other mammalian sequence entries, part 30.
1953. gbmam31.seq - Other mammalian sequence entries, part 31.
1954. gbmam32.seq - Other mammalian sequence entries, part 32.
1955. gbmam33.seq - Other mammalian sequence entries, part 33.
1956. gbmam34.seq - Other mammalian sequence entries, part 34.
1957. gbmam35.seq - Other mammalian sequence entries, part 35.
1958. gbmam36.seq - Other mammalian sequence entries, part 36.
1959. gbmam37.seq - Other mammalian sequence entries, part 37.
1960. gbmam38.seq - Other mammalian sequence entries, part 38.
1961. gbmam39.seq - Other mammalian sequence entries, part 39.
1962. gbmam4.seq - Other mammalian sequence entries, part 4.
1963. gbmam40.seq - Other mammalian sequence entries, part 40.
1964. gbmam41.seq - Other mammalian sequence entries, part 41.
1965. gbmam42.seq - Other mammalian sequence entries, part 42.
1966. gbmam43.seq - Other mammalian sequence entries, part 43.
1967. gbmam44.seq - Other mammalian sequence entries, part 44.
1968. gbmam45.seq - Other mammalian sequence entries, part 45.
1969. gbmam46.seq - Other mammalian sequence entries, part 46.
1970. gbmam47.seq - Other mammalian sequence entries, part 47.
1971. gbmam48.seq - Other mammalian sequence entries, part 48.
1972. gbmam49.seq - Other mammalian sequence entries, part 49.
1973. gbmam5.seq - Other mammalian sequence entries, part 5.
1974. gbmam50.seq - Other mammalian sequence entries, part 50.
1975. gbmam51.seq - Other mammalian sequence entries, part 51.
1976. gbmam52.seq - Other mammalian sequence entries, part 52.
1977. gbmam53.seq - Other mammalian sequence entries, part 53.
1978. gbmam54.seq - Other mammalian sequence entries, part 54.
1979. gbmam55.seq - Other mammalian sequence entries, part 55.
1980. gbmam56.seq - Other mammalian sequence entries, part 56.
1981. gbmam57.seq - Other mammalian sequence entries, part 57.
1982. gbmam58.seq - Other mammalian sequence entries, part 58.
1983. gbmam59.seq - Other mammalian sequence entries, part 59.
1984. gbmam6.seq - Other mammalian sequence entries, part 6.
1985. gbmam60.seq - Other mammalian sequence entries, part 60.
1986. gbmam61.seq - Other mammalian sequence entries, part 61.
1987. gbmam62.seq - Other mammalian sequence entries, part 62.
1988. gbmam63.seq - Other mammalian sequence entries, part 63.
1989. gbmam64.seq - Other mammalian sequence entries, part 64.
1990. gbmam65.seq - Other mammalian sequence entries, part 65.
1991. gbmam66.seq - Other mammalian sequence entries, part 66.
1992. gbmam67.seq - Other mammalian sequence entries, part 67.
1993. gbmam68.seq - Other mammalian sequence entries, part 68.
1994. gbmam69.seq - Other mammalian sequence entries, part 69.
1995. gbmam7.seq - Other mammalian sequence entries, part 7.
1996. gbmam70.seq - Other mammalian sequence entries, part 70.
1997. gbmam71.seq - Other mammalian sequence entries, part 71.
1998. gbmam72.seq - Other mammalian sequence entries, part 72.
1999. gbmam73.seq - Other mammalian sequence entries, part 73.
2000. gbmam74.seq - Other mammalian sequence entries, part 74.
2001. gbmam75.seq - Other mammalian sequence entries, part 75.
2002. gbmam76.seq - Other mammalian sequence entries, part 76.
2003. gbmam77.seq - Other mammalian sequence entries, part 77.
2004. gbmam78.seq - Other mammalian sequence entries, part 78.
2005. gbmam79.seq - Other mammalian sequence entries, part 79.
2006. gbmam8.seq - Other mammalian sequence entries, part 8.
2007. gbmam80.seq - Other mammalian sequence entries, part 80.
2008. gbmam81.seq - Other mammalian sequence entries, part 81.
2009. gbmam82.seq - Other mammalian sequence entries, part 82.
2010. gbmam83.seq - Other mammalian sequence entries, part 83.
2011. gbmam84.seq - Other mammalian sequence entries, part 84.
2012. gbmam85.seq - Other mammalian sequence entries, part 85.
2013. gbmam86.seq - Other mammalian sequence entries, part 86.
2014. gbmam87.seq - Other mammalian sequence entries, part 87.
2015. gbmam88.seq - Other mammalian sequence entries, part 88.
2016. gbmam89.seq - Other mammalian sequence entries, part 89.
2017. gbmam9.seq - Other mammalian sequence entries, part 9.
2018. gbmam90.seq - Other mammalian sequence entries, part 90.
2019. gbmam91.seq - Other mammalian sequence entries, part 91.
2020. gbmam92.seq - Other mammalian sequence entries, part 92.
2021. gbmam93.seq - Other mammalian sequence entries, part 93.
2022. gbmam94.seq - Other mammalian sequence entries, part 94.
2023. gbmam95.seq - Other mammalian sequence entries, part 95.
2024. gbmam96.seq - Other mammalian sequence entries, part 96.
2025. gbmam97.seq - Other mammalian sequence entries, part 97.
2026. gbmam98.seq - Other mammalian sequence entries, part 98.
2027. gbmam99.seq - Other mammalian sequence entries, part 99.
2028. gbnew.txt - Accession numbers of entries new since the previous release.
2029. gbpat1.seq - Patent sequence entries, part 1.
2030. gbpat10.seq - Patent sequence entries, part 10.
2031. gbpat11.seq - Patent sequence entries, part 11.
2032. gbpat12.seq - Patent sequence entries, part 12.
2033. gbpat13.seq - Patent sequence entries, part 13.
2034. gbpat14.seq - Patent sequence entries, part 14.
2035. gbpat15.seq - Patent sequence entries, part 15.
2036. gbpat16.seq - Patent sequence entries, part 16.
2037. gbpat17.seq - Patent sequence entries, part 17.
2038. gbpat18.seq - Patent sequence entries, part 18.
2039. gbpat19.seq - Patent sequence entries, part 19.
2040. gbpat2.seq - Patent sequence entries, part 2.
2041. gbpat20.seq - Patent sequence entries, part 20.
2042. gbpat21.seq - Patent sequence entries, part 21.
2043. gbpat22.seq - Patent sequence entries, part 22.
2044. gbpat23.seq - Patent sequence entries, part 23.
2045. gbpat24.seq - Patent sequence entries, part 24.
2046. gbpat25.seq - Patent sequence entries, part 25.
2047. gbpat26.seq - Patent sequence entries, part 26.
2048. gbpat27.seq - Patent sequence entries, part 27.
2049. gbpat28.seq - Patent sequence entries, part 28.
2050. gbpat29.seq - Patent sequence entries, part 29.
2051. gbpat3.seq - Patent sequence entries, part 3.
2052. gbpat30.seq - Patent sequence entries, part 30.
2053. gbpat31.seq - Patent sequence entries, part 31.
2054. gbpat32.seq - Patent sequence entries, part 32.
2055. gbpat33.seq - Patent sequence entries, part 33.
2056. gbpat34.seq - Patent sequence entries, part 34.
2057. gbpat35.seq - Patent sequence entries, part 35.
2058. gbpat36.seq - Patent sequence entries, part 36.
2059. gbpat37.seq - Patent sequence entries, part 37.
2060. gbpat38.seq - Patent sequence entries, part 38.
2061. gbpat39.seq - Patent sequence entries, part 39.
2062. gbpat4.seq - Patent sequence entries, part 4.
2063. gbpat40.seq - Patent sequence entries, part 40.
2064. gbpat41.seq - Patent sequence entries, part 41.
2065. gbpat42.seq - Patent sequence entries, part 42.
2066. gbpat43.seq - Patent sequence entries, part 43.
2067. gbpat44.seq - Patent sequence entries, part 44.
2068. gbpat45.seq - Patent sequence entries, part 45.
2069. gbpat46.seq - Patent sequence entries, part 46.
2070. gbpat47.seq - Patent sequence entries, part 47.
2071. gbpat48.seq - Patent sequence entries, part 48.
2072. gbpat49.seq - Patent sequence entries, part 49.
2073. gbpat5.seq - Patent sequence entries, part 5.
2074. gbpat50.seq - Patent sequence entries, part 50.
2075. gbpat51.seq - Patent sequence entries, part 51.
2076. gbpat52.seq - Patent sequence entries, part 52.
2077. gbpat53.seq - Patent sequence entries, part 53.
2078. gbpat54.seq - Patent sequence entries, part 54.
2079. gbpat55.seq - Patent sequence entries, part 55.
2080. gbpat56.seq - Patent sequence entries, part 56.
2081. gbpat57.seq - Patent sequence entries, part 57.
2082. gbpat58.seq - Patent sequence entries, part 58.
2083. gbpat59.seq - Patent sequence entries, part 59.
2084. gbpat6.seq - Patent sequence entries, part 6.
2085. gbpat60.seq - Patent sequence entries, part 60.
2086. gbpat61.seq - Patent sequence entries, part 61.
2087. gbpat62.seq - Patent sequence entries, part 62.
2088. gbpat63.seq - Patent sequence entries, part 63.
2089. gbpat64.seq - Patent sequence entries, part 64.
2090. gbpat65.seq - Patent sequence entries, part 65.
2091. gbpat66.seq - Patent sequence entries, part 66.
2092. gbpat67.seq - Patent sequence entries, part 67.
2093. gbpat68.seq - Patent sequence entries, part 68.
2094. gbpat69.seq - Patent sequence entries, part 69.
2095. gbpat7.seq - Patent sequence entries, part 7.
2096. gbpat70.seq - Patent sequence entries, part 70.
2097. gbpat71.seq - Patent sequence entries, part 71.
2098. gbpat72.seq - Patent sequence entries, part 72.
2099. gbpat73.seq - Patent sequence entries, part 73.
2100. gbpat74.seq - Patent sequence entries, part 74.
2101. gbpat75.seq - Patent sequence entries, part 75.
2102. gbpat76.seq - Patent sequence entries, part 76.
2103. gbpat77.seq - Patent sequence entries, part 77.
2104. gbpat78.seq - Patent sequence entries, part 78.
2105. gbpat79.seq - Patent sequence entries, part 79.
2106. gbpat8.seq - Patent sequence entries, part 8.
2107. gbpat80.seq - Patent sequence entries, part 80.
2108. gbpat9.seq - Patent sequence entries, part 9.
2109. gbphg1.seq - Phage sequence entries, part 1.
2110. gbphg2.seq - Phage sequence entries, part 2.
2111. gbphg3.seq - Phage sequence entries, part 3.
2112. gbpln1.seq - Plant sequence entries (including fungi and algae), part 1.
2113. gbpln10.seq - Plant sequence entries (including fungi and algae), part 10.
2114. gbpln100.seq - Plant sequence entries (including fungi and algae), part 100.
2115. gbpln1000.seq - Plant sequence entries (including fungi and algae), part 1000.
2116. gbpln1001.seq - Plant sequence entries (including fungi and algae), part 1001.
2117. gbpln1002.seq - Plant sequence entries (including fungi and algae), part 1002.
2118. gbpln1003.seq - Plant sequence entries (including fungi and algae), part 1003.
2119. gbpln1004.seq - Plant sequence entries (including fungi and algae), part 1004.
2120. gbpln1005.seq - Plant sequence entries (including fungi and algae), part 1005.
2121. gbpln1006.seq - Plant sequence entries (including fungi and algae), part 1006.
2122. gbpln1007.seq - Plant sequence entries (including fungi and algae), part 1007.
2123. gbpln1008.seq - Plant sequence entries (including fungi and algae), part 1008.
2124. gbpln1009.seq - Plant sequence entries (including fungi and algae), part 1009.
2125. gbpln101.seq - Plant sequence entries (including fungi and algae), part 101.
2126. gbpln1010.seq - Plant sequence entries (including fungi and algae), part 1010.
2127. gbpln1011.seq - Plant sequence entries (including fungi and algae), part 1011.
2128. gbpln1012.seq - Plant sequence entries (including fungi and algae), part 1012.
2129. gbpln1013.seq - Plant sequence entries (including fungi and algae), part 1013.
2130. gbpln1014.seq - Plant sequence entries (including fungi and algae), part 1014.
2131. gbpln1015.seq - Plant sequence entries (including fungi and algae), part 1015.
2132. gbpln1016.seq - Plant sequence entries (including fungi and algae), part 1016.
2133. gbpln1017.seq - Plant sequence entries (including fungi and algae), part 1017.
2134. gbpln1018.seq - Plant sequence entries (including fungi and algae), part 1018.
2135. gbpln1019.seq - Plant sequence entries (including fungi and algae), part 1019.
2136. gbpln102.seq - Plant sequence entries (including fungi and algae), part 102.
2137. gbpln1020.seq - Plant sequence entries (including fungi and algae), part 1020.
2138. gbpln1021.seq - Plant sequence entries (including fungi and algae), part 1021.
2139. gbpln1022.seq - Plant sequence entries (including fungi and algae), part 1022.
2140. gbpln1023.seq - Plant sequence entries (including fungi and algae), part 1023.
2141. gbpln1024.seq - Plant sequence entries (including fungi and algae), part 1024.
2142. gbpln1025.seq - Plant sequence entries (including fungi and algae), part 1025.
2143. gbpln1026.seq - Plant sequence entries (including fungi and algae), part 1026.
2144. gbpln1027.seq - Plant sequence entries (including fungi and algae), part 1027.
2145. gbpln1028.seq - Plant sequence entries (including fungi and algae), part 1028.
2146. gbpln1029.seq - Plant sequence entries (including fungi and algae), part 1029.
2147. gbpln103.seq - Plant sequence entries (including fungi and algae), part 103.
2148. gbpln1030.seq - Plant sequence entries (including fungi and algae), part 1030.
2149. gbpln1031.seq - Plant sequence entries (including fungi and algae), part 1031.
2150. gbpln1032.seq - Plant sequence entries (including fungi and algae), part 1032.
2151. gbpln1033.seq - Plant sequence entries (including fungi and algae), part 1033.
2152. gbpln1034.seq - Plant sequence entries (including fungi and algae), part 1034.
2153. gbpln1035.seq - Plant sequence entries (including fungi and algae), part 1035.
2154. gbpln1036.seq - Plant sequence entries (including fungi and algae), part 1036.
2155. gbpln1037.seq - Plant sequence entries (including fungi and algae), part 1037.
2156. gbpln1038.seq - Plant sequence entries (including fungi and algae), part 1038.
2157. gbpln1039.seq - Plant sequence entries (including fungi and algae), part 1039.
2158. gbpln104.seq - Plant sequence entries (including fungi and algae), part 104.
2159. gbpln1040.seq - Plant sequence entries (including fungi and algae), part 1040.
2160. gbpln1041.seq - Plant sequence entries (including fungi and algae), part 1041.
2161. gbpln1042.seq - Plant sequence entries (including fungi and algae), part 1042.
2162. gbpln1043.seq - Plant sequence entries (including fungi and algae), part 1043.
2163. gbpln1044.seq - Plant sequence entries (including fungi and algae), part 1044.
2164. gbpln1045.seq - Plant sequence entries (including fungi and algae), part 1045.
2165. gbpln1046.seq - Plant sequence entries (including fungi and algae), part 1046.
2166. gbpln1047.seq - Plant sequence entries (including fungi and algae), part 1047.
2167. gbpln1048.seq - Plant sequence entries (including fungi and algae), part 1048.
2168. gbpln1049.seq - Plant sequence entries (including fungi and algae), part 1049.
2169. gbpln105.seq - Plant sequence entries (including fungi and algae), part 105.
2170. gbpln1050.seq - Plant sequence entries (including fungi and algae), part 1050.
2171. gbpln1051.seq - Plant sequence entries (including fungi and algae), part 1051.
2172. gbpln1052.seq - Plant sequence entries (including fungi and algae), part 1052.
2173. gbpln1053.seq - Plant sequence entries (including fungi and algae), part 1053.
2174. gbpln1054.seq - Plant sequence entries (including fungi and algae), part 1054.
2175. gbpln1055.seq - Plant sequence entries (including fungi and algae), part 1055.
2176. gbpln1056.seq - Plant sequence entries (including fungi and algae), part 1056.
2177. gbpln1057.seq - Plant sequence entries (including fungi and algae), part 1057.
2178. gbpln1058.seq - Plant sequence entries (including fungi and algae), part 1058.
2179. gbpln1059.seq - Plant sequence entries (including fungi and algae), part 1059.
2180. gbpln106.seq - Plant sequence entries (including fungi and algae), part 106.
2181. gbpln1060.seq - Plant sequence entries (including fungi and algae), part 1060.
2182. gbpln1061.seq - Plant sequence entries (including fungi and algae), part 1061.
2183. gbpln1062.seq - Plant sequence entries (including fungi and algae), part 1062.
2184. gbpln1063.seq - Plant sequence entries (including fungi and algae), part 1063.
2185. gbpln1064.seq - Plant sequence entries (including fungi and algae), part 1064.
2186. gbpln1065.seq - Plant sequence entries (including fungi and algae), part 1065.
2187. gbpln1066.seq - Plant sequence entries (including fungi and algae), part 1066.
2188. gbpln1067.seq - Plant sequence entries (including fungi and algae), part 1067.
2189. gbpln1068.seq - Plant sequence entries (including fungi and algae), part 1068.
2190. gbpln1069.seq - Plant sequence entries (including fungi and algae), part 1069.
2191. gbpln107.seq - Plant sequence entries (including fungi and algae), part 107.
2192. gbpln1070.seq - Plant sequence entries (including fungi and algae), part 1070.
2193. gbpln1071.seq - Plant sequence entries (including fungi and algae), part 1071.
2194. gbpln1072.seq - Plant sequence entries (including fungi and algae), part 1072.
2195. gbpln1073.seq - Plant sequence entries (including fungi and algae), part 1073.
2196. gbpln1074.seq - Plant sequence entries (including fungi and algae), part 1074.
2197. gbpln1075.seq - Plant sequence entries (including fungi and algae), part 1075.
2198. gbpln1076.seq - Plant sequence entries (including fungi and algae), part 1076.
2199. gbpln1077.seq - Plant sequence entries (including fungi and algae), part 1077.
2200. gbpln1078.seq - Plant sequence entries (including fungi and algae), part 1078.
2201. gbpln1079.seq - Plant sequence entries (including fungi and algae), part 1079.
2202. gbpln108.seq - Plant sequence entries (including fungi and algae), part 108.
2203. gbpln1080.seq - Plant sequence entries (including fungi and algae), part 1080.
2204. gbpln1081.seq - Plant sequence entries (including fungi and algae), part 1081.
2205. gbpln1082.seq - Plant sequence entries (including fungi and algae), part 1082.
2206. gbpln1083.seq - Plant sequence entries (including fungi and algae), part 1083.
2207. gbpln1084.seq - Plant sequence entries (including fungi and algae), part 1084.
2208. gbpln1085.seq - Plant sequence entries (including fungi and algae), part 1085.
2209. gbpln1086.seq - Plant sequence entries (including fungi and algae), part 1086.
2210. gbpln1087.seq - Plant sequence entries (including fungi and algae), part 1087.
2211. gbpln1088.seq - Plant sequence entries (including fungi and algae), part 1088.
2212. gbpln1089.seq - Plant sequence entries (including fungi and algae), part 1089.
2213. gbpln109.seq - Plant sequence entries (including fungi and algae), part 109.
2214. gbpln1090.seq - Plant sequence entries (including fungi and algae), part 1090.
2215. gbpln1091.seq - Plant sequence entries (including fungi and algae), part 1091.
2216. gbpln1092.seq - Plant sequence entries (including fungi and algae), part 1092.
2217. gbpln1093.seq - Plant sequence entries (including fungi and algae), part 1093.
2218. gbpln1094.seq - Plant sequence entries (including fungi and algae), part 1094.
2219. gbpln1095.seq - Plant sequence entries (including fungi and algae), part 1095.
2220. gbpln1096.seq - Plant sequence entries (including fungi and algae), part 1096.
2221. gbpln1097.seq - Plant sequence entries (including fungi and algae), part 1097.
2222. gbpln1098.seq - Plant sequence entries (including fungi and algae), part 1098.
2223. gbpln1099.seq - Plant sequence entries (including fungi and algae), part 1099.
2224. gbpln11.seq - Plant sequence entries (including fungi and algae), part 11.
2225. gbpln110.seq - Plant sequence entries (including fungi and algae), part 110.
2226. gbpln1100.seq - Plant sequence entries (including fungi and algae), part 1100.
2227. gbpln1101.seq - Plant sequence entries (including fungi and algae), part 1101.
2228. gbpln1102.seq - Plant sequence entries (including fungi and algae), part 1102.
2229. gbpln1103.seq - Plant sequence entries (including fungi and algae), part 1103.
2230. gbpln1104.seq - Plant sequence entries (including fungi and algae), part 1104.
2231. gbpln1105.seq - Plant sequence entries (including fungi and algae), part 1105.
2232. gbpln1106.seq - Plant sequence entries (including fungi and algae), part 1106.
2233. gbpln1107.seq - Plant sequence entries (including fungi and algae), part 1107.
2234. gbpln1108.seq - Plant sequence entries (including fungi and algae), part 1108.
2235. gbpln1109.seq - Plant sequence entries (including fungi and algae), part 1109.
2236. gbpln111.seq - Plant sequence entries (including fungi and algae), part 111.
2237. gbpln1110.seq - Plant sequence entries (including fungi and algae), part 1110.
2238. gbpln1111.seq - Plant sequence entries (including fungi and algae), part 1111.
2239. gbpln1112.seq - Plant sequence entries (including fungi and algae), part 1112.
2240. gbpln1113.seq - Plant sequence entries (including fungi and algae), part 1113.
2241. gbpln1114.seq - Plant sequence entries (including fungi and algae), part 1114.
2242. gbpln1115.seq - Plant sequence entries (including fungi and algae), part 1115.
2243. gbpln1116.seq - Plant sequence entries (including fungi and algae), part 1116.
2244. gbpln1117.seq - Plant sequence entries (including fungi and algae), part 1117.
2245. gbpln1118.seq - Plant sequence entries (including fungi and algae), part 1118.
2246. gbpln1119.seq - Plant sequence entries (including fungi and algae), part 1119.
2247. gbpln112.seq - Plant sequence entries (including fungi and algae), part 112.
2248. gbpln1120.seq - Plant sequence entries (including fungi and algae), part 1120.
2249. gbpln1121.seq - Plant sequence entries (including fungi and algae), part 1121.
2250. gbpln1122.seq - Plant sequence entries (including fungi and algae), part 1122.
2251. gbpln1123.seq - Plant sequence entries (including fungi and algae), part 1123.
2252. gbpln1124.seq - Plant sequence entries (including fungi and algae), part 1124.
2253. gbpln1125.seq - Plant sequence entries (including fungi and algae), part 1125.
2254. gbpln1126.seq - Plant sequence entries (including fungi and algae), part 1126.
2255. gbpln1127.seq - Plant sequence entries (including fungi and algae), part 1127.
2256. gbpln1128.seq - Plant sequence entries (including fungi and algae), part 1128.
2257. gbpln1129.seq - Plant sequence entries (including fungi and algae), part 1129.
2258. gbpln113.seq - Plant sequence entries (including fungi and algae), part 113.
2259. gbpln1130.seq - Plant sequence entries (including fungi and algae), part 1130.
2260. gbpln1131.seq - Plant sequence entries (including fungi and algae), part 1131.
2261. gbpln1132.seq - Plant sequence entries (including fungi and algae), part 1132.
2262. gbpln1133.seq - Plant sequence entries (including fungi and algae), part 1133.
2263. gbpln1134.seq - Plant sequence entries (including fungi and algae), part 1134.
2264. gbpln1135.seq - Plant sequence entries (including fungi and algae), part 1135.
2265. gbpln1136.seq - Plant sequence entries (including fungi and algae), part 1136.
2266. gbpln1137.seq - Plant sequence entries (including fungi and algae), part 1137.
2267. gbpln1138.seq - Plant sequence entries (including fungi and algae), part 1138.
2268. gbpln1139.seq - Plant sequence entries (including fungi and algae), part 1139.
2269. gbpln114.seq - Plant sequence entries (including fungi and algae), part 114.
2270. gbpln1140.seq - Plant sequence entries (including fungi and algae), part 1140.
2271. gbpln1141.seq - Plant sequence entries (including fungi and algae), part 1141.
2272. gbpln1142.seq - Plant sequence entries (including fungi and algae), part 1142.
2273. gbpln1143.seq - Plant sequence entries (including fungi and algae), part 1143.
2274. gbpln1144.seq - Plant sequence entries (including fungi and algae), part 1144.
2275. gbpln1145.seq - Plant sequence entries (including fungi and algae), part 1145.
2276. gbpln1146.seq - Plant sequence entries (including fungi and algae), part 1146.
2277. gbpln1147.seq - Plant sequence entries (including fungi and algae), part 1147.
2278. gbpln1148.seq - Plant sequence entries (including fungi and algae), part 1148.
2279. gbpln1149.seq - Plant sequence entries (including fungi and algae), part 1149.
2280. gbpln115.seq - Plant sequence entries (including fungi and algae), part 115.
2281. gbpln1150.seq - Plant sequence entries (including fungi and algae), part 1150.
2282. gbpln1151.seq - Plant sequence entries (including fungi and algae), part 1151.
2283. gbpln1152.seq - Plant sequence entries (including fungi and algae), part 1152.
2284. gbpln1153.seq - Plant sequence entries (including fungi and algae), part 1153.
2285. gbpln1154.seq - Plant sequence entries (including fungi and algae), part 1154.
2286. gbpln1155.seq - Plant sequence entries (including fungi and algae), part 1155.
2287. gbpln1156.seq - Plant sequence entries (including fungi and algae), part 1156.
2288. gbpln1157.seq - Plant sequence entries (including fungi and algae), part 1157.
2289. gbpln1158.seq - Plant sequence entries (including fungi and algae), part 1158.
2290. gbpln1159.seq - Plant sequence entries (including fungi and algae), part 1159.
2291. gbpln116.seq - Plant sequence entries (including fungi and algae), part 116.
2292. gbpln1160.seq - Plant sequence entries (including fungi and algae), part 1160.
2293. gbpln1161.seq - Plant sequence entries (including fungi and algae), part 1161.
2294. gbpln1162.seq - Plant sequence entries (including fungi and algae), part 1162.
2295. gbpln1163.seq - Plant sequence entries (including fungi and algae), part 1163.
2296. gbpln1164.seq - Plant sequence entries (including fungi and algae), part 1164.
2297. gbpln1165.seq - Plant sequence entries (including fungi and algae), part 1165.
2298. gbpln1166.seq - Plant sequence entries (including fungi and algae), part 1166.
2299. gbpln1167.seq - Plant sequence entries (including fungi and algae), part 1167.
2300. gbpln1168.seq - Plant sequence entries (including fungi and algae), part 1168.
2301. gbpln1169.seq - Plant sequence entries (including fungi and algae), part 1169.
2302. gbpln117.seq - Plant sequence entries (including fungi and algae), part 117.
2303. gbpln1170.seq - Plant sequence entries (including fungi and algae), part 1170.
2304. gbpln1171.seq - Plant sequence entries (including fungi and algae), part 1171.
2305. gbpln1172.seq - Plant sequence entries (including fungi and algae), part 1172.
2306. gbpln1173.seq - Plant sequence entries (including fungi and algae), part 1173.
2307. gbpln1174.seq - Plant sequence entries (including fungi and algae), part 1174.
2308. gbpln1175.seq - Plant sequence entries (including fungi and algae), part 1175.
2309. gbpln1176.seq - Plant sequence entries (including fungi and algae), part 1176.
2310. gbpln1177.seq - Plant sequence entries (including fungi and algae), part 1177.
2311. gbpln1178.seq - Plant sequence entries (including fungi and algae), part 1178.
2312. gbpln1179.seq - Plant sequence entries (including fungi and algae), part 1179.
2313. gbpln118.seq - Plant sequence entries (including fungi and algae), part 118.
2314. gbpln1180.seq - Plant sequence entries (including fungi and algae), part 1180.
2315. gbpln1181.seq - Plant sequence entries (including fungi and algae), part 1181.
2316. gbpln1182.seq - Plant sequence entries (including fungi and algae), part 1182.
2317. gbpln1183.seq - Plant sequence entries (including fungi and algae), part 1183.
2318. gbpln1184.seq - Plant sequence entries (including fungi and algae), part 1184.
2319. gbpln1185.seq - Plant sequence entries (including fungi and algae), part 1185.
2320. gbpln1186.seq - Plant sequence entries (including fungi and algae), part 1186.
2321. gbpln1187.seq - Plant sequence entries (including fungi and algae), part 1187.
2322. gbpln1188.seq - Plant sequence entries (including fungi and algae), part 1188.
2323. gbpln1189.seq - Plant sequence entries (including fungi and algae), part 1189.
2324. gbpln119.seq - Plant sequence entries (including fungi and algae), part 119.
2325. gbpln1190.seq - Plant sequence entries (including fungi and algae), part 1190.
2326. gbpln1191.seq - Plant sequence entries (including fungi and algae), part 1191.
2327. gbpln1192.seq - Plant sequence entries (including fungi and algae), part 1192.
2328. gbpln1193.seq - Plant sequence entries (including fungi and algae), part 1193.
2329. gbpln1194.seq - Plant sequence entries (including fungi and algae), part 1194.
2330. gbpln1195.seq - Plant sequence entries (including fungi and algae), part 1195.
2331. gbpln1196.seq - Plant sequence entries (including fungi and algae), part 1196.
2332. gbpln1197.seq - Plant sequence entries (including fungi and algae), part 1197.
2333. gbpln1198.seq - Plant sequence entries (including fungi and algae), part 1198.
2334. gbpln1199.seq - Plant sequence entries (including fungi and algae), part 1199.
2335. gbpln12.seq - Plant sequence entries (including fungi and algae), part 12.
2336. gbpln120.seq - Plant sequence entries (including fungi and algae), part 120.
2337. gbpln1200.seq - Plant sequence entries (including fungi and algae), part 1200.
2338. gbpln1201.seq - Plant sequence entries (including fungi and algae), part 1201.
2339. gbpln1202.seq - Plant sequence entries (including fungi and algae), part 1202.
2340. gbpln1203.seq - Plant sequence entries (including fungi and algae), part 1203.
2341. gbpln1204.seq - Plant sequence entries (including fungi and algae), part 1204.
2342. gbpln1205.seq - Plant sequence entries (including fungi and algae), part 1205.
2343. gbpln1206.seq - Plant sequence entries (including fungi and algae), part 1206.
2344. gbpln1207.seq - Plant sequence entries (including fungi and algae), part 1207.
2345. gbpln1208.seq - Plant sequence entries (including fungi and algae), part 1208.
2346. gbpln1209.seq - Plant sequence entries (including fungi and algae), part 1209.
2347. gbpln121.seq - Plant sequence entries (including fungi and algae), part 121.
2348. gbpln1210.seq - Plant sequence entries (including fungi and algae), part 1210.
2349. gbpln1211.seq - Plant sequence entries (including fungi and algae), part 1211.
2350. gbpln1212.seq - Plant sequence entries (including fungi and algae), part 1212.
2351. gbpln1213.seq - Plant sequence entries (including fungi and algae), part 1213.
2352. gbpln1214.seq - Plant sequence entries (including fungi and algae), part 1214.
2353. gbpln1215.seq - Plant sequence entries (including fungi and algae), part 1215.
2354. gbpln1216.seq - Plant sequence entries (including fungi and algae), part 1216.
2355. gbpln1217.seq - Plant sequence entries (including fungi and algae), part 1217.
2356. gbpln1218.seq - Plant sequence entries (including fungi and algae), part 1218.
2357. gbpln1219.seq - Plant sequence entries (including fungi and algae), part 1219.
2358. gbpln122.seq - Plant sequence entries (including fungi and algae), part 122.
2359. gbpln1220.seq - Plant sequence entries (including fungi and algae), part 1220.
2360. gbpln1221.seq - Plant sequence entries (including fungi and algae), part 1221.
2361. gbpln1222.seq - Plant sequence entries (including fungi and algae), part 1222.
2362. gbpln1223.seq - Plant sequence entries (including fungi and algae), part 1223.
2363. gbpln1224.seq - Plant sequence entries (including fungi and algae), part 1224.
2364. gbpln1225.seq - Plant sequence entries (including fungi and algae), part 1225.
2365. gbpln1226.seq - Plant sequence entries (including fungi and algae), part 1226.
2366. gbpln1227.seq - Plant sequence entries (including fungi and algae), part 1227.
2367. gbpln1228.seq - Plant sequence entries (including fungi and algae), part 1228.
2368. gbpln1229.seq - Plant sequence entries (including fungi and algae), part 1229.
2369. gbpln123.seq - Plant sequence entries (including fungi and algae), part 123.
2370. gbpln1230.seq - Plant sequence entries (including fungi and algae), part 1230.
2371. gbpln1231.seq - Plant sequence entries (including fungi and algae), part 1231.
2372. gbpln1232.seq - Plant sequence entries (including fungi and algae), part 1232.
2373. gbpln1233.seq - Plant sequence entries (including fungi and algae), part 1233.
2374. gbpln1234.seq - Plant sequence entries (including fungi and algae), part 1234.
2375. gbpln1235.seq - Plant sequence entries (including fungi and algae), part 1235.
2376. gbpln1236.seq - Plant sequence entries (including fungi and algae), part 1236.
2377. gbpln1237.seq - Plant sequence entries (including fungi and algae), part 1237.
2378. gbpln1238.seq - Plant sequence entries (including fungi and algae), part 1238.
2379. gbpln1239.seq - Plant sequence entries (including fungi and algae), part 1239.
2380. gbpln124.seq - Plant sequence entries (including fungi and algae), part 124.
2381. gbpln1240.seq - Plant sequence entries (including fungi and algae), part 1240.
2382. gbpln1241.seq - Plant sequence entries (including fungi and algae), part 1241.
2383. gbpln1242.seq - Plant sequence entries (including fungi and algae), part 1242.
2384. gbpln1243.seq - Plant sequence entries (including fungi and algae), part 1243.
2385. gbpln1244.seq - Plant sequence entries (including fungi and algae), part 1244.
2386. gbpln1245.seq - Plant sequence entries (including fungi and algae), part 1245.
2387. gbpln1246.seq - Plant sequence entries (including fungi and algae), part 1246.
2388. gbpln1247.seq - Plant sequence entries (including fungi and algae), part 1247.
2389. gbpln1248.seq - Plant sequence entries (including fungi and algae), part 1248.
2390. gbpln1249.seq - Plant sequence entries (including fungi and algae), part 1249.
2391. gbpln125.seq - Plant sequence entries (including fungi and algae), part 125.
2392. gbpln1250.seq - Plant sequence entries (including fungi and algae), part 1250.
2393. gbpln1251.seq - Plant sequence entries (including fungi and algae), part 1251.
2394. gbpln1252.seq - Plant sequence entries (including fungi and algae), part 1252.
2395. gbpln1253.seq - Plant sequence entries (including fungi and algae), part 1253.
2396. gbpln1254.seq - Plant sequence entries (including fungi and algae), part 1254.
2397. gbpln1255.seq - Plant sequence entries (including fungi and algae), part 1255.
2398. gbpln1256.seq - Plant sequence entries (including fungi and algae), part 1256.
2399. gbpln1257.seq - Plant sequence entries (including fungi and algae), part 1257.
2400. gbpln1258.seq - Plant sequence entries (including fungi and algae), part 1258.
2401. gbpln1259.seq - Plant sequence entries (including fungi and algae), part 1259.
2402. gbpln126.seq - Plant sequence entries (including fungi and algae), part 126.
2403. gbpln1260.seq - Plant sequence entries (including fungi and algae), part 1260.
2404. gbpln1261.seq - Plant sequence entries (including fungi and algae), part 1261.
2405. gbpln1262.seq - Plant sequence entries (including fungi and algae), part 1262.
2406. gbpln1263.seq - Plant sequence entries (including fungi and algae), part 1263.
2407. gbpln1264.seq - Plant sequence entries (including fungi and algae), part 1264.
2408. gbpln1265.seq - Plant sequence entries (including fungi and algae), part 1265.
2409. gbpln1266.seq - Plant sequence entries (including fungi and algae), part 1266.
2410. gbpln1267.seq - Plant sequence entries (including fungi and algae), part 1267.
2411. gbpln1268.seq - Plant sequence entries (including fungi and algae), part 1268.
2412. gbpln1269.seq - Plant sequence entries (including fungi and algae), part 1269.
2413. gbpln127.seq - Plant sequence entries (including fungi and algae), part 127.
2414. gbpln1270.seq - Plant sequence entries (including fungi and algae), part 1270.
2415. gbpln1271.seq - Plant sequence entries (including fungi and algae), part 1271.
2416. gbpln1272.seq - Plant sequence entries (including fungi and algae), part 1272.
2417. gbpln1273.seq - Plant sequence entries (including fungi and algae), part 1273.
2418. gbpln1274.seq - Plant sequence entries (including fungi and algae), part 1274.
2419. gbpln1275.seq - Plant sequence entries (including fungi and algae), part 1275.
2420. gbpln1276.seq - Plant sequence entries (including fungi and algae), part 1276.
2421. gbpln1277.seq - Plant sequence entries (including fungi and algae), part 1277.
2422. gbpln1278.seq - Plant sequence entries (including fungi and algae), part 1278.
2423. gbpln1279.seq - Plant sequence entries (including fungi and algae), part 1279.
2424. gbpln128.seq - Plant sequence entries (including fungi and algae), part 128.
2425. gbpln1280.seq - Plant sequence entries (including fungi and algae), part 1280.
2426. gbpln1281.seq - Plant sequence entries (including fungi and algae), part 1281.
2427. gbpln1282.seq - Plant sequence entries (including fungi and algae), part 1282.
2428. gbpln1283.seq - Plant sequence entries (including fungi and algae), part 1283.
2429. gbpln1284.seq - Plant sequence entries (including fungi and algae), part 1284.
2430. gbpln1285.seq - Plant sequence entries (including fungi and algae), part 1285.
2431. gbpln1286.seq - Plant sequence entries (including fungi and algae), part 1286.
2432. gbpln1287.seq - Plant sequence entries (including fungi and algae), part 1287.
2433. gbpln1288.seq - Plant sequence entries (including fungi and algae), part 1288.
2434. gbpln1289.seq - Plant sequence entries (including fungi and algae), part 1289.
2435. gbpln129.seq - Plant sequence entries (including fungi and algae), part 129.
2436. gbpln1290.seq - Plant sequence entries (including fungi and algae), part 1290.
2437. gbpln1291.seq - Plant sequence entries (including fungi and algae), part 1291.
2438. gbpln1292.seq - Plant sequence entries (including fungi and algae), part 1292.
2439. gbpln1293.seq - Plant sequence entries (including fungi and algae), part 1293.
2440. gbpln1294.seq - Plant sequence entries (including fungi and algae), part 1294.
2441. gbpln1295.seq - Plant sequence entries (including fungi and algae), part 1295.
2442. gbpln1296.seq - Plant sequence entries (including fungi and algae), part 1296.
2443. gbpln1297.seq - Plant sequence entries (including fungi and algae), part 1297.
2444. gbpln1298.seq - Plant sequence entries (including fungi and algae), part 1298.
2445. gbpln1299.seq - Plant sequence entries (including fungi and algae), part 1299.
2446. gbpln13.seq - Plant sequence entries (including fungi and algae), part 13.
2447. gbpln130.seq - Plant sequence entries (including fungi and algae), part 130.
2448. gbpln1300.seq - Plant sequence entries (including fungi and algae), part 1300.
2449. gbpln1301.seq - Plant sequence entries (including fungi and algae), part 1301.
2450. gbpln1302.seq - Plant sequence entries (including fungi and algae), part 1302.
2451. gbpln1303.seq - Plant sequence entries (including fungi and algae), part 1303.
2452. gbpln1304.seq - Plant sequence entries (including fungi and algae), part 1304.
2453. gbpln1305.seq - Plant sequence entries (including fungi and algae), part 1305.
2454. gbpln1306.seq - Plant sequence entries (including fungi and algae), part 1306.
2455. gbpln1307.seq - Plant sequence entries (including fungi and algae), part 1307.
2456. gbpln1308.seq - Plant sequence entries (including fungi and algae), part 1308.
2457. gbpln1309.seq - Plant sequence entries (including fungi and algae), part 1309.
2458. gbpln131.seq - Plant sequence entries (including fungi and algae), part 131.
2459. gbpln1310.seq - Plant sequence entries (including fungi and algae), part 1310.
2460. gbpln1311.seq - Plant sequence entries (including fungi and algae), part 1311.
2461. gbpln1312.seq - Plant sequence entries (including fungi and algae), part 1312.
2462. gbpln1313.seq - Plant sequence entries (including fungi and algae), part 1313.
2463. gbpln1314.seq - Plant sequence entries (including fungi and algae), part 1314.
2464. gbpln1315.seq - Plant sequence entries (including fungi and algae), part 1315.
2465. gbpln1316.seq - Plant sequence entries (including fungi and algae), part 1316.
2466. gbpln1317.seq - Plant sequence entries (including fungi and algae), part 1317.
2467. gbpln1318.seq - Plant sequence entries (including fungi and algae), part 1318.
2468. gbpln1319.seq - Plant sequence entries (including fungi and algae), part 1319.
2469. gbpln132.seq - Plant sequence entries (including fungi and algae), part 132.
2470. gbpln1320.seq - Plant sequence entries (including fungi and algae), part 1320.
2471. gbpln1321.seq - Plant sequence entries (including fungi and algae), part 1321.
2472. gbpln1322.seq - Plant sequence entries (including fungi and algae), part 1322.
2473. gbpln1323.seq - Plant sequence entries (including fungi and algae), part 1323.
2474. gbpln1324.seq - Plant sequence entries (including fungi and algae), part 1324.
2475. gbpln1325.seq - Plant sequence entries (including fungi and algae), part 1325.
2476. gbpln1326.seq - Plant sequence entries (including fungi and algae), part 1326.
2477. gbpln1327.seq - Plant sequence entries (including fungi and algae), part 1327.
2478. gbpln1328.seq - Plant sequence entries (including fungi and algae), part 1328.
2479. gbpln1329.seq - Plant sequence entries (including fungi and algae), part 1329.
2480. gbpln133.seq - Plant sequence entries (including fungi and algae), part 133.
2481. gbpln1330.seq - Plant sequence entries (including fungi and algae), part 1330.
2482. gbpln1331.seq - Plant sequence entries (including fungi and algae), part 1331.
2483. gbpln1332.seq - Plant sequence entries (including fungi and algae), part 1332.
2484. gbpln1333.seq - Plant sequence entries (including fungi and algae), part 1333.
2485. gbpln1334.seq - Plant sequence entries (including fungi and algae), part 1334.
2486. gbpln1335.seq - Plant sequence entries (including fungi and algae), part 1335.
2487. gbpln1336.seq - Plant sequence entries (including fungi and algae), part 1336.
2488. gbpln1337.seq - Plant sequence entries (including fungi and algae), part 1337.
2489. gbpln1338.seq - Plant sequence entries (including fungi and algae), part 1338.
2490. gbpln1339.seq - Plant sequence entries (including fungi and algae), part 1339.
2491. gbpln134.seq - Plant sequence entries (including fungi and algae), part 134.
2492. gbpln1340.seq - Plant sequence entries (including fungi and algae), part 1340.
2493. gbpln1341.seq - Plant sequence entries (including fungi and algae), part 1341.
2494. gbpln1342.seq - Plant sequence entries (including fungi and algae), part 1342.
2495. gbpln1343.seq - Plant sequence entries (including fungi and algae), part 1343.
2496. gbpln1344.seq - Plant sequence entries (including fungi and algae), part 1344.
2497. gbpln1345.seq - Plant sequence entries (including fungi and algae), part 1345.
2498. gbpln1346.seq - Plant sequence entries (including fungi and algae), part 1346.
2499. gbpln1347.seq - Plant sequence entries (including fungi and algae), part 1347.
2500. gbpln1348.seq - Plant sequence entries (including fungi and algae), part 1348.
2501. gbpln1349.seq - Plant sequence entries (including fungi and algae), part 1349.
2502. gbpln135.seq - Plant sequence entries (including fungi and algae), part 135.
2503. gbpln1350.seq - Plant sequence entries (including fungi and algae), part 1350.
2504. gbpln1351.seq - Plant sequence entries (including fungi and algae), part 1351.
2505. gbpln1352.seq - Plant sequence entries (including fungi and algae), part 1352.
2506. gbpln1353.seq - Plant sequence entries (including fungi and algae), part 1353.
2507. gbpln1354.seq - Plant sequence entries (including fungi and algae), part 1354.
2508. gbpln1355.seq - Plant sequence entries (including fungi and algae), part 1355.
2509. gbpln1356.seq - Plant sequence entries (including fungi and algae), part 1356.
2510. gbpln1357.seq - Plant sequence entries (including fungi and algae), part 1357.
2511. gbpln1358.seq - Plant sequence entries (including fungi and algae), part 1358.
2512. gbpln1359.seq - Plant sequence entries (including fungi and algae), part 1359.
2513. gbpln136.seq - Plant sequence entries (including fungi and algae), part 136.
2514. gbpln1360.seq - Plant sequence entries (including fungi and algae), part 1360.
2515. gbpln1361.seq - Plant sequence entries (including fungi and algae), part 1361.
2516. gbpln1362.seq - Plant sequence entries (including fungi and algae), part 1362.
2517. gbpln1363.seq - Plant sequence entries (including fungi and algae), part 1363.
2518. gbpln1364.seq - Plant sequence entries (including fungi and algae), part 1364.
2519. gbpln1365.seq - Plant sequence entries (including fungi and algae), part 1365.
2520. gbpln1366.seq - Plant sequence entries (including fungi and algae), part 1366.
2521. gbpln1367.seq - Plant sequence entries (including fungi and algae), part 1367.
2522. gbpln1368.seq - Plant sequence entries (including fungi and algae), part 1368.
2523. gbpln1369.seq - Plant sequence entries (including fungi and algae), part 1369.
2524. gbpln137.seq - Plant sequence entries (including fungi and algae), part 137.
2525. gbpln1370.seq - Plant sequence entries (including fungi and algae), part 1370.
2526. gbpln1371.seq - Plant sequence entries (including fungi and algae), part 1371.
2527. gbpln1372.seq - Plant sequence entries (including fungi and algae), part 1372.
2528. gbpln1373.seq - Plant sequence entries (including fungi and algae), part 1373.
2529. gbpln1374.seq - Plant sequence entries (including fungi and algae), part 1374.
2530. gbpln1375.seq - Plant sequence entries (including fungi and algae), part 1375.
2531. gbpln1376.seq - Plant sequence entries (including fungi and algae), part 1376.
2532. gbpln1377.seq - Plant sequence entries (including fungi and algae), part 1377.
2533. gbpln1378.seq - Plant sequence entries (including fungi and algae), part 1378.
2534. gbpln1379.seq - Plant sequence entries (including fungi and algae), part 1379.
2535. gbpln138.seq - Plant sequence entries (including fungi and algae), part 138.
2536. gbpln1380.seq - Plant sequence entries (including fungi and algae), part 1380.
2537. gbpln1381.seq - Plant sequence entries (including fungi and algae), part 1381.
2538. gbpln1382.seq - Plant sequence entries (including fungi and algae), part 1382.
2539. gbpln1383.seq - Plant sequence entries (including fungi and algae), part 1383.
2540. gbpln1384.seq - Plant sequence entries (including fungi and algae), part 1384.
2541. gbpln1385.seq - Plant sequence entries (including fungi and algae), part 1385.
2542. gbpln1386.seq - Plant sequence entries (including fungi and algae), part 1386.
2543. gbpln1387.seq - Plant sequence entries (including fungi and algae), part 1387.
2544. gbpln1388.seq - Plant sequence entries (including fungi and algae), part 1388.
2545. gbpln1389.seq - Plant sequence entries (including fungi and algae), part 1389.
2546. gbpln139.seq - Plant sequence entries (including fungi and algae), part 139.
2547. gbpln1390.seq - Plant sequence entries (including fungi and algae), part 1390.
2548. gbpln1391.seq - Plant sequence entries (including fungi and algae), part 1391.
2549. gbpln1392.seq - Plant sequence entries (including fungi and algae), part 1392.
2550. gbpln1393.seq - Plant sequence entries (including fungi and algae), part 1393.
2551. gbpln1394.seq - Plant sequence entries (including fungi and algae), part 1394.
2552. gbpln1395.seq - Plant sequence entries (including fungi and algae), part 1395.
2553. gbpln1396.seq - Plant sequence entries (including fungi and algae), part 1396.
2554. gbpln1397.seq - Plant sequence entries (including fungi and algae), part 1397.
2555. gbpln1398.seq - Plant sequence entries (including fungi and algae), part 1398.
2556. gbpln1399.seq - Plant sequence entries (including fungi and algae), part 1399.
2557. gbpln14.seq - Plant sequence entries (including fungi and algae), part 14.
2558. gbpln140.seq - Plant sequence entries (including fungi and algae), part 140.
2559. gbpln1400.seq - Plant sequence entries (including fungi and algae), part 1400.
2560. gbpln1401.seq - Plant sequence entries (including fungi and algae), part 1401.
2561. gbpln1402.seq - Plant sequence entries (including fungi and algae), part 1402.
2562. gbpln1403.seq - Plant sequence entries (including fungi and algae), part 1403.
2563. gbpln1404.seq - Plant sequence entries (including fungi and algae), part 1404.
2564. gbpln1405.seq - Plant sequence entries (including fungi and algae), part 1405.
2565. gbpln1406.seq - Plant sequence entries (including fungi and algae), part 1406.
2566. gbpln1407.seq - Plant sequence entries (including fungi and algae), part 1407.
2567. gbpln1408.seq - Plant sequence entries (including fungi and algae), part 1408.
2568. gbpln1409.seq - Plant sequence entries (including fungi and algae), part 1409.
2569. gbpln141.seq - Plant sequence entries (including fungi and algae), part 141.
2570. gbpln1410.seq - Plant sequence entries (including fungi and algae), part 1410.
2571. gbpln1411.seq - Plant sequence entries (including fungi and algae), part 1411.
2572. gbpln1412.seq - Plant sequence entries (including fungi and algae), part 1412.
2573. gbpln1413.seq - Plant sequence entries (including fungi and algae), part 1413.
2574. gbpln1414.seq - Plant sequence entries (including fungi and algae), part 1414.
2575. gbpln1415.seq - Plant sequence entries (including fungi and algae), part 1415.
2576. gbpln1416.seq - Plant sequence entries (including fungi and algae), part 1416.
2577. gbpln1417.seq - Plant sequence entries (including fungi and algae), part 1417.
2578. gbpln1418.seq - Plant sequence entries (including fungi and algae), part 1418.
2579. gbpln1419.seq - Plant sequence entries (including fungi and algae), part 1419.
2580. gbpln142.seq - Plant sequence entries (including fungi and algae), part 142.
2581. gbpln1420.seq - Plant sequence entries (including fungi and algae), part 1420.
2582. gbpln1421.seq - Plant sequence entries (including fungi and algae), part 1421.
2583. gbpln1422.seq - Plant sequence entries (including fungi and algae), part 1422.
2584. gbpln1423.seq - Plant sequence entries (including fungi and algae), part 1423.
2585. gbpln1424.seq - Plant sequence entries (including fungi and algae), part 1424.
2586. gbpln1425.seq - Plant sequence entries (including fungi and algae), part 1425.
2587. gbpln1426.seq - Plant sequence entries (including fungi and algae), part 1426.
2588. gbpln1427.seq - Plant sequence entries (including fungi and algae), part 1427.
2589. gbpln1428.seq - Plant sequence entries (including fungi and algae), part 1428.
2590. gbpln1429.seq - Plant sequence entries (including fungi and algae), part 1429.
2591. gbpln143.seq - Plant sequence entries (including fungi and algae), part 143.
2592. gbpln1430.seq - Plant sequence entries (including fungi and algae), part 1430.
2593. gbpln1431.seq - Plant sequence entries (including fungi and algae), part 1431.
2594. gbpln1432.seq - Plant sequence entries (including fungi and algae), part 1432.
2595. gbpln1433.seq - Plant sequence entries (including fungi and algae), part 1433.
2596. gbpln1434.seq - Plant sequence entries (including fungi and algae), part 1434.
2597. gbpln1435.seq - Plant sequence entries (including fungi and algae), part 1435.
2598. gbpln1436.seq - Plant sequence entries (including fungi and algae), part 1436.
2599. gbpln1437.seq - Plant sequence entries (including fungi and algae), part 1437.
2600. gbpln1438.seq - Plant sequence entries (including fungi and algae), part 1438.
2601. gbpln1439.seq - Plant sequence entries (including fungi and algae), part 1439.
2602. gbpln144.seq - Plant sequence entries (including fungi and algae), part 144.
2603. gbpln1440.seq - Plant sequence entries (including fungi and algae), part 1440.
2604. gbpln1441.seq - Plant sequence entries (including fungi and algae), part 1441.
2605. gbpln1442.seq - Plant sequence entries (including fungi and algae), part 1442.
2606. gbpln1443.seq - Plant sequence entries (including fungi and algae), part 1443.
2607. gbpln1444.seq - Plant sequence entries (including fungi and algae), part 1444.
2608. gbpln1445.seq - Plant sequence entries (including fungi and algae), part 1445.
2609. gbpln1446.seq - Plant sequence entries (including fungi and algae), part 1446.
2610. gbpln1447.seq - Plant sequence entries (including fungi and algae), part 1447.
2611. gbpln1448.seq - Plant sequence entries (including fungi and algae), part 1448.
2612. gbpln1449.seq - Plant sequence entries (including fungi and algae), part 1449.
2613. gbpln145.seq - Plant sequence entries (including fungi and algae), part 145.
2614. gbpln1450.seq - Plant sequence entries (including fungi and algae), part 1450.
2615. gbpln1451.seq - Plant sequence entries (including fungi and algae), part 1451.
2616. gbpln1452.seq - Plant sequence entries (including fungi and algae), part 1452.
2617. gbpln1453.seq - Plant sequence entries (including fungi and algae), part 1453.
2618. gbpln1454.seq - Plant sequence entries (including fungi and algae), part 1454.
2619. gbpln1455.seq - Plant sequence entries (including fungi and algae), part 1455.
2620. gbpln1456.seq - Plant sequence entries (including fungi and algae), part 1456.
2621. gbpln1457.seq - Plant sequence entries (including fungi and algae), part 1457.
2622. gbpln1458.seq - Plant sequence entries (including fungi and algae), part 1458.
2623. gbpln1459.seq - Plant sequence entries (including fungi and algae), part 1459.
2624. gbpln146.seq - Plant sequence entries (including fungi and algae), part 146.
2625. gbpln1460.seq - Plant sequence entries (including fungi and algae), part 1460.
2626. gbpln1461.seq - Plant sequence entries (including fungi and algae), part 1461.
2627. gbpln1462.seq - Plant sequence entries (including fungi and algae), part 1462.
2628. gbpln1463.seq - Plant sequence entries (including fungi and algae), part 1463.
2629. gbpln1464.seq - Plant sequence entries (including fungi and algae), part 1464.
2630. gbpln1465.seq - Plant sequence entries (including fungi and algae), part 1465.
2631. gbpln1466.seq - Plant sequence entries (including fungi and algae), part 1466.
2632. gbpln1467.seq - Plant sequence entries (including fungi and algae), part 1467.
2633. gbpln1468.seq - Plant sequence entries (including fungi and algae), part 1468.
2634. gbpln1469.seq - Plant sequence entries (including fungi and algae), part 1469.
2635. gbpln147.seq - Plant sequence entries (including fungi and algae), part 147.
2636. gbpln1470.seq - Plant sequence entries (including fungi and algae), part 1470.
2637. gbpln1471.seq - Plant sequence entries (including fungi and algae), part 1471.
2638. gbpln1472.seq - Plant sequence entries (including fungi and algae), part 1472.
2639. gbpln1473.seq - Plant sequence entries (including fungi and algae), part 1473.
2640. gbpln1474.seq - Plant sequence entries (including fungi and algae), part 1474.
2641. gbpln1475.seq - Plant sequence entries (including fungi and algae), part 1475.
2642. gbpln1476.seq - Plant sequence entries (including fungi and algae), part 1476.
2643. gbpln1477.seq - Plant sequence entries (including fungi and algae), part 1477.
2644. gbpln1478.seq - Plant sequence entries (including fungi and algae), part 1478.
2645. gbpln1479.seq - Plant sequence entries (including fungi and algae), part 1479.
2646. gbpln148.seq - Plant sequence entries (including fungi and algae), part 148.
2647. gbpln1480.seq - Plant sequence entries (including fungi and algae), part 1480.
2648. gbpln1481.seq - Plant sequence entries (including fungi and algae), part 1481.
2649. gbpln1482.seq - Plant sequence entries (including fungi and algae), part 1482.
2650. gbpln1483.seq - Plant sequence entries (including fungi and algae), part 1483.
2651. gbpln1484.seq - Plant sequence entries (including fungi and algae), part 1484.
2652. gbpln1485.seq - Plant sequence entries (including fungi and algae), part 1485.
2653. gbpln1486.seq - Plant sequence entries (including fungi and algae), part 1486.
2654. gbpln1487.seq - Plant sequence entries (including fungi and algae), part 1487.
2655. gbpln1488.seq - Plant sequence entries (including fungi and algae), part 1488.
2656. gbpln1489.seq - Plant sequence entries (including fungi and algae), part 1489.
2657. gbpln149.seq - Plant sequence entries (including fungi and algae), part 149.
2658. gbpln1490.seq - Plant sequence entries (including fungi and algae), part 1490.
2659. gbpln1491.seq - Plant sequence entries (including fungi and algae), part 1491.
2660. gbpln1492.seq - Plant sequence entries (including fungi and algae), part 1492.
2661. gbpln1493.seq - Plant sequence entries (including fungi and algae), part 1493.
2662. gbpln1494.seq - Plant sequence entries (including fungi and algae), part 1494.
2663. gbpln1495.seq - Plant sequence entries (including fungi and algae), part 1495.
2664. gbpln1496.seq - Plant sequence entries (including fungi and algae), part 1496.
2665. gbpln1497.seq - Plant sequence entries (including fungi and algae), part 1497.
2666. gbpln1498.seq - Plant sequence entries (including fungi and algae), part 1498.
2667. gbpln1499.seq - Plant sequence entries (including fungi and algae), part 1499.
2668. gbpln15.seq - Plant sequence entries (including fungi and algae), part 15.
2669. gbpln150.seq - Plant sequence entries (including fungi and algae), part 150.
2670. gbpln1500.seq - Plant sequence entries (including fungi and algae), part 1500.
2671. gbpln1501.seq - Plant sequence entries (including fungi and algae), part 1501.
2672. gbpln1502.seq - Plant sequence entries (including fungi and algae), part 1502.
2673. gbpln1503.seq - Plant sequence entries (including fungi and algae), part 1503.
2674. gbpln1504.seq - Plant sequence entries (including fungi and algae), part 1504.
2675. gbpln1505.seq - Plant sequence entries (including fungi and algae), part 1505.
2676. gbpln1506.seq - Plant sequence entries (including fungi and algae), part 1506.
2677. gbpln1507.seq - Plant sequence entries (including fungi and algae), part 1507.
2678. gbpln1508.seq - Plant sequence entries (including fungi and algae), part 1508.
2679. gbpln1509.seq - Plant sequence entries (including fungi and algae), part 1509.
2680. gbpln151.seq - Plant sequence entries (including fungi and algae), part 151.
2681. gbpln1510.seq - Plant sequence entries (including fungi and algae), part 1510.
2682. gbpln1511.seq - Plant sequence entries (including fungi and algae), part 1511.
2683. gbpln1512.seq - Plant sequence entries (including fungi and algae), part 1512.
2684. gbpln1513.seq - Plant sequence entries (including fungi and algae), part 1513.
2685. gbpln1514.seq - Plant sequence entries (including fungi and algae), part 1514.
2686. gbpln1515.seq - Plant sequence entries (including fungi and algae), part 1515.
2687. gbpln1516.seq - Plant sequence entries (including fungi and algae), part 1516.
2688. gbpln1517.seq - Plant sequence entries (including fungi and algae), part 1517.
2689. gbpln1518.seq - Plant sequence entries (including fungi and algae), part 1518.
2690. gbpln1519.seq - Plant sequence entries (including fungi and algae), part 1519.
2691. gbpln152.seq - Plant sequence entries (including fungi and algae), part 152.
2692. gbpln1520.seq - Plant sequence entries (including fungi and algae), part 1520.
2693. gbpln1521.seq - Plant sequence entries (including fungi and algae), part 1521.
2694. gbpln1522.seq - Plant sequence entries (including fungi and algae), part 1522.
2695. gbpln1523.seq - Plant sequence entries (including fungi and algae), part 1523.
2696. gbpln1524.seq - Plant sequence entries (including fungi and algae), part 1524.
2697. gbpln1525.seq - Plant sequence entries (including fungi and algae), part 1525.
2698. gbpln1526.seq - Plant sequence entries (including fungi and algae), part 1526.
2699. gbpln1527.seq - Plant sequence entries (including fungi and algae), part 1527.
2700. gbpln1528.seq - Plant sequence entries (including fungi and algae), part 1528.
2701. gbpln1529.seq - Plant sequence entries (including fungi and algae), part 1529.
2702. gbpln153.seq - Plant sequence entries (including fungi and algae), part 153.
2703. gbpln1530.seq - Plant sequence entries (including fungi and algae), part 1530.
2704. gbpln1531.seq - Plant sequence entries (including fungi and algae), part 1531.
2705. gbpln1532.seq - Plant sequence entries (including fungi and algae), part 1532.
2706. gbpln1533.seq - Plant sequence entries (including fungi and algae), part 1533.
2707. gbpln1534.seq - Plant sequence entries (including fungi and algae), part 1534.
2708. gbpln1535.seq - Plant sequence entries (including fungi and algae), part 1535.
2709. gbpln1536.seq - Plant sequence entries (including fungi and algae), part 1536.
2710. gbpln1537.seq - Plant sequence entries (including fungi and algae), part 1537.
2711. gbpln1538.seq - Plant sequence entries (including fungi and algae), part 1538.
2712. gbpln1539.seq - Plant sequence entries (including fungi and algae), part 1539.
2713. gbpln154.seq - Plant sequence entries (including fungi and algae), part 154.
2714. gbpln1540.seq - Plant sequence entries (including fungi and algae), part 1540.
2715. gbpln1541.seq - Plant sequence entries (including fungi and algae), part 1541.
2716. gbpln1542.seq - Plant sequence entries (including fungi and algae), part 1542.
2717. gbpln1543.seq - Plant sequence entries (including fungi and algae), part 1543.
2718. gbpln1544.seq - Plant sequence entries (including fungi and algae), part 1544.
2719. gbpln1545.seq - Plant sequence entries (including fungi and algae), part 1545.
2720. gbpln1546.seq - Plant sequence entries (including fungi and algae), part 1546.
2721. gbpln1547.seq - Plant sequence entries (including fungi and algae), part 1547.
2722. gbpln1548.seq - Plant sequence entries (including fungi and algae), part 1548.
2723. gbpln1549.seq - Plant sequence entries (including fungi and algae), part 1549.
2724. gbpln155.seq - Plant sequence entries (including fungi and algae), part 155.
2725. gbpln1550.seq - Plant sequence entries (including fungi and algae), part 1550.
2726. gbpln1551.seq - Plant sequence entries (including fungi and algae), part 1551.
2727. gbpln1552.seq - Plant sequence entries (including fungi and algae), part 1552.
2728. gbpln1553.seq - Plant sequence entries (including fungi and algae), part 1553.
2729. gbpln1554.seq - Plant sequence entries (including fungi and algae), part 1554.
2730. gbpln1555.seq - Plant sequence entries (including fungi and algae), part 1555.
2731. gbpln1556.seq - Plant sequence entries (including fungi and algae), part 1556.
2732. gbpln1557.seq - Plant sequence entries (including fungi and algae), part 1557.
2733. gbpln1558.seq - Plant sequence entries (including fungi and algae), part 1558.
2734. gbpln1559.seq - Plant sequence entries (including fungi and algae), part 1559.
2735. gbpln156.seq - Plant sequence entries (including fungi and algae), part 156.
2736. gbpln1560.seq - Plant sequence entries (including fungi and algae), part 1560.
2737. gbpln1561.seq - Plant sequence entries (including fungi and algae), part 1561.
2738. gbpln1562.seq - Plant sequence entries (including fungi and algae), part 1562.
2739. gbpln1563.seq - Plant sequence entries (including fungi and algae), part 1563.
2740. gbpln1564.seq - Plant sequence entries (including fungi and algae), part 1564.
2741. gbpln1565.seq - Plant sequence entries (including fungi and algae), part 1565.
2742. gbpln1566.seq - Plant sequence entries (including fungi and algae), part 1566.
2743. gbpln1567.seq - Plant sequence entries (including fungi and algae), part 1567.
2744. gbpln1568.seq - Plant sequence entries (including fungi and algae), part 1568.
2745. gbpln1569.seq - Plant sequence entries (including fungi and algae), part 1569.
2746. gbpln157.seq - Plant sequence entries (including fungi and algae), part 157.
2747. gbpln1570.seq - Plant sequence entries (including fungi and algae), part 1570.
2748. gbpln1571.seq - Plant sequence entries (including fungi and algae), part 1571.
2749. gbpln1572.seq - Plant sequence entries (including fungi and algae), part 1572.
2750. gbpln1573.seq - Plant sequence entries (including fungi and algae), part 1573.
2751. gbpln1574.seq - Plant sequence entries (including fungi and algae), part 1574.
2752. gbpln1575.seq - Plant sequence entries (including fungi and algae), part 1575.
2753. gbpln1576.seq - Plant sequence entries (including fungi and algae), part 1576.
2754. gbpln1577.seq - Plant sequence entries (including fungi and algae), part 1577.
2755. gbpln1578.seq - Plant sequence entries (including fungi and algae), part 1578.
2756. gbpln1579.seq - Plant sequence entries (including fungi and algae), part 1579.
2757. gbpln158.seq - Plant sequence entries (including fungi and algae), part 158.
2758. gbpln1580.seq - Plant sequence entries (including fungi and algae), part 1580.
2759. gbpln1581.seq - Plant sequence entries (including fungi and algae), part 1581.
2760. gbpln1582.seq - Plant sequence entries (including fungi and algae), part 1582.
2761. gbpln1583.seq - Plant sequence entries (including fungi and algae), part 1583.
2762. gbpln1584.seq - Plant sequence entries (including fungi and algae), part 1584.
2763. gbpln1585.seq - Plant sequence entries (including fungi and algae), part 1585.
2764. gbpln1586.seq - Plant sequence entries (including fungi and algae), part 1586.
2765. gbpln1587.seq - Plant sequence entries (including fungi and algae), part 1587.
2766. gbpln1588.seq - Plant sequence entries (including fungi and algae), part 1588.
2767. gbpln1589.seq - Plant sequence entries (including fungi and algae), part 1589.
2768. gbpln159.seq - Plant sequence entries (including fungi and algae), part 159.
2769. gbpln1590.seq - Plant sequence entries (including fungi and algae), part 1590.
2770. gbpln1591.seq - Plant sequence entries (including fungi and algae), part 1591.
2771. gbpln1592.seq - Plant sequence entries (including fungi and algae), part 1592.
2772. gbpln1593.seq - Plant sequence entries (including fungi and algae), part 1593.
2773. gbpln1594.seq - Plant sequence entries (including fungi and algae), part 1594.
2774. gbpln1595.seq - Plant sequence entries (including fungi and algae), part 1595.
2775. gbpln1596.seq - Plant sequence entries (including fungi and algae), part 1596.
2776. gbpln1597.seq - Plant sequence entries (including fungi and algae), part 1597.
2777. gbpln1598.seq - Plant sequence entries (including fungi and algae), part 1598.
2778. gbpln1599.seq - Plant sequence entries (including fungi and algae), part 1599.
2779. gbpln16.seq - Plant sequence entries (including fungi and algae), part 16.
2780. gbpln160.seq - Plant sequence entries (including fungi and algae), part 160.
2781. gbpln1600.seq - Plant sequence entries (including fungi and algae), part 1600.
2782. gbpln1601.seq - Plant sequence entries (including fungi and algae), part 1601.
2783. gbpln1602.seq - Plant sequence entries (including fungi and algae), part 1602.
2784. gbpln1603.seq - Plant sequence entries (including fungi and algae), part 1603.
2785. gbpln1604.seq - Plant sequence entries (including fungi and algae), part 1604.
2786. gbpln1605.seq - Plant sequence entries (including fungi and algae), part 1605.
2787. gbpln1606.seq - Plant sequence entries (including fungi and algae), part 1606.
2788. gbpln1607.seq - Plant sequence entries (including fungi and algae), part 1607.
2789. gbpln1608.seq - Plant sequence entries (including fungi and algae), part 1608.
2790. gbpln1609.seq - Plant sequence entries (including fungi and algae), part 1609.
2791. gbpln161.seq - Plant sequence entries (including fungi and algae), part 161.
2792. gbpln1610.seq - Plant sequence entries (including fungi and algae), part 1610.
2793. gbpln1611.seq - Plant sequence entries (including fungi and algae), part 1611.
2794. gbpln1612.seq - Plant sequence entries (including fungi and algae), part 1612.
2795. gbpln1613.seq - Plant sequence entries (including fungi and algae), part 1613.
2796. gbpln1614.seq - Plant sequence entries (including fungi and algae), part 1614.
2797. gbpln1615.seq - Plant sequence entries (including fungi and algae), part 1615.
2798. gbpln1616.seq - Plant sequence entries (including fungi and algae), part 1616.
2799. gbpln1617.seq - Plant sequence entries (including fungi and algae), part 1617.
2800. gbpln1618.seq - Plant sequence entries (including fungi and algae), part 1618.
2801. gbpln1619.seq - Plant sequence entries (including fungi and algae), part 1619.
2802. gbpln162.seq - Plant sequence entries (including fungi and algae), part 162.
2803. gbpln1620.seq - Plant sequence entries (including fungi and algae), part 1620.
2804. gbpln1621.seq - Plant sequence entries (including fungi and algae), part 1621.
2805. gbpln1622.seq - Plant sequence entries (including fungi and algae), part 1622.
2806. gbpln1623.seq - Plant sequence entries (including fungi and algae), part 1623.
2807. gbpln1624.seq - Plant sequence entries (including fungi and algae), part 1624.
2808. gbpln1625.seq - Plant sequence entries (including fungi and algae), part 1625.
2809. gbpln1626.seq - Plant sequence entries (including fungi and algae), part 1626.
2810. gbpln1627.seq - Plant sequence entries (including fungi and algae), part 1627.
2811. gbpln1628.seq - Plant sequence entries (including fungi and algae), part 1628.
2812. gbpln1629.seq - Plant sequence entries (including fungi and algae), part 1629.
2813. gbpln163.seq - Plant sequence entries (including fungi and algae), part 163.
2814. gbpln1630.seq - Plant sequence entries (including fungi and algae), part 1630.
2815. gbpln1631.seq - Plant sequence entries (including fungi and algae), part 1631.
2816. gbpln1632.seq - Plant sequence entries (including fungi and algae), part 1632.
2817. gbpln1633.seq - Plant sequence entries (including fungi and algae), part 1633.
2818. gbpln1634.seq - Plant sequence entries (including fungi and algae), part 1634.
2819. gbpln1635.seq - Plant sequence entries (including fungi and algae), part 1635.
2820. gbpln1636.seq - Plant sequence entries (including fungi and algae), part 1636.
2821. gbpln1637.seq - Plant sequence entries (including fungi and algae), part 1637.
2822. gbpln1638.seq - Plant sequence entries (including fungi and algae), part 1638.
2823. gbpln1639.seq - Plant sequence entries (including fungi and algae), part 1639.
2824. gbpln164.seq - Plant sequence entries (including fungi and algae), part 164.
2825. gbpln1640.seq - Plant sequence entries (including fungi and algae), part 1640.
2826. gbpln1641.seq - Plant sequence entries (including fungi and algae), part 1641.
2827. gbpln1642.seq - Plant sequence entries (including fungi and algae), part 1642.
2828. gbpln1643.seq - Plant sequence entries (including fungi and algae), part 1643.
2829. gbpln1644.seq - Plant sequence entries (including fungi and algae), part 1644.
2830. gbpln1645.seq - Plant sequence entries (including fungi and algae), part 1645.
2831. gbpln1646.seq - Plant sequence entries (including fungi and algae), part 1646.
2832. gbpln1647.seq - Plant sequence entries (including fungi and algae), part 1647.
2833. gbpln1648.seq - Plant sequence entries (including fungi and algae), part 1648.
2834. gbpln1649.seq - Plant sequence entries (including fungi and algae), part 1649.
2835. gbpln165.seq - Plant sequence entries (including fungi and algae), part 165.
2836. gbpln1650.seq - Plant sequence entries (including fungi and algae), part 1650.
2837. gbpln1651.seq - Plant sequence entries (including fungi and algae), part 1651.
2838. gbpln1652.seq - Plant sequence entries (including fungi and algae), part 1652.
2839. gbpln1653.seq - Plant sequence entries (including fungi and algae), part 1653.
2840. gbpln1654.seq - Plant sequence entries (including fungi and algae), part 1654.
2841. gbpln1655.seq - Plant sequence entries (including fungi and algae), part 1655.
2842. gbpln1656.seq - Plant sequence entries (including fungi and algae), part 1656.
2843. gbpln1657.seq - Plant sequence entries (including fungi and algae), part 1657.
2844. gbpln1658.seq - Plant sequence entries (including fungi and algae), part 1658.
2845. gbpln1659.seq - Plant sequence entries (including fungi and algae), part 1659.
2846. gbpln166.seq - Plant sequence entries (including fungi and algae), part 166.
2847. gbpln1660.seq - Plant sequence entries (including fungi and algae), part 1660.
2848. gbpln1661.seq - Plant sequence entries (including fungi and algae), part 1661.
2849. gbpln1662.seq - Plant sequence entries (including fungi and algae), part 1662.
2850. gbpln1663.seq - Plant sequence entries (including fungi and algae), part 1663.
2851. gbpln1664.seq - Plant sequence entries (including fungi and algae), part 1664.
2852. gbpln1665.seq - Plant sequence entries (including fungi and algae), part 1665.
2853. gbpln1666.seq - Plant sequence entries (including fungi and algae), part 1666.
2854. gbpln1667.seq - Plant sequence entries (including fungi and algae), part 1667.
2855. gbpln1668.seq - Plant sequence entries (including fungi and algae), part 1668.
2856. gbpln1669.seq - Plant sequence entries (including fungi and algae), part 1669.
2857. gbpln167.seq - Plant sequence entries (including fungi and algae), part 167.
2858. gbpln1670.seq - Plant sequence entries (including fungi and algae), part 1670.
2859. gbpln1671.seq - Plant sequence entries (including fungi and algae), part 1671.
2860. gbpln1672.seq - Plant sequence entries (including fungi and algae), part 1672.
2861. gbpln1673.seq - Plant sequence entries (including fungi and algae), part 1673.
2862. gbpln1674.seq - Plant sequence entries (including fungi and algae), part 1674.
2863. gbpln1675.seq - Plant sequence entries (including fungi and algae), part 1675.
2864. gbpln1676.seq - Plant sequence entries (including fungi and algae), part 1676.
2865. gbpln1677.seq - Plant sequence entries (including fungi and algae), part 1677.
2866. gbpln1678.seq - Plant sequence entries (including fungi and algae), part 1678.
2867. gbpln1679.seq - Plant sequence entries (including fungi and algae), part 1679.
2868. gbpln168.seq - Plant sequence entries (including fungi and algae), part 168.
2869. gbpln1680.seq - Plant sequence entries (including fungi and algae), part 1680.
2870. gbpln1681.seq - Plant sequence entries (including fungi and algae), part 1681.
2871. gbpln1682.seq - Plant sequence entries (including fungi and algae), part 1682.
2872. gbpln1683.seq - Plant sequence entries (including fungi and algae), part 1683.
2873. gbpln1684.seq - Plant sequence entries (including fungi and algae), part 1684.
2874. gbpln1685.seq - Plant sequence entries (including fungi and algae), part 1685.
2875. gbpln1686.seq - Plant sequence entries (including fungi and algae), part 1686.
2876. gbpln1687.seq - Plant sequence entries (including fungi and algae), part 1687.
2877. gbpln1688.seq - Plant sequence entries (including fungi and algae), part 1688.
2878. gbpln1689.seq - Plant sequence entries (including fungi and algae), part 1689.
2879. gbpln169.seq - Plant sequence entries (including fungi and algae), part 169.
2880. gbpln1690.seq - Plant sequence entries (including fungi and algae), part 1690.
2881. gbpln1691.seq - Plant sequence entries (including fungi and algae), part 1691.
2882. gbpln1692.seq - Plant sequence entries (including fungi and algae), part 1692.
2883. gbpln1693.seq - Plant sequence entries (including fungi and algae), part 1693.
2884. gbpln1694.seq - Plant sequence entries (including fungi and algae), part 1694.
2885. gbpln1695.seq - Plant sequence entries (including fungi and algae), part 1695.
2886. gbpln1696.seq - Plant sequence entries (including fungi and algae), part 1696.
2887. gbpln1697.seq - Plant sequence entries (including fungi and algae), part 1697.
2888. gbpln1698.seq - Plant sequence entries (including fungi and algae), part 1698.
2889. gbpln1699.seq - Plant sequence entries (including fungi and algae), part 1699.
2890. gbpln17.seq - Plant sequence entries (including fungi and algae), part 17.
2891. gbpln170.seq - Plant sequence entries (including fungi and algae), part 170.
2892. gbpln1700.seq - Plant sequence entries (including fungi and algae), part 1700.
2893. gbpln1701.seq - Plant sequence entries (including fungi and algae), part 1701.
2894. gbpln1702.seq - Plant sequence entries (including fungi and algae), part 1702.
2895. gbpln1703.seq - Plant sequence entries (including fungi and algae), part 1703.
2896. gbpln1704.seq - Plant sequence entries (including fungi and algae), part 1704.
2897. gbpln1705.seq - Plant sequence entries (including fungi and algae), part 1705.
2898. gbpln1706.seq - Plant sequence entries (including fungi and algae), part 1706.
2899. gbpln1707.seq - Plant sequence entries (including fungi and algae), part 1707.
2900. gbpln1708.seq - Plant sequence entries (including fungi and algae), part 1708.
2901. gbpln1709.seq - Plant sequence entries (including fungi and algae), part 1709.
2902. gbpln171.seq - Plant sequence entries (including fungi and algae), part 171.
2903. gbpln1710.seq - Plant sequence entries (including fungi and algae), part 1710.
2904. gbpln1711.seq - Plant sequence entries (including fungi and algae), part 1711.
2905. gbpln1712.seq - Plant sequence entries (including fungi and algae), part 1712.
2906. gbpln1713.seq - Plant sequence entries (including fungi and algae), part 1713.
2907. gbpln1714.seq - Plant sequence entries (including fungi and algae), part 1714.
2908. gbpln1715.seq - Plant sequence entries (including fungi and algae), part 1715.
2909. gbpln1716.seq - Plant sequence entries (including fungi and algae), part 1716.
2910. gbpln1717.seq - Plant sequence entries (including fungi and algae), part 1717.
2911. gbpln1718.seq - Plant sequence entries (including fungi and algae), part 1718.
2912. gbpln1719.seq - Plant sequence entries (including fungi and algae), part 1719.
2913. gbpln172.seq - Plant sequence entries (including fungi and algae), part 172.
2914. gbpln1720.seq - Plant sequence entries (including fungi and algae), part 1720.
2915. gbpln1721.seq - Plant sequence entries (including fungi and algae), part 1721.
2916. gbpln1722.seq - Plant sequence entries (including fungi and algae), part 1722.
2917. gbpln1723.seq - Plant sequence entries (including fungi and algae), part 1723.
2918. gbpln1724.seq - Plant sequence entries (including fungi and algae), part 1724.
2919. gbpln1725.seq - Plant sequence entries (including fungi and algae), part 1725.
2920. gbpln1726.seq - Plant sequence entries (including fungi and algae), part 1726.
2921. gbpln1727.seq - Plant sequence entries (including fungi and algae), part 1727.
2922. gbpln1728.seq - Plant sequence entries (including fungi and algae), part 1728.
2923. gbpln1729.seq - Plant sequence entries (including fungi and algae), part 1729.
2924. gbpln173.seq - Plant sequence entries (including fungi and algae), part 173.
2925. gbpln1730.seq - Plant sequence entries (including fungi and algae), part 1730.
2926. gbpln1731.seq - Plant sequence entries (including fungi and algae), part 1731.
2927. gbpln1732.seq - Plant sequence entries (including fungi and algae), part 1732.
2928. gbpln1733.seq - Plant sequence entries (including fungi and algae), part 1733.
2929. gbpln1734.seq - Plant sequence entries (including fungi and algae), part 1734.
2930. gbpln1735.seq - Plant sequence entries (including fungi and algae), part 1735.
2931. gbpln1736.seq - Plant sequence entries (including fungi and algae), part 1736.
2932. gbpln1737.seq - Plant sequence entries (including fungi and algae), part 1737.
2933. gbpln1738.seq - Plant sequence entries (including fungi and algae), part 1738.
2934. gbpln1739.seq - Plant sequence entries (including fungi and algae), part 1739.
2935. gbpln174.seq - Plant sequence entries (including fungi and algae), part 174.
2936. gbpln1740.seq - Plant sequence entries (including fungi and algae), part 1740.
2937. gbpln1741.seq - Plant sequence entries (including fungi and algae), part 1741.
2938. gbpln1742.seq - Plant sequence entries (including fungi and algae), part 1742.
2939. gbpln1743.seq - Plant sequence entries (including fungi and algae), part 1743.
2940. gbpln1744.seq - Plant sequence entries (including fungi and algae), part 1744.
2941. gbpln1745.seq - Plant sequence entries (including fungi and algae), part 1745.
2942. gbpln1746.seq - Plant sequence entries (including fungi and algae), part 1746.
2943. gbpln1747.seq - Plant sequence entries (including fungi and algae), part 1747.
2944. gbpln1748.seq - Plant sequence entries (including fungi and algae), part 1748.
2945. gbpln1749.seq - Plant sequence entries (including fungi and algae), part 1749.
2946. gbpln175.seq - Plant sequence entries (including fungi and algae), part 175.
2947. gbpln1750.seq - Plant sequence entries (including fungi and algae), part 1750.
2948. gbpln1751.seq - Plant sequence entries (including fungi and algae), part 1751.
2949. gbpln1752.seq - Plant sequence entries (including fungi and algae), part 1752.
2950. gbpln1753.seq - Plant sequence entries (including fungi and algae), part 1753.
2951. gbpln1754.seq - Plant sequence entries (including fungi and algae), part 1754.
2952. gbpln1755.seq - Plant sequence entries (including fungi and algae), part 1755.
2953. gbpln1756.seq - Plant sequence entries (including fungi and algae), part 1756.
2954. gbpln1757.seq - Plant sequence entries (including fungi and algae), part 1757.
2955. gbpln1758.seq - Plant sequence entries (including fungi and algae), part 1758.
2956. gbpln1759.seq - Plant sequence entries (including fungi and algae), part 1759.
2957. gbpln176.seq - Plant sequence entries (including fungi and algae), part 176.
2958. gbpln1760.seq - Plant sequence entries (including fungi and algae), part 1760.
2959. gbpln1761.seq - Plant sequence entries (including fungi and algae), part 1761.
2960. gbpln1762.seq - Plant sequence entries (including fungi and algae), part 1762.
2961. gbpln1763.seq - Plant sequence entries (including fungi and algae), part 1763.
2962. gbpln1764.seq - Plant sequence entries (including fungi and algae), part 1764.
2963. gbpln1765.seq - Plant sequence entries (including fungi and algae), part 1765.
2964. gbpln1766.seq - Plant sequence entries (including fungi and algae), part 1766.
2965. gbpln1767.seq - Plant sequence entries (including fungi and algae), part 1767.
2966. gbpln1768.seq - Plant sequence entries (including fungi and algae), part 1768.
2967. gbpln1769.seq - Plant sequence entries (including fungi and algae), part 1769.
2968. gbpln177.seq - Plant sequence entries (including fungi and algae), part 177.
2969. gbpln1770.seq - Plant sequence entries (including fungi and algae), part 1770.
2970. gbpln1771.seq - Plant sequence entries (including fungi and algae), part 1771.
2971. gbpln1772.seq - Plant sequence entries (including fungi and algae), part 1772.
2972. gbpln1773.seq - Plant sequence entries (including fungi and algae), part 1773.
2973. gbpln1774.seq - Plant sequence entries (including fungi and algae), part 1774.
2974. gbpln1775.seq - Plant sequence entries (including fungi and algae), part 1775.
2975. gbpln1776.seq - Plant sequence entries (including fungi and algae), part 1776.
2976. gbpln1777.seq - Plant sequence entries (including fungi and algae), part 1777.
2977. gbpln1778.seq - Plant sequence entries (including fungi and algae), part 1778.
2978. gbpln1779.seq - Plant sequence entries (including fungi and algae), part 1779.
2979. gbpln178.seq - Plant sequence entries (including fungi and algae), part 178.
2980. gbpln1780.seq - Plant sequence entries (including fungi and algae), part 1780.
2981. gbpln1781.seq - Plant sequence entries (including fungi and algae), part 1781.
2982. gbpln1782.seq - Plant sequence entries (including fungi and algae), part 1782.
2983. gbpln1783.seq - Plant sequence entries (including fungi and algae), part 1783.
2984. gbpln1784.seq - Plant sequence entries (including fungi and algae), part 1784.
2985. gbpln1785.seq - Plant sequence entries (including fungi and algae), part 1785.
2986. gbpln1786.seq - Plant sequence entries (including fungi and algae), part 1786.
2987. gbpln1787.seq - Plant sequence entries (including fungi and algae), part 1787.
2988. gbpln1788.seq - Plant sequence entries (including fungi and algae), part 1788.
2989. gbpln1789.seq - Plant sequence entries (including fungi and algae), part 1789.
2990. gbpln179.seq - Plant sequence entries (including fungi and algae), part 179.
2991. gbpln1790.seq - Plant sequence entries (including fungi and algae), part 1790.
2992. gbpln1791.seq - Plant sequence entries (including fungi and algae), part 1791.
2993. gbpln1792.seq - Plant sequence entries (including fungi and algae), part 1792.
2994. gbpln1793.seq - Plant sequence entries (including fungi and algae), part 1793.
2995. gbpln1794.seq - Plant sequence entries (including fungi and algae), part 1794.
2996. gbpln1795.seq - Plant sequence entries (including fungi and algae), part 1795.
2997. gbpln1796.seq - Plant sequence entries (including fungi and algae), part 1796.
2998. gbpln1797.seq - Plant sequence entries (including fungi and algae), part 1797.
2999. gbpln1798.seq - Plant sequence entries (including fungi and algae), part 1798.
3000. gbpln1799.seq - Plant sequence entries (including fungi and algae), part 1799.
3001. gbpln18.seq - Plant sequence entries (including fungi and algae), part 18.
3002. gbpln180.seq - Plant sequence entries (including fungi and algae), part 180.
3003. gbpln1800.seq - Plant sequence entries (including fungi and algae), part 1800.
3004. gbpln1801.seq - Plant sequence entries (including fungi and algae), part 1801.
3005. gbpln1802.seq - Plant sequence entries (including fungi and algae), part 1802.
3006. gbpln1803.seq - Plant sequence entries (including fungi and algae), part 1803.
3007. gbpln1804.seq - Plant sequence entries (including fungi and algae), part 1804.
3008. gbpln1805.seq - Plant sequence entries (including fungi and algae), part 1805.
3009. gbpln1806.seq - Plant sequence entries (including fungi and algae), part 1806.
3010. gbpln1807.seq - Plant sequence entries (including fungi and algae), part 1807.
3011. gbpln1808.seq - Plant sequence entries (including fungi and algae), part 1808.
3012. gbpln1809.seq - Plant sequence entries (including fungi and algae), part 1809.
3013. gbpln181.seq - Plant sequence entries (including fungi and algae), part 181.
3014. gbpln1810.seq - Plant sequence entries (including fungi and algae), part 1810.
3015. gbpln1811.seq - Plant sequence entries (including fungi and algae), part 1811.
3016. gbpln1812.seq - Plant sequence entries (including fungi and algae), part 1812.
3017. gbpln1813.seq - Plant sequence entries (including fungi and algae), part 1813.
3018. gbpln1814.seq - Plant sequence entries (including fungi and algae), part 1814.
3019. gbpln1815.seq - Plant sequence entries (including fungi and algae), part 1815.
3020. gbpln1816.seq - Plant sequence entries (including fungi and algae), part 1816.
3021. gbpln1817.seq - Plant sequence entries (including fungi and algae), part 1817.
3022. gbpln1818.seq - Plant sequence entries (including fungi and algae), part 1818.
3023. gbpln1819.seq - Plant sequence entries (including fungi and algae), part 1819.
3024. gbpln182.seq - Plant sequence entries (including fungi and algae), part 182.
3025. gbpln1820.seq - Plant sequence entries (including fungi and algae), part 1820.
3026. gbpln1821.seq - Plant sequence entries (including fungi and algae), part 1821.
3027. gbpln1822.seq - Plant sequence entries (including fungi and algae), part 1822.
3028. gbpln1823.seq - Plant sequence entries (including fungi and algae), part 1823.
3029. gbpln1824.seq - Plant sequence entries (including fungi and algae), part 1824.
3030. gbpln1825.seq - Plant sequence entries (including fungi and algae), part 1825.
3031. gbpln1826.seq - Plant sequence entries (including fungi and algae), part 1826.
3032. gbpln1827.seq - Plant sequence entries (including fungi and algae), part 1827.
3033. gbpln1828.seq - Plant sequence entries (including fungi and algae), part 1828.
3034. gbpln1829.seq - Plant sequence entries (including fungi and algae), part 1829.
3035. gbpln183.seq - Plant sequence entries (including fungi and algae), part 183.
3036. gbpln1830.seq - Plant sequence entries (including fungi and algae), part 1830.
3037. gbpln1831.seq - Plant sequence entries (including fungi and algae), part 1831.
3038. gbpln1832.seq - Plant sequence entries (including fungi and algae), part 1832.
3039. gbpln1833.seq - Plant sequence entries (including fungi and algae), part 1833.
3040. gbpln1834.seq - Plant sequence entries (including fungi and algae), part 1834.
3041. gbpln1835.seq - Plant sequence entries (including fungi and algae), part 1835.
3042. gbpln1836.seq - Plant sequence entries (including fungi and algae), part 1836.
3043. gbpln1837.seq - Plant sequence entries (including fungi and algae), part 1837.
3044. gbpln1838.seq - Plant sequence entries (including fungi and algae), part 1838.
3045. gbpln1839.seq - Plant sequence entries (including fungi and algae), part 1839.
3046. gbpln184.seq - Plant sequence entries (including fungi and algae), part 184.
3047. gbpln1840.seq - Plant sequence entries (including fungi and algae), part 1840.
3048. gbpln1841.seq - Plant sequence entries (including fungi and algae), part 1841.
3049. gbpln1842.seq - Plant sequence entries (including fungi and algae), part 1842.
3050. gbpln1843.seq - Plant sequence entries (including fungi and algae), part 1843.
3051. gbpln1844.seq - Plant sequence entries (including fungi and algae), part 1844.
3052. gbpln1845.seq - Plant sequence entries (including fungi and algae), part 1845.
3053. gbpln1846.seq - Plant sequence entries (including fungi and algae), part 1846.
3054. gbpln1847.seq - Plant sequence entries (including fungi and algae), part 1847.
3055. gbpln1848.seq - Plant sequence entries (including fungi and algae), part 1848.
3056. gbpln1849.seq - Plant sequence entries (including fungi and algae), part 1849.
3057. gbpln185.seq - Plant sequence entries (including fungi and algae), part 185.
3058. gbpln1850.seq - Plant sequence entries (including fungi and algae), part 1850.
3059. gbpln1851.seq - Plant sequence entries (including fungi and algae), part 1851.
3060. gbpln1852.seq - Plant sequence entries (including fungi and algae), part 1852.
3061. gbpln1853.seq - Plant sequence entries (including fungi and algae), part 1853.
3062. gbpln1854.seq - Plant sequence entries (including fungi and algae), part 1854.
3063. gbpln1855.seq - Plant sequence entries (including fungi and algae), part 1855.
3064. gbpln1856.seq - Plant sequence entries (including fungi and algae), part 1856.
3065. gbpln1857.seq - Plant sequence entries (including fungi and algae), part 1857.
3066. gbpln1858.seq - Plant sequence entries (including fungi and algae), part 1858.
3067. gbpln1859.seq - Plant sequence entries (including fungi and algae), part 1859.
3068. gbpln186.seq - Plant sequence entries (including fungi and algae), part 186.
3069. gbpln1860.seq - Plant sequence entries (including fungi and algae), part 1860.
3070. gbpln1861.seq - Plant sequence entries (including fungi and algae), part 1861.
3071. gbpln1862.seq - Plant sequence entries (including fungi and algae), part 1862.
3072. gbpln1863.seq - Plant sequence entries (including fungi and algae), part 1863.
3073. gbpln1864.seq - Plant sequence entries (including fungi and algae), part 1864.
3074. gbpln1865.seq - Plant sequence entries (including fungi and algae), part 1865.
3075. gbpln1866.seq - Plant sequence entries (including fungi and algae), part 1866.
3076. gbpln1867.seq - Plant sequence entries (including fungi and algae), part 1867.
3077. gbpln1868.seq - Plant sequence entries (including fungi and algae), part 1868.
3078. gbpln1869.seq - Plant sequence entries (including fungi and algae), part 1869.
3079. gbpln187.seq - Plant sequence entries (including fungi and algae), part 187.
3080. gbpln1870.seq - Plant sequence entries (including fungi and algae), part 1870.
3081. gbpln1871.seq - Plant sequence entries (including fungi and algae), part 1871.
3082. gbpln1872.seq - Plant sequence entries (including fungi and algae), part 1872.
3083. gbpln1873.seq - Plant sequence entries (including fungi and algae), part 1873.
3084. gbpln1874.seq - Plant sequence entries (including fungi and algae), part 1874.
3085. gbpln1875.seq - Plant sequence entries (including fungi and algae), part 1875.
3086. gbpln188.seq - Plant sequence entries (including fungi and algae), part 188.
3087. gbpln189.seq - Plant sequence entries (including fungi and algae), part 189.
3088. gbpln19.seq - Plant sequence entries (including fungi and algae), part 19.
3089. gbpln190.seq - Plant sequence entries (including fungi and algae), part 190.
3090. gbpln191.seq - Plant sequence entries (including fungi and algae), part 191.
3091. gbpln192.seq - Plant sequence entries (including fungi and algae), part 192.
3092. gbpln193.seq - Plant sequence entries (including fungi and algae), part 193.
3093. gbpln194.seq - Plant sequence entries (including fungi and algae), part 194.
3094. gbpln195.seq - Plant sequence entries (including fungi and algae), part 195.
3095. gbpln196.seq - Plant sequence entries (including fungi and algae), part 196.
3096. gbpln197.seq - Plant sequence entries (including fungi and algae), part 197.
3097. gbpln198.seq - Plant sequence entries (including fungi and algae), part 198.
3098. gbpln199.seq - Plant sequence entries (including fungi and algae), part 199.
3099. gbpln2.seq - Plant sequence entries (including fungi and algae), part 2.
3100. gbpln20.seq - Plant sequence entries (including fungi and algae), part 20.
3101. gbpln200.seq - Plant sequence entries (including fungi and algae), part 200.
3102. gbpln201.seq - Plant sequence entries (including fungi and algae), part 201.
3103. gbpln202.seq - Plant sequence entries (including fungi and algae), part 202.
3104. gbpln203.seq - Plant sequence entries (including fungi and algae), part 203.
3105. gbpln204.seq - Plant sequence entries (including fungi and algae), part 204.
3106. gbpln205.seq - Plant sequence entries (including fungi and algae), part 205.
3107. gbpln206.seq - Plant sequence entries (including fungi and algae), part 206.
3108. gbpln207.seq - Plant sequence entries (including fungi and algae), part 207.
3109. gbpln208.seq - Plant sequence entries (including fungi and algae), part 208.
3110. gbpln209.seq - Plant sequence entries (including fungi and algae), part 209.
3111. gbpln21.seq - Plant sequence entries (including fungi and algae), part 21.
3112. gbpln210.seq - Plant sequence entries (including fungi and algae), part 210.
3113. gbpln211.seq - Plant sequence entries (including fungi and algae), part 211.
3114. gbpln212.seq - Plant sequence entries (including fungi and algae), part 212.
3115. gbpln213.seq - Plant sequence entries (including fungi and algae), part 213.
3116. gbpln214.seq - Plant sequence entries (including fungi and algae), part 214.
3117. gbpln215.seq - Plant sequence entries (including fungi and algae), part 215.
3118. gbpln216.seq - Plant sequence entries (including fungi and algae), part 216.
3119. gbpln217.seq - Plant sequence entries (including fungi and algae), part 217.
3120. gbpln218.seq - Plant sequence entries (including fungi and algae), part 218.
3121. gbpln219.seq - Plant sequence entries (including fungi and algae), part 219.
3122. gbpln22.seq - Plant sequence entries (including fungi and algae), part 22.
3123. gbpln220.seq - Plant sequence entries (including fungi and algae), part 220.
3124. gbpln221.seq - Plant sequence entries (including fungi and algae), part 221.
3125. gbpln222.seq - Plant sequence entries (including fungi and algae), part 222.
3126. gbpln223.seq - Plant sequence entries (including fungi and algae), part 223.
3127. gbpln224.seq - Plant sequence entries (including fungi and algae), part 224.
3128. gbpln225.seq - Plant sequence entries (including fungi and algae), part 225.
3129. gbpln226.seq - Plant sequence entries (including fungi and algae), part 226.
3130. gbpln227.seq - Plant sequence entries (including fungi and algae), part 227.
3131. gbpln228.seq - Plant sequence entries (including fungi and algae), part 228.
3132. gbpln229.seq - Plant sequence entries (including fungi and algae), part 229.
3133. gbpln23.seq - Plant sequence entries (including fungi and algae), part 23.
3134. gbpln230.seq - Plant sequence entries (including fungi and algae), part 230.
3135. gbpln231.seq - Plant sequence entries (including fungi and algae), part 231.
3136. gbpln232.seq - Plant sequence entries (including fungi and algae), part 232.
3137. gbpln233.seq - Plant sequence entries (including fungi and algae), part 233.
3138. gbpln234.seq - Plant sequence entries (including fungi and algae), part 234.
3139. gbpln235.seq - Plant sequence entries (including fungi and algae), part 235.
3140. gbpln236.seq - Plant sequence entries (including fungi and algae), part 236.
3141. gbpln237.seq - Plant sequence entries (including fungi and algae), part 237.
3142. gbpln238.seq - Plant sequence entries (including fungi and algae), part 238.
3143. gbpln239.seq - Plant sequence entries (including fungi and algae), part 239.
3144. gbpln24.seq - Plant sequence entries (including fungi and algae), part 24.
3145. gbpln240.seq - Plant sequence entries (including fungi and algae), part 240.
3146. gbpln241.seq - Plant sequence entries (including fungi and algae), part 241.
3147. gbpln242.seq - Plant sequence entries (including fungi and algae), part 242.
3148. gbpln243.seq - Plant sequence entries (including fungi and algae), part 243.
3149. gbpln244.seq - Plant sequence entries (including fungi and algae), part 244.
3150. gbpln245.seq - Plant sequence entries (including fungi and algae), part 245.
3151. gbpln246.seq - Plant sequence entries (including fungi and algae), part 246.
3152. gbpln247.seq - Plant sequence entries (including fungi and algae), part 247.
3153. gbpln248.seq - Plant sequence entries (including fungi and algae), part 248.
3154. gbpln249.seq - Plant sequence entries (including fungi and algae), part 249.
3155. gbpln25.seq - Plant sequence entries (including fungi and algae), part 25.
3156. gbpln250.seq - Plant sequence entries (including fungi and algae), part 250.
3157. gbpln251.seq - Plant sequence entries (including fungi and algae), part 251.
3158. gbpln252.seq - Plant sequence entries (including fungi and algae), part 252.
3159. gbpln253.seq - Plant sequence entries (including fungi and algae), part 253.
3160. gbpln254.seq - Plant sequence entries (including fungi and algae), part 254.
3161. gbpln255.seq - Plant sequence entries (including fungi and algae), part 255.
3162. gbpln256.seq - Plant sequence entries (including fungi and algae), part 256.
3163. gbpln257.seq - Plant sequence entries (including fungi and algae), part 257.
3164. gbpln258.seq - Plant sequence entries (including fungi and algae), part 258.
3165. gbpln259.seq - Plant sequence entries (including fungi and algae), part 259.
3166. gbpln26.seq - Plant sequence entries (including fungi and algae), part 26.
3167. gbpln260.seq - Plant sequence entries (including fungi and algae), part 260.
3168. gbpln261.seq - Plant sequence entries (including fungi and algae), part 261.
3169. gbpln262.seq - Plant sequence entries (including fungi and algae), part 262.
3170. gbpln263.seq - Plant sequence entries (including fungi and algae), part 263.
3171. gbpln264.seq - Plant sequence entries (including fungi and algae), part 264.
3172. gbpln265.seq - Plant sequence entries (including fungi and algae), part 265.
3173. gbpln266.seq - Plant sequence entries (including fungi and algae), part 266.
3174. gbpln267.seq - Plant sequence entries (including fungi and algae), part 267.
3175. gbpln268.seq - Plant sequence entries (including fungi and algae), part 268.
3176. gbpln269.seq - Plant sequence entries (including fungi and algae), part 269.
3177. gbpln27.seq - Plant sequence entries (including fungi and algae), part 27.
3178. gbpln270.seq - Plant sequence entries (including fungi and algae), part 270.
3179. gbpln271.seq - Plant sequence entries (including fungi and algae), part 271.
3180. gbpln272.seq - Plant sequence entries (including fungi and algae), part 272.
3181. gbpln273.seq - Plant sequence entries (including fungi and algae), part 273.
3182. gbpln274.seq - Plant sequence entries (including fungi and algae), part 274.
3183. gbpln275.seq - Plant sequence entries (including fungi and algae), part 275.
3184. gbpln276.seq - Plant sequence entries (including fungi and algae), part 276.
3185. gbpln277.seq - Plant sequence entries (including fungi and algae), part 277.
3186. gbpln278.seq - Plant sequence entries (including fungi and algae), part 278.
3187. gbpln279.seq - Plant sequence entries (including fungi and algae), part 279.
3188. gbpln28.seq - Plant sequence entries (including fungi and algae), part 28.
3189. gbpln280.seq - Plant sequence entries (including fungi and algae), part 280.
3190. gbpln281.seq - Plant sequence entries (including fungi and algae), part 281.
3191. gbpln282.seq - Plant sequence entries (including fungi and algae), part 282.
3192. gbpln283.seq - Plant sequence entries (including fungi and algae), part 283.
3193. gbpln284.seq - Plant sequence entries (including fungi and algae), part 284.
3194. gbpln285.seq - Plant sequence entries (including fungi and algae), part 285.
3195. gbpln286.seq - Plant sequence entries (including fungi and algae), part 286.
3196. gbpln287.seq - Plant sequence entries (including fungi and algae), part 287.
3197. gbpln288.seq - Plant sequence entries (including fungi and algae), part 288.
3198. gbpln289.seq - Plant sequence entries (including fungi and algae), part 289.
3199. gbpln29.seq - Plant sequence entries (including fungi and algae), part 29.
3200. gbpln290.seq - Plant sequence entries (including fungi and algae), part 290.
3201. gbpln291.seq - Plant sequence entries (including fungi and algae), part 291.
3202. gbpln292.seq - Plant sequence entries (including fungi and algae), part 292.
3203. gbpln293.seq - Plant sequence entries (including fungi and algae), part 293.
3204. gbpln294.seq - Plant sequence entries (including fungi and algae), part 294.
3205. gbpln295.seq - Plant sequence entries (including fungi and algae), part 295.
3206. gbpln296.seq - Plant sequence entries (including fungi and algae), part 296.
3207. gbpln297.seq - Plant sequence entries (including fungi and algae), part 297.
3208. gbpln298.seq - Plant sequence entries (including fungi and algae), part 298.
3209. gbpln299.seq - Plant sequence entries (including fungi and algae), part 299.
3210. gbpln3.seq - Plant sequence entries (including fungi and algae), part 3.
3211. gbpln30.seq - Plant sequence entries (including fungi and algae), part 30.
3212. gbpln300.seq - Plant sequence entries (including fungi and algae), part 300.
3213. gbpln301.seq - Plant sequence entries (including fungi and algae), part 301.
3214. gbpln302.seq - Plant sequence entries (including fungi and algae), part 302.
3215. gbpln303.seq - Plant sequence entries (including fungi and algae), part 303.
3216. gbpln304.seq - Plant sequence entries (including fungi and algae), part 304.
3217. gbpln305.seq - Plant sequence entries (including fungi and algae), part 305.
3218. gbpln306.seq - Plant sequence entries (including fungi and algae), part 306.
3219. gbpln307.seq - Plant sequence entries (including fungi and algae), part 307.
3220. gbpln308.seq - Plant sequence entries (including fungi and algae), part 308.
3221. gbpln309.seq - Plant sequence entries (including fungi and algae), part 309.
3222. gbpln31.seq - Plant sequence entries (including fungi and algae), part 31.
3223. gbpln310.seq - Plant sequence entries (including fungi and algae), part 310.
3224. gbpln311.seq - Plant sequence entries (including fungi and algae), part 311.
3225. gbpln312.seq - Plant sequence entries (including fungi and algae), part 312.
3226. gbpln313.seq - Plant sequence entries (including fungi and algae), part 313.
3227. gbpln314.seq - Plant sequence entries (including fungi and algae), part 314.
3228. gbpln315.seq - Plant sequence entries (including fungi and algae), part 315.
3229. gbpln316.seq - Plant sequence entries (including fungi and algae), part 316.
3230. gbpln317.seq - Plant sequence entries (including fungi and algae), part 317.
3231. gbpln318.seq - Plant sequence entries (including fungi and algae), part 318.
3232. gbpln319.seq - Plant sequence entries (including fungi and algae), part 319.
3233. gbpln32.seq - Plant sequence entries (including fungi and algae), part 32.
3234. gbpln320.seq - Plant sequence entries (including fungi and algae), part 320.
3235. gbpln321.seq - Plant sequence entries (including fungi and algae), part 321.
3236. gbpln322.seq - Plant sequence entries (including fungi and algae), part 322.
3237. gbpln323.seq - Plant sequence entries (including fungi and algae), part 323.
3238. gbpln324.seq - Plant sequence entries (including fungi and algae), part 324.
3239. gbpln325.seq - Plant sequence entries (including fungi and algae), part 325.
3240. gbpln326.seq - Plant sequence entries (including fungi and algae), part 326.
3241. gbpln327.seq - Plant sequence entries (including fungi and algae), part 327.
3242. gbpln328.seq - Plant sequence entries (including fungi and algae), part 328.
3243. gbpln329.seq - Plant sequence entries (including fungi and algae), part 329.
3244. gbpln33.seq - Plant sequence entries (including fungi and algae), part 33.
3245. gbpln330.seq - Plant sequence entries (including fungi and algae), part 330.
3246. gbpln331.seq - Plant sequence entries (including fungi and algae), part 331.
3247. gbpln332.seq - Plant sequence entries (including fungi and algae), part 332.
3248. gbpln333.seq - Plant sequence entries (including fungi and algae), part 333.
3249. gbpln334.seq - Plant sequence entries (including fungi and algae), part 334.
3250. gbpln335.seq - Plant sequence entries (including fungi and algae), part 335.
3251. gbpln336.seq - Plant sequence entries (including fungi and algae), part 336.
3252. gbpln337.seq - Plant sequence entries (including fungi and algae), part 337.
3253. gbpln338.seq - Plant sequence entries (including fungi and algae), part 338.
3254. gbpln339.seq - Plant sequence entries (including fungi and algae), part 339.
3255. gbpln34.seq - Plant sequence entries (including fungi and algae), part 34.
3256. gbpln340.seq - Plant sequence entries (including fungi and algae), part 340.
3257. gbpln341.seq - Plant sequence entries (including fungi and algae), part 341.
3258. gbpln342.seq - Plant sequence entries (including fungi and algae), part 342.
3259. gbpln343.seq - Plant sequence entries (including fungi and algae), part 343.
3260. gbpln344.seq - Plant sequence entries (including fungi and algae), part 344.
3261. gbpln345.seq - Plant sequence entries (including fungi and algae), part 345.
3262. gbpln346.seq - Plant sequence entries (including fungi and algae), part 346.
3263. gbpln347.seq - Plant sequence entries (including fungi and algae), part 347.
3264. gbpln348.seq - Plant sequence entries (including fungi and algae), part 348.
3265. gbpln349.seq - Plant sequence entries (including fungi and algae), part 349.
3266. gbpln35.seq - Plant sequence entries (including fungi and algae), part 35.
3267. gbpln350.seq - Plant sequence entries (including fungi and algae), part 350.
3268. gbpln351.seq - Plant sequence entries (including fungi and algae), part 351.
3269. gbpln352.seq - Plant sequence entries (including fungi and algae), part 352.
3270. gbpln353.seq - Plant sequence entries (including fungi and algae), part 353.
3271. gbpln354.seq - Plant sequence entries (including fungi and algae), part 354.
3272. gbpln355.seq - Plant sequence entries (including fungi and algae), part 355.
3273. gbpln356.seq - Plant sequence entries (including fungi and algae), part 356.
3274. gbpln357.seq - Plant sequence entries (including fungi and algae), part 357.
3275. gbpln358.seq - Plant sequence entries (including fungi and algae), part 358.
3276. gbpln359.seq - Plant sequence entries (including fungi and algae), part 359.
3277. gbpln36.seq - Plant sequence entries (including fungi and algae), part 36.
3278. gbpln360.seq - Plant sequence entries (including fungi and algae), part 360.
3279. gbpln361.seq - Plant sequence entries (including fungi and algae), part 361.
3280. gbpln362.seq - Plant sequence entries (including fungi and algae), part 362.
3281. gbpln363.seq - Plant sequence entries (including fungi and algae), part 363.
3282. gbpln364.seq - Plant sequence entries (including fungi and algae), part 364.
3283. gbpln365.seq - Plant sequence entries (including fungi and algae), part 365.
3284. gbpln366.seq - Plant sequence entries (including fungi and algae), part 366.
3285. gbpln367.seq - Plant sequence entries (including fungi and algae), part 367.
3286. gbpln368.seq - Plant sequence entries (including fungi and algae), part 368.
3287. gbpln369.seq - Plant sequence entries (including fungi and algae), part 369.
3288. gbpln37.seq - Plant sequence entries (including fungi and algae), part 37.
3289. gbpln370.seq - Plant sequence entries (including fungi and algae), part 370.
3290. gbpln371.seq - Plant sequence entries (including fungi and algae), part 371.
3291. gbpln372.seq - Plant sequence entries (including fungi and algae), part 372.
3292. gbpln373.seq - Plant sequence entries (including fungi and algae), part 373.
3293. gbpln374.seq - Plant sequence entries (including fungi and algae), part 374.
3294. gbpln375.seq - Plant sequence entries (including fungi and algae), part 375.
3295. gbpln376.seq - Plant sequence entries (including fungi and algae), part 376.
3296. gbpln377.seq - Plant sequence entries (including fungi and algae), part 377.
3297. gbpln378.seq - Plant sequence entries (including fungi and algae), part 378.
3298. gbpln379.seq - Plant sequence entries (including fungi and algae), part 379.
3299. gbpln38.seq - Plant sequence entries (including fungi and algae), part 38.
3300. gbpln380.seq - Plant sequence entries (including fungi and algae), part 380.
3301. gbpln381.seq - Plant sequence entries (including fungi and algae), part 381.
3302. gbpln382.seq - Plant sequence entries (including fungi and algae), part 382.
3303. gbpln383.seq - Plant sequence entries (including fungi and algae), part 383.
3304. gbpln384.seq - Plant sequence entries (including fungi and algae), part 384.
3305. gbpln385.seq - Plant sequence entries (including fungi and algae), part 385.
3306. gbpln386.seq - Plant sequence entries (including fungi and algae), part 386.
3307. gbpln387.seq - Plant sequence entries (including fungi and algae), part 387.
3308. gbpln388.seq - Plant sequence entries (including fungi and algae), part 388.
3309. gbpln389.seq - Plant sequence entries (including fungi and algae), part 389.
3310. gbpln39.seq - Plant sequence entries (including fungi and algae), part 39.
3311. gbpln390.seq - Plant sequence entries (including fungi and algae), part 390.
3312. gbpln391.seq - Plant sequence entries (including fungi and algae), part 391.
3313. gbpln392.seq - Plant sequence entries (including fungi and algae), part 392.
3314. gbpln393.seq - Plant sequence entries (including fungi and algae), part 393.
3315. gbpln394.seq - Plant sequence entries (including fungi and algae), part 394.
3316. gbpln395.seq - Plant sequence entries (including fungi and algae), part 395.
3317. gbpln396.seq - Plant sequence entries (including fungi and algae), part 396.
3318. gbpln397.seq - Plant sequence entries (including fungi and algae), part 397.
3319. gbpln398.seq - Plant sequence entries (including fungi and algae), part 398.
3320. gbpln399.seq - Plant sequence entries (including fungi and algae), part 399.
3321. gbpln4.seq - Plant sequence entries (including fungi and algae), part 4.
3322. gbpln40.seq - Plant sequence entries (including fungi and algae), part 40.
3323. gbpln400.seq - Plant sequence entries (including fungi and algae), part 400.
3324. gbpln401.seq - Plant sequence entries (including fungi and algae), part 401.
3325. gbpln402.seq - Plant sequence entries (including fungi and algae), part 402.
3326. gbpln403.seq - Plant sequence entries (including fungi and algae), part 403.
3327. gbpln404.seq - Plant sequence entries (including fungi and algae), part 404.
3328. gbpln405.seq - Plant sequence entries (including fungi and algae), part 405.
3329. gbpln406.seq - Plant sequence entries (including fungi and algae), part 406.
3330. gbpln407.seq - Plant sequence entries (including fungi and algae), part 407.
3331. gbpln408.seq - Plant sequence entries (including fungi and algae), part 408.
3332. gbpln409.seq - Plant sequence entries (including fungi and algae), part 409.
3333. gbpln41.seq - Plant sequence entries (including fungi and algae), part 41.
3334. gbpln410.seq - Plant sequence entries (including fungi and algae), part 410.
3335. gbpln411.seq - Plant sequence entries (including fungi and algae), part 411.
3336. gbpln412.seq - Plant sequence entries (including fungi and algae), part 412.
3337. gbpln413.seq - Plant sequence entries (including fungi and algae), part 413.
3338. gbpln414.seq - Plant sequence entries (including fungi and algae), part 414.
3339. gbpln415.seq - Plant sequence entries (including fungi and algae), part 415.
3340. gbpln416.seq - Plant sequence entries (including fungi and algae), part 416.
3341. gbpln417.seq - Plant sequence entries (including fungi and algae), part 417.
3342. gbpln418.seq - Plant sequence entries (including fungi and algae), part 418.
3343. gbpln419.seq - Plant sequence entries (including fungi and algae), part 419.
3344. gbpln42.seq - Plant sequence entries (including fungi and algae), part 42.
3345. gbpln420.seq - Plant sequence entries (including fungi and algae), part 420.
3346. gbpln421.seq - Plant sequence entries (including fungi and algae), part 421.
3347. gbpln422.seq - Plant sequence entries (including fungi and algae), part 422.
3348. gbpln423.seq - Plant sequence entries (including fungi and algae), part 423.
3349. gbpln424.seq - Plant sequence entries (including fungi and algae), part 424.
3350. gbpln425.seq - Plant sequence entries (including fungi and algae), part 425.
3351. gbpln426.seq - Plant sequence entries (including fungi and algae), part 426.
3352. gbpln427.seq - Plant sequence entries (including fungi and algae), part 427.
3353. gbpln428.seq - Plant sequence entries (including fungi and algae), part 428.
3354. gbpln429.seq - Plant sequence entries (including fungi and algae), part 429.
3355. gbpln43.seq - Plant sequence entries (including fungi and algae), part 43.
3356. gbpln430.seq - Plant sequence entries (including fungi and algae), part 430.
3357. gbpln431.seq - Plant sequence entries (including fungi and algae), part 431.
3358. gbpln432.seq - Plant sequence entries (including fungi and algae), part 432.
3359. gbpln433.seq - Plant sequence entries (including fungi and algae), part 433.
3360. gbpln434.seq - Plant sequence entries (including fungi and algae), part 434.
3361. gbpln435.seq - Plant sequence entries (including fungi and algae), part 435.
3362. gbpln436.seq - Plant sequence entries (including fungi and algae), part 436.
3363. gbpln437.seq - Plant sequence entries (including fungi and algae), part 437.
3364. gbpln438.seq - Plant sequence entries (including fungi and algae), part 438.
3365. gbpln439.seq - Plant sequence entries (including fungi and algae), part 439.
3366. gbpln44.seq - Plant sequence entries (including fungi and algae), part 44.
3367. gbpln440.seq - Plant sequence entries (including fungi and algae), part 440.
3368. gbpln441.seq - Plant sequence entries (including fungi and algae), part 441.
3369. gbpln442.seq - Plant sequence entries (including fungi and algae), part 442.
3370. gbpln443.seq - Plant sequence entries (including fungi and algae), part 443.
3371. gbpln444.seq - Plant sequence entries (including fungi and algae), part 444.
3372. gbpln445.seq - Plant sequence entries (including fungi and algae), part 445.
3373. gbpln446.seq - Plant sequence entries (including fungi and algae), part 446.
3374. gbpln447.seq - Plant sequence entries (including fungi and algae), part 447.
3375. gbpln448.seq - Plant sequence entries (including fungi and algae), part 448.
3376. gbpln449.seq - Plant sequence entries (including fungi and algae), part 449.
3377. gbpln45.seq - Plant sequence entries (including fungi and algae), part 45.
3378. gbpln450.seq - Plant sequence entries (including fungi and algae), part 450.
3379. gbpln451.seq - Plant sequence entries (including fungi and algae), part 451.
3380. gbpln452.seq - Plant sequence entries (including fungi and algae), part 452.
3381. gbpln453.seq - Plant sequence entries (including fungi and algae), part 453.
3382. gbpln454.seq - Plant sequence entries (including fungi and algae), part 454.
3383. gbpln455.seq - Plant sequence entries (including fungi and algae), part 455.
3384. gbpln456.seq - Plant sequence entries (including fungi and algae), part 456.
3385. gbpln457.seq - Plant sequence entries (including fungi and algae), part 457.
3386. gbpln458.seq - Plant sequence entries (including fungi and algae), part 458.
3387. gbpln459.seq - Plant sequence entries (including fungi and algae), part 459.
3388. gbpln46.seq - Plant sequence entries (including fungi and algae), part 46.
3389. gbpln460.seq - Plant sequence entries (including fungi and algae), part 460.
3390. gbpln461.seq - Plant sequence entries (including fungi and algae), part 461.
3391. gbpln462.seq - Plant sequence entries (including fungi and algae), part 462.
3392. gbpln463.seq - Plant sequence entries (including fungi and algae), part 463.
3393. gbpln464.seq - Plant sequence entries (including fungi and algae), part 464.
3394. gbpln465.seq - Plant sequence entries (including fungi and algae), part 465.
3395. gbpln466.seq - Plant sequence entries (including fungi and algae), part 466.
3396. gbpln467.seq - Plant sequence entries (including fungi and algae), part 467.
3397. gbpln468.seq - Plant sequence entries (including fungi and algae), part 468.
3398. gbpln469.seq - Plant sequence entries (including fungi and algae), part 469.
3399. gbpln47.seq - Plant sequence entries (including fungi and algae), part 47.
3400. gbpln470.seq - Plant sequence entries (including fungi and algae), part 470.
3401. gbpln471.seq - Plant sequence entries (including fungi and algae), part 471.
3402. gbpln472.seq - Plant sequence entries (including fungi and algae), part 472.
3403. gbpln473.seq - Plant sequence entries (including fungi and algae), part 473.
3404. gbpln474.seq - Plant sequence entries (including fungi and algae), part 474.
3405. gbpln475.seq - Plant sequence entries (including fungi and algae), part 475.
3406. gbpln476.seq - Plant sequence entries (including fungi and algae), part 476.
3407. gbpln477.seq - Plant sequence entries (including fungi and algae), part 477.
3408. gbpln478.seq - Plant sequence entries (including fungi and algae), part 478.
3409. gbpln479.seq - Plant sequence entries (including fungi and algae), part 479.
3410. gbpln48.seq - Plant sequence entries (including fungi and algae), part 48.
3411. gbpln480.seq - Plant sequence entries (including fungi and algae), part 480.
3412. gbpln481.seq - Plant sequence entries (including fungi and algae), part 481.
3413. gbpln482.seq - Plant sequence entries (including fungi and algae), part 482.
3414. gbpln483.seq - Plant sequence entries (including fungi and algae), part 483.
3415. gbpln484.seq - Plant sequence entries (including fungi and algae), part 484.
3416. gbpln485.seq - Plant sequence entries (including fungi and algae), part 485.
3417. gbpln486.seq - Plant sequence entries (including fungi and algae), part 486.
3418. gbpln487.seq - Plant sequence entries (including fungi and algae), part 487.
3419. gbpln488.seq - Plant sequence entries (including fungi and algae), part 488.
3420. gbpln489.seq - Plant sequence entries (including fungi and algae), part 489.
3421. gbpln49.seq - Plant sequence entries (including fungi and algae), part 49.
3422. gbpln490.seq - Plant sequence entries (including fungi and algae), part 490.
3423. gbpln491.seq - Plant sequence entries (including fungi and algae), part 491.
3424. gbpln492.seq - Plant sequence entries (including fungi and algae), part 492.
3425. gbpln493.seq - Plant sequence entries (including fungi and algae), part 493.
3426. gbpln494.seq - Plant sequence entries (including fungi and algae), part 494.
3427. gbpln495.seq - Plant sequence entries (including fungi and algae), part 495.
3428. gbpln496.seq - Plant sequence entries (including fungi and algae), part 496.
3429. gbpln497.seq - Plant sequence entries (including fungi and algae), part 497.
3430. gbpln498.seq - Plant sequence entries (including fungi and algae), part 498.
3431. gbpln499.seq - Plant sequence entries (including fungi and algae), part 499.
3432. gbpln5.seq - Plant sequence entries (including fungi and algae), part 5.
3433. gbpln50.seq - Plant sequence entries (including fungi and algae), part 50.
3434. gbpln500.seq - Plant sequence entries (including fungi and algae), part 500.
3435. gbpln501.seq - Plant sequence entries (including fungi and algae), part 501.
3436. gbpln502.seq - Plant sequence entries (including fungi and algae), part 502.
3437. gbpln503.seq - Plant sequence entries (including fungi and algae), part 503.
3438. gbpln504.seq - Plant sequence entries (including fungi and algae), part 504.
3439. gbpln505.seq - Plant sequence entries (including fungi and algae), part 505.
3440. gbpln506.seq - Plant sequence entries (including fungi and algae), part 506.
3441. gbpln507.seq - Plant sequence entries (including fungi and algae), part 507.
3442. gbpln508.seq - Plant sequence entries (including fungi and algae), part 508.
3443. gbpln509.seq - Plant sequence entries (including fungi and algae), part 509.
3444. gbpln51.seq - Plant sequence entries (including fungi and algae), part 51.
3445. gbpln510.seq - Plant sequence entries (including fungi and algae), part 510.
3446. gbpln511.seq - Plant sequence entries (including fungi and algae), part 511.
3447. gbpln512.seq - Plant sequence entries (including fungi and algae), part 512.
3448. gbpln513.seq - Plant sequence entries (including fungi and algae), part 513.
3449. gbpln514.seq - Plant sequence entries (including fungi and algae), part 514.
3450. gbpln515.seq - Plant sequence entries (including fungi and algae), part 515.
3451. gbpln516.seq - Plant sequence entries (including fungi and algae), part 516.
3452. gbpln517.seq - Plant sequence entries (including fungi and algae), part 517.
3453. gbpln518.seq - Plant sequence entries (including fungi and algae), part 518.
3454. gbpln519.seq - Plant sequence entries (including fungi and algae), part 519.
3455. gbpln52.seq - Plant sequence entries (including fungi and algae), part 52.
3456. gbpln520.seq - Plant sequence entries (including fungi and algae), part 520.
3457. gbpln521.seq - Plant sequence entries (including fungi and algae), part 521.
3458. gbpln522.seq - Plant sequence entries (including fungi and algae), part 522.
3459. gbpln523.seq - Plant sequence entries (including fungi and algae), part 523.
3460. gbpln524.seq - Plant sequence entries (including fungi and algae), part 524.
3461. gbpln525.seq - Plant sequence entries (including fungi and algae), part 525.
3462. gbpln526.seq - Plant sequence entries (including fungi and algae), part 526.
3463. gbpln527.seq - Plant sequence entries (including fungi and algae), part 527.
3464. gbpln528.seq - Plant sequence entries (including fungi and algae), part 528.
3465. gbpln529.seq - Plant sequence entries (including fungi and algae), part 529.
3466. gbpln53.seq - Plant sequence entries (including fungi and algae), part 53.
3467. gbpln530.seq - Plant sequence entries (including fungi and algae), part 530.
3468. gbpln531.seq - Plant sequence entries (including fungi and algae), part 531.
3469. gbpln532.seq - Plant sequence entries (including fungi and algae), part 532.
3470. gbpln533.seq - Plant sequence entries (including fungi and algae), part 533.
3471. gbpln534.seq - Plant sequence entries (including fungi and algae), part 534.
3472. gbpln535.seq - Plant sequence entries (including fungi and algae), part 535.
3473. gbpln536.seq - Plant sequence entries (including fungi and algae), part 536.
3474. gbpln537.seq - Plant sequence entries (including fungi and algae), part 537.
3475. gbpln538.seq - Plant sequence entries (including fungi and algae), part 538.
3476. gbpln539.seq - Plant sequence entries (including fungi and algae), part 539.
3477. gbpln54.seq - Plant sequence entries (including fungi and algae), part 54.
3478. gbpln540.seq - Plant sequence entries (including fungi and algae), part 540.
3479. gbpln541.seq - Plant sequence entries (including fungi and algae), part 541.
3480. gbpln542.seq - Plant sequence entries (including fungi and algae), part 542.
3481. gbpln543.seq - Plant sequence entries (including fungi and algae), part 543.
3482. gbpln544.seq - Plant sequence entries (including fungi and algae), part 544.
3483. gbpln545.seq - Plant sequence entries (including fungi and algae), part 545.
3484. gbpln546.seq - Plant sequence entries (including fungi and algae), part 546.
3485. gbpln547.seq - Plant sequence entries (including fungi and algae), part 547.
3486. gbpln548.seq - Plant sequence entries (including fungi and algae), part 548.
3487. gbpln549.seq - Plant sequence entries (including fungi and algae), part 549.
3488. gbpln55.seq - Plant sequence entries (including fungi and algae), part 55.
3489. gbpln550.seq - Plant sequence entries (including fungi and algae), part 550.
3490. gbpln551.seq - Plant sequence entries (including fungi and algae), part 551.
3491. gbpln552.seq - Plant sequence entries (including fungi and algae), part 552.
3492. gbpln553.seq - Plant sequence entries (including fungi and algae), part 553.
3493. gbpln554.seq - Plant sequence entries (including fungi and algae), part 554.
3494. gbpln555.seq - Plant sequence entries (including fungi and algae), part 555.
3495. gbpln556.seq - Plant sequence entries (including fungi and algae), part 556.
3496. gbpln557.seq - Plant sequence entries (including fungi and algae), part 557.
3497. gbpln558.seq - Plant sequence entries (including fungi and algae), part 558.
3498. gbpln559.seq - Plant sequence entries (including fungi and algae), part 559.
3499. gbpln56.seq - Plant sequence entries (including fungi and algae), part 56.
3500. gbpln560.seq - Plant sequence entries (including fungi and algae), part 560.
3501. gbpln561.seq - Plant sequence entries (including fungi and algae), part 561.
3502. gbpln562.seq - Plant sequence entries (including fungi and algae), part 562.
3503. gbpln563.seq - Plant sequence entries (including fungi and algae), part 563.
3504. gbpln564.seq - Plant sequence entries (including fungi and algae), part 564.
3505. gbpln565.seq - Plant sequence entries (including fungi and algae), part 565.
3506. gbpln566.seq - Plant sequence entries (including fungi and algae), part 566.
3507. gbpln567.seq - Plant sequence entries (including fungi and algae), part 567.
3508. gbpln568.seq - Plant sequence entries (including fungi and algae), part 568.
3509. gbpln569.seq - Plant sequence entries (including fungi and algae), part 569.
3510. gbpln57.seq - Plant sequence entries (including fungi and algae), part 57.
3511. gbpln570.seq - Plant sequence entries (including fungi and algae), part 570.
3512. gbpln571.seq - Plant sequence entries (including fungi and algae), part 571.
3513. gbpln572.seq - Plant sequence entries (including fungi and algae), part 572.
3514. gbpln573.seq - Plant sequence entries (including fungi and algae), part 573.
3515. gbpln574.seq - Plant sequence entries (including fungi and algae), part 574.
3516. gbpln575.seq - Plant sequence entries (including fungi and algae), part 575.
3517. gbpln576.seq - Plant sequence entries (including fungi and algae), part 576.
3518. gbpln577.seq - Plant sequence entries (including fungi and algae), part 577.
3519. gbpln578.seq - Plant sequence entries (including fungi and algae), part 578.
3520. gbpln579.seq - Plant sequence entries (including fungi and algae), part 579.
3521. gbpln58.seq - Plant sequence entries (including fungi and algae), part 58.
3522. gbpln580.seq - Plant sequence entries (including fungi and algae), part 580.
3523. gbpln581.seq - Plant sequence entries (including fungi and algae), part 581.
3524. gbpln582.seq - Plant sequence entries (including fungi and algae), part 582.
3525. gbpln583.seq - Plant sequence entries (including fungi and algae), part 583.
3526. gbpln584.seq - Plant sequence entries (including fungi and algae), part 584.
3527. gbpln585.seq - Plant sequence entries (including fungi and algae), part 585.
3528. gbpln586.seq - Plant sequence entries (including fungi and algae), part 586.
3529. gbpln587.seq - Plant sequence entries (including fungi and algae), part 587.
3530. gbpln588.seq - Plant sequence entries (including fungi and algae), part 588.
3531. gbpln589.seq - Plant sequence entries (including fungi and algae), part 589.
3532. gbpln59.seq - Plant sequence entries (including fungi and algae), part 59.
3533. gbpln590.seq - Plant sequence entries (including fungi and algae), part 590.
3534. gbpln591.seq - Plant sequence entries (including fungi and algae), part 591.
3535. gbpln592.seq - Plant sequence entries (including fungi and algae), part 592.
3536. gbpln593.seq - Plant sequence entries (including fungi and algae), part 593.
3537. gbpln594.seq - Plant sequence entries (including fungi and algae), part 594.
3538. gbpln595.seq - Plant sequence entries (including fungi and algae), part 595.
3539. gbpln596.seq - Plant sequence entries (including fungi and algae), part 596.
3540. gbpln597.seq - Plant sequence entries (including fungi and algae), part 597.
3541. gbpln598.seq - Plant sequence entries (including fungi and algae), part 598.
3542. gbpln599.seq - Plant sequence entries (including fungi and algae), part 599.
3543. gbpln6.seq - Plant sequence entries (including fungi and algae), part 6.
3544. gbpln60.seq - Plant sequence entries (including fungi and algae), part 60.
3545. gbpln600.seq - Plant sequence entries (including fungi and algae), part 600.
3546. gbpln601.seq - Plant sequence entries (including fungi and algae), part 601.
3547. gbpln602.seq - Plant sequence entries (including fungi and algae), part 602.
3548. gbpln603.seq - Plant sequence entries (including fungi and algae), part 603.
3549. gbpln604.seq - Plant sequence entries (including fungi and algae), part 604.
3550. gbpln605.seq - Plant sequence entries (including fungi and algae), part 605.
3551. gbpln606.seq - Plant sequence entries (including fungi and algae), part 606.
3552. gbpln607.seq - Plant sequence entries (including fungi and algae), part 607.
3553. gbpln608.seq - Plant sequence entries (including fungi and algae), part 608.
3554. gbpln609.seq - Plant sequence entries (including fungi and algae), part 609.
3555. gbpln61.seq - Plant sequence entries (including fungi and algae), part 61.
3556. gbpln610.seq - Plant sequence entries (including fungi and algae), part 610.
3557. gbpln611.seq - Plant sequence entries (including fungi and algae), part 611.
3558. gbpln612.seq - Plant sequence entries (including fungi and algae), part 612.
3559. gbpln613.seq - Plant sequence entries (including fungi and algae), part 613.
3560. gbpln614.seq - Plant sequence entries (including fungi and algae), part 614.
3561. gbpln615.seq - Plant sequence entries (including fungi and algae), part 615.
3562. gbpln616.seq - Plant sequence entries (including fungi and algae), part 616.
3563. gbpln617.seq - Plant sequence entries (including fungi and algae), part 617.
3564. gbpln618.seq - Plant sequence entries (including fungi and algae), part 618.
3565. gbpln619.seq - Plant sequence entries (including fungi and algae), part 619.
3566. gbpln62.seq - Plant sequence entries (including fungi and algae), part 62.
3567. gbpln620.seq - Plant sequence entries (including fungi and algae), part 620.
3568. gbpln621.seq - Plant sequence entries (including fungi and algae), part 621.
3569. gbpln622.seq - Plant sequence entries (including fungi and algae), part 622.
3570. gbpln623.seq - Plant sequence entries (including fungi and algae), part 623.
3571. gbpln624.seq - Plant sequence entries (including fungi and algae), part 624.
3572. gbpln625.seq - Plant sequence entries (including fungi and algae), part 625.
3573. gbpln626.seq - Plant sequence entries (including fungi and algae), part 626.
3574. gbpln627.seq - Plant sequence entries (including fungi and algae), part 627.
3575. gbpln628.seq - Plant sequence entries (including fungi and algae), part 628.
3576. gbpln629.seq - Plant sequence entries (including fungi and algae), part 629.
3577. gbpln63.seq - Plant sequence entries (including fungi and algae), part 63.
3578. gbpln630.seq - Plant sequence entries (including fungi and algae), part 630.
3579. gbpln631.seq - Plant sequence entries (including fungi and algae), part 631.
3580. gbpln632.seq - Plant sequence entries (including fungi and algae), part 632.
3581. gbpln633.seq - Plant sequence entries (including fungi and algae), part 633.
3582. gbpln634.seq - Plant sequence entries (including fungi and algae), part 634.
3583. gbpln635.seq - Plant sequence entries (including fungi and algae), part 635.
3584. gbpln636.seq - Plant sequence entries (including fungi and algae), part 636.
3585. gbpln637.seq - Plant sequence entries (including fungi and algae), part 637.
3586. gbpln638.seq - Plant sequence entries (including fungi and algae), part 638.
3587. gbpln639.seq - Plant sequence entries (including fungi and algae), part 639.
3588. gbpln64.seq - Plant sequence entries (including fungi and algae), part 64.
3589. gbpln640.seq - Plant sequence entries (including fungi and algae), part 640.
3590. gbpln641.seq - Plant sequence entries (including fungi and algae), part 641.
3591. gbpln642.seq - Plant sequence entries (including fungi and algae), part 642.
3592. gbpln643.seq - Plant sequence entries (including fungi and algae), part 643.
3593. gbpln644.seq - Plant sequence entries (including fungi and algae), part 644.
3594. gbpln645.seq - Plant sequence entries (including fungi and algae), part 645.
3595. gbpln646.seq - Plant sequence entries (including fungi and algae), part 646.
3596. gbpln647.seq - Plant sequence entries (including fungi and algae), part 647.
3597. gbpln648.seq - Plant sequence entries (including fungi and algae), part 648.
3598. gbpln649.seq - Plant sequence entries (including fungi and algae), part 649.
3599. gbpln65.seq - Plant sequence entries (including fungi and algae), part 65.
3600. gbpln650.seq - Plant sequence entries (including fungi and algae), part 650.
3601. gbpln651.seq - Plant sequence entries (including fungi and algae), part 651.
3602. gbpln652.seq - Plant sequence entries (including fungi and algae), part 652.
3603. gbpln653.seq - Plant sequence entries (including fungi and algae), part 653.
3604. gbpln654.seq - Plant sequence entries (including fungi and algae), part 654.
3605. gbpln655.seq - Plant sequence entries (including fungi and algae), part 655.
3606. gbpln656.seq - Plant sequence entries (including fungi and algae), part 656.
3607. gbpln657.seq - Plant sequence entries (including fungi and algae), part 657.
3608. gbpln658.seq - Plant sequence entries (including fungi and algae), part 658.
3609. gbpln659.seq - Plant sequence entries (including fungi and algae), part 659.
3610. gbpln66.seq - Plant sequence entries (including fungi and algae), part 66.
3611. gbpln660.seq - Plant sequence entries (including fungi and algae), part 660.
3612. gbpln661.seq - Plant sequence entries (including fungi and algae), part 661.
3613. gbpln662.seq - Plant sequence entries (including fungi and algae), part 662.
3614. gbpln663.seq - Plant sequence entries (including fungi and algae), part 663.
3615. gbpln664.seq - Plant sequence entries (including fungi and algae), part 664.
3616. gbpln665.seq - Plant sequence entries (including fungi and algae), part 665.
3617. gbpln666.seq - Plant sequence entries (including fungi and algae), part 666.
3618. gbpln667.seq - Plant sequence entries (including fungi and algae), part 667.
3619. gbpln668.seq - Plant sequence entries (including fungi and algae), part 668.
3620. gbpln669.seq - Plant sequence entries (including fungi and algae), part 669.
3621. gbpln67.seq - Plant sequence entries (including fungi and algae), part 67.
3622. gbpln670.seq - Plant sequence entries (including fungi and algae), part 670.
3623. gbpln671.seq - Plant sequence entries (including fungi and algae), part 671.
3624. gbpln672.seq - Plant sequence entries (including fungi and algae), part 672.
3625. gbpln673.seq - Plant sequence entries (including fungi and algae), part 673.
3626. gbpln674.seq - Plant sequence entries (including fungi and algae), part 674.
3627. gbpln675.seq - Plant sequence entries (including fungi and algae), part 675.
3628. gbpln676.seq - Plant sequence entries (including fungi and algae), part 676.
3629. gbpln677.seq - Plant sequence entries (including fungi and algae), part 677.
3630. gbpln678.seq - Plant sequence entries (including fungi and algae), part 678.
3631. gbpln679.seq - Plant sequence entries (including fungi and algae), part 679.
3632. gbpln68.seq - Plant sequence entries (including fungi and algae), part 68.
3633. gbpln680.seq - Plant sequence entries (including fungi and algae), part 680.
3634. gbpln681.seq - Plant sequence entries (including fungi and algae), part 681.
3635. gbpln682.seq - Plant sequence entries (including fungi and algae), part 682.
3636. gbpln683.seq - Plant sequence entries (including fungi and algae), part 683.
3637. gbpln684.seq - Plant sequence entries (including fungi and algae), part 684.
3638. gbpln685.seq - Plant sequence entries (including fungi and algae), part 685.
3639. gbpln686.seq - Plant sequence entries (including fungi and algae), part 686.
3640. gbpln687.seq - Plant sequence entries (including fungi and algae), part 687.
3641. gbpln688.seq - Plant sequence entries (including fungi and algae), part 688.
3642. gbpln689.seq - Plant sequence entries (including fungi and algae), part 689.
3643. gbpln69.seq - Plant sequence entries (including fungi and algae), part 69.
3644. gbpln690.seq - Plant sequence entries (including fungi and algae), part 690.
3645. gbpln691.seq - Plant sequence entries (including fungi and algae), part 691.
3646. gbpln692.seq - Plant sequence entries (including fungi and algae), part 692.
3647. gbpln693.seq - Plant sequence entries (including fungi and algae), part 693.
3648. gbpln694.seq - Plant sequence entries (including fungi and algae), part 694.
3649. gbpln695.seq - Plant sequence entries (including fungi and algae), part 695.
3650. gbpln696.seq - Plant sequence entries (including fungi and algae), part 696.
3651. gbpln697.seq - Plant sequence entries (including fungi and algae), part 697.
3652. gbpln698.seq - Plant sequence entries (including fungi and algae), part 698.
3653. gbpln699.seq - Plant sequence entries (including fungi and algae), part 699.
3654. gbpln7.seq - Plant sequence entries (including fungi and algae), part 7.
3655. gbpln70.seq - Plant sequence entries (including fungi and algae), part 70.
3656. gbpln700.seq - Plant sequence entries (including fungi and algae), part 700.
3657. gbpln701.seq - Plant sequence entries (including fungi and algae), part 701.
3658. gbpln702.seq - Plant sequence entries (including fungi and algae), part 702.
3659. gbpln703.seq - Plant sequence entries (including fungi and algae), part 703.
3660. gbpln704.seq - Plant sequence entries (including fungi and algae), part 704.
3661. gbpln705.seq - Plant sequence entries (including fungi and algae), part 705.
3662. gbpln706.seq - Plant sequence entries (including fungi and algae), part 706.
3663. gbpln707.seq - Plant sequence entries (including fungi and algae), part 707.
3664. gbpln708.seq - Plant sequence entries (including fungi and algae), part 708.
3665. gbpln709.seq - Plant sequence entries (including fungi and algae), part 709.
3666. gbpln71.seq - Plant sequence entries (including fungi and algae), part 71.
3667. gbpln710.seq - Plant sequence entries (including fungi and algae), part 710.
3668. gbpln711.seq - Plant sequence entries (including fungi and algae), part 711.
3669. gbpln712.seq - Plant sequence entries (including fungi and algae), part 712.
3670. gbpln713.seq - Plant sequence entries (including fungi and algae), part 713.
3671. gbpln714.seq - Plant sequence entries (including fungi and algae), part 714.
3672. gbpln715.seq - Plant sequence entries (including fungi and algae), part 715.
3673. gbpln716.seq - Plant sequence entries (including fungi and algae), part 716.
3674. gbpln717.seq - Plant sequence entries (including fungi and algae), part 717.
3675. gbpln718.seq - Plant sequence entries (including fungi and algae), part 718.
3676. gbpln719.seq - Plant sequence entries (including fungi and algae), part 719.
3677. gbpln72.seq - Plant sequence entries (including fungi and algae), part 72.
3678. gbpln720.seq - Plant sequence entries (including fungi and algae), part 720.
3679. gbpln721.seq - Plant sequence entries (including fungi and algae), part 721.
3680. gbpln722.seq - Plant sequence entries (including fungi and algae), part 722.
3681. gbpln723.seq - Plant sequence entries (including fungi and algae), part 723.
3682. gbpln724.seq - Plant sequence entries (including fungi and algae), part 724.
3683. gbpln725.seq - Plant sequence entries (including fungi and algae), part 725.
3684. gbpln726.seq - Plant sequence entries (including fungi and algae), part 726.
3685. gbpln727.seq - Plant sequence entries (including fungi and algae), part 727.
3686. gbpln728.seq - Plant sequence entries (including fungi and algae), part 728.
3687. gbpln729.seq - Plant sequence entries (including fungi and algae), part 729.
3688. gbpln73.seq - Plant sequence entries (including fungi and algae), part 73.
3689. gbpln730.seq - Plant sequence entries (including fungi and algae), part 730.
3690. gbpln731.seq - Plant sequence entries (including fungi and algae), part 731.
3691. gbpln732.seq - Plant sequence entries (including fungi and algae), part 732.
3692. gbpln733.seq - Plant sequence entries (including fungi and algae), part 733.
3693. gbpln734.seq - Plant sequence entries (including fungi and algae), part 734.
3694. gbpln735.seq - Plant sequence entries (including fungi and algae), part 735.
3695. gbpln736.seq - Plant sequence entries (including fungi and algae), part 736.
3696. gbpln737.seq - Plant sequence entries (including fungi and algae), part 737.
3697. gbpln738.seq - Plant sequence entries (including fungi and algae), part 738.
3698. gbpln739.seq - Plant sequence entries (including fungi and algae), part 739.
3699. gbpln74.seq - Plant sequence entries (including fungi and algae), part 74.
3700. gbpln740.seq - Plant sequence entries (including fungi and algae), part 740.
3701. gbpln741.seq - Plant sequence entries (including fungi and algae), part 741.
3702. gbpln742.seq - Plant sequence entries (including fungi and algae), part 742.
3703. gbpln743.seq - Plant sequence entries (including fungi and algae), part 743.
3704. gbpln744.seq - Plant sequence entries (including fungi and algae), part 744.
3705. gbpln745.seq - Plant sequence entries (including fungi and algae), part 745.
3706. gbpln746.seq - Plant sequence entries (including fungi and algae), part 746.
3707. gbpln747.seq - Plant sequence entries (including fungi and algae), part 747.
3708. gbpln748.seq - Plant sequence entries (including fungi and algae), part 748.
3709. gbpln749.seq - Plant sequence entries (including fungi and algae), part 749.
3710. gbpln75.seq - Plant sequence entries (including fungi and algae), part 75.
3711. gbpln750.seq - Plant sequence entries (including fungi and algae), part 750.
3712. gbpln751.seq - Plant sequence entries (including fungi and algae), part 751.
3713. gbpln752.seq - Plant sequence entries (including fungi and algae), part 752.
3714. gbpln753.seq - Plant sequence entries (including fungi and algae), part 753.
3715. gbpln754.seq - Plant sequence entries (including fungi and algae), part 754.
3716. gbpln755.seq - Plant sequence entries (including fungi and algae), part 755.
3717. gbpln756.seq - Plant sequence entries (including fungi and algae), part 756.
3718. gbpln757.seq - Plant sequence entries (including fungi and algae), part 757.
3719. gbpln758.seq - Plant sequence entries (including fungi and algae), part 758.
3720. gbpln759.seq - Plant sequence entries (including fungi and algae), part 759.
3721. gbpln76.seq - Plant sequence entries (including fungi and algae), part 76.
3722. gbpln760.seq - Plant sequence entries (including fungi and algae), part 760.
3723. gbpln761.seq - Plant sequence entries (including fungi and algae), part 761.
3724. gbpln762.seq - Plant sequence entries (including fungi and algae), part 762.
3725. gbpln763.seq - Plant sequence entries (including fungi and algae), part 763.
3726. gbpln764.seq - Plant sequence entries (including fungi and algae), part 764.
3727. gbpln765.seq - Plant sequence entries (including fungi and algae), part 765.
3728. gbpln766.seq - Plant sequence entries (including fungi and algae), part 766.
3729. gbpln767.seq - Plant sequence entries (including fungi and algae), part 767.
3730. gbpln768.seq - Plant sequence entries (including fungi and algae), part 768.
3731. gbpln769.seq - Plant sequence entries (including fungi and algae), part 769.
3732. gbpln77.seq - Plant sequence entries (including fungi and algae), part 77.
3733. gbpln770.seq - Plant sequence entries (including fungi and algae), part 770.
3734. gbpln771.seq - Plant sequence entries (including fungi and algae), part 771.
3735. gbpln772.seq - Plant sequence entries (including fungi and algae), part 772.
3736. gbpln773.seq - Plant sequence entries (including fungi and algae), part 773.
3737. gbpln774.seq - Plant sequence entries (including fungi and algae), part 774.
3738. gbpln775.seq - Plant sequence entries (including fungi and algae), part 775.
3739. gbpln776.seq - Plant sequence entries (including fungi and algae), part 776.
3740. gbpln777.seq - Plant sequence entries (including fungi and algae), part 777.
3741. gbpln778.seq - Plant sequence entries (including fungi and algae), part 778.
3742. gbpln779.seq - Plant sequence entries (including fungi and algae), part 779.
3743. gbpln78.seq - Plant sequence entries (including fungi and algae), part 78.
3744. gbpln780.seq - Plant sequence entries (including fungi and algae), part 780.
3745. gbpln781.seq - Plant sequence entries (including fungi and algae), part 781.
3746. gbpln782.seq - Plant sequence entries (including fungi and algae), part 782.
3747. gbpln783.seq - Plant sequence entries (including fungi and algae), part 783.
3748. gbpln784.seq - Plant sequence entries (including fungi and algae), part 784.
3749. gbpln785.seq - Plant sequence entries (including fungi and algae), part 785.
3750. gbpln786.seq - Plant sequence entries (including fungi and algae), part 786.
3751. gbpln787.seq - Plant sequence entries (including fungi and algae), part 787.
3752. gbpln788.seq - Plant sequence entries (including fungi and algae), part 788.
3753. gbpln789.seq - Plant sequence entries (including fungi and algae), part 789.
3754. gbpln79.seq - Plant sequence entries (including fungi and algae), part 79.
3755. gbpln790.seq - Plant sequence entries (including fungi and algae), part 790.
3756. gbpln791.seq - Plant sequence entries (including fungi and algae), part 791.
3757. gbpln792.seq - Plant sequence entries (including fungi and algae), part 792.
3758. gbpln793.seq - Plant sequence entries (including fungi and algae), part 793.
3759. gbpln794.seq - Plant sequence entries (including fungi and algae), part 794.
3760. gbpln795.seq - Plant sequence entries (including fungi and algae), part 795.
3761. gbpln796.seq - Plant sequence entries (including fungi and algae), part 796.
3762. gbpln797.seq - Plant sequence entries (including fungi and algae), part 797.
3763. gbpln798.seq - Plant sequence entries (including fungi and algae), part 798.
3764. gbpln799.seq - Plant sequence entries (including fungi and algae), part 799.
3765. gbpln8.seq - Plant sequence entries (including fungi and algae), part 8.
3766. gbpln80.seq - Plant sequence entries (including fungi and algae), part 80.
3767. gbpln800.seq - Plant sequence entries (including fungi and algae), part 800.
3768. gbpln801.seq - Plant sequence entries (including fungi and algae), part 801.
3769. gbpln802.seq - Plant sequence entries (including fungi and algae), part 802.
3770. gbpln803.seq - Plant sequence entries (including fungi and algae), part 803.
3771. gbpln804.seq - Plant sequence entries (including fungi and algae), part 804.
3772. gbpln805.seq - Plant sequence entries (including fungi and algae), part 805.
3773. gbpln806.seq - Plant sequence entries (including fungi and algae), part 806.
3774. gbpln807.seq - Plant sequence entries (including fungi and algae), part 807.
3775. gbpln808.seq - Plant sequence entries (including fungi and algae), part 808.
3776. gbpln809.seq - Plant sequence entries (including fungi and algae), part 809.
3777. gbpln81.seq - Plant sequence entries (including fungi and algae), part 81.
3778. gbpln810.seq - Plant sequence entries (including fungi and algae), part 810.
3779. gbpln811.seq - Plant sequence entries (including fungi and algae), part 811.
3780. gbpln812.seq - Plant sequence entries (including fungi and algae), part 812.
3781. gbpln813.seq - Plant sequence entries (including fungi and algae), part 813.
3782. gbpln814.seq - Plant sequence entries (including fungi and algae), part 814.
3783. gbpln815.seq - Plant sequence entries (including fungi and algae), part 815.
3784. gbpln816.seq - Plant sequence entries (including fungi and algae), part 816.
3785. gbpln817.seq - Plant sequence entries (including fungi and algae), part 817.
3786. gbpln818.seq - Plant sequence entries (including fungi and algae), part 818.
3787. gbpln819.seq - Plant sequence entries (including fungi and algae), part 819.
3788. gbpln82.seq - Plant sequence entries (including fungi and algae), part 82.
3789. gbpln820.seq - Plant sequence entries (including fungi and algae), part 820.
3790. gbpln821.seq - Plant sequence entries (including fungi and algae), part 821.
3791. gbpln822.seq - Plant sequence entries (including fungi and algae), part 822.
3792. gbpln823.seq - Plant sequence entries (including fungi and algae), part 823.
3793. gbpln824.seq - Plant sequence entries (including fungi and algae), part 824.
3794. gbpln825.seq - Plant sequence entries (including fungi and algae), part 825.
3795. gbpln826.seq - Plant sequence entries (including fungi and algae), part 826.
3796. gbpln827.seq - Plant sequence entries (including fungi and algae), part 827.
3797. gbpln828.seq - Plant sequence entries (including fungi and algae), part 828.
3798. gbpln829.seq - Plant sequence entries (including fungi and algae), part 829.
3799. gbpln83.seq - Plant sequence entries (including fungi and algae), part 83.
3800. gbpln830.seq - Plant sequence entries (including fungi and algae), part 830.
3801. gbpln831.seq - Plant sequence entries (including fungi and algae), part 831.
3802. gbpln832.seq - Plant sequence entries (including fungi and algae), part 832.
3803. gbpln833.seq - Plant sequence entries (including fungi and algae), part 833.
3804. gbpln834.seq - Plant sequence entries (including fungi and algae), part 834.
3805. gbpln835.seq - Plant sequence entries (including fungi and algae), part 835.
3806. gbpln836.seq - Plant sequence entries (including fungi and algae), part 836.
3807. gbpln837.seq - Plant sequence entries (including fungi and algae), part 837.
3808. gbpln838.seq - Plant sequence entries (including fungi and algae), part 838.
3809. gbpln839.seq - Plant sequence entries (including fungi and algae), part 839.
3810. gbpln84.seq - Plant sequence entries (including fungi and algae), part 84.
3811. gbpln840.seq - Plant sequence entries (including fungi and algae), part 840.
3812. gbpln841.seq - Plant sequence entries (including fungi and algae), part 841.
3813. gbpln842.seq - Plant sequence entries (including fungi and algae), part 842.
3814. gbpln843.seq - Plant sequence entries (including fungi and algae), part 843.
3815. gbpln844.seq - Plant sequence entries (including fungi and algae), part 844.
3816. gbpln845.seq - Plant sequence entries (including fungi and algae), part 845.
3817. gbpln846.seq - Plant sequence entries (including fungi and algae), part 846.
3818. gbpln847.seq - Plant sequence entries (including fungi and algae), part 847.
3819. gbpln848.seq - Plant sequence entries (including fungi and algae), part 848.
3820. gbpln849.seq - Plant sequence entries (including fungi and algae), part 849.
3821. gbpln85.seq - Plant sequence entries (including fungi and algae), part 85.
3822. gbpln850.seq - Plant sequence entries (including fungi and algae), part 850.
3823. gbpln851.seq - Plant sequence entries (including fungi and algae), part 851.
3824. gbpln852.seq - Plant sequence entries (including fungi and algae), part 852.
3825. gbpln853.seq - Plant sequence entries (including fungi and algae), part 853.
3826. gbpln854.seq - Plant sequence entries (including fungi and algae), part 854.
3827. gbpln855.seq - Plant sequence entries (including fungi and algae), part 855.
3828. gbpln856.seq - Plant sequence entries (including fungi and algae), part 856.
3829. gbpln857.seq - Plant sequence entries (including fungi and algae), part 857.
3830. gbpln858.seq - Plant sequence entries (including fungi and algae), part 858.
3831. gbpln859.seq - Plant sequence entries (including fungi and algae), part 859.
3832. gbpln86.seq - Plant sequence entries (including fungi and algae), part 86.
3833. gbpln860.seq - Plant sequence entries (including fungi and algae), part 860.
3834. gbpln861.seq - Plant sequence entries (including fungi and algae), part 861.
3835. gbpln862.seq - Plant sequence entries (including fungi and algae), part 862.
3836. gbpln863.seq - Plant sequence entries (including fungi and algae), part 863.
3837. gbpln864.seq - Plant sequence entries (including fungi and algae), part 864.
3838. gbpln865.seq - Plant sequence entries (including fungi and algae), part 865.
3839. gbpln866.seq - Plant sequence entries (including fungi and algae), part 866.
3840. gbpln867.seq - Plant sequence entries (including fungi and algae), part 867.
3841. gbpln868.seq - Plant sequence entries (including fungi and algae), part 868.
3842. gbpln869.seq - Plant sequence entries (including fungi and algae), part 869.
3843. gbpln87.seq - Plant sequence entries (including fungi and algae), part 87.
3844. gbpln870.seq - Plant sequence entries (including fungi and algae), part 870.
3845. gbpln871.seq - Plant sequence entries (including fungi and algae), part 871.
3846. gbpln872.seq - Plant sequence entries (including fungi and algae), part 872.
3847. gbpln873.seq - Plant sequence entries (including fungi and algae), part 873.
3848. gbpln874.seq - Plant sequence entries (including fungi and algae), part 874.
3849. gbpln875.seq - Plant sequence entries (including fungi and algae), part 875.
3850. gbpln876.seq - Plant sequence entries (including fungi and algae), part 876.
3851. gbpln877.seq - Plant sequence entries (including fungi and algae), part 877.
3852. gbpln878.seq - Plant sequence entries (including fungi and algae), part 878.
3853. gbpln879.seq - Plant sequence entries (including fungi and algae), part 879.
3854. gbpln88.seq - Plant sequence entries (including fungi and algae), part 88.
3855. gbpln880.seq - Plant sequence entries (including fungi and algae), part 880.
3856. gbpln881.seq - Plant sequence entries (including fungi and algae), part 881.
3857. gbpln882.seq - Plant sequence entries (including fungi and algae), part 882.
3858. gbpln883.seq - Plant sequence entries (including fungi and algae), part 883.
3859. gbpln884.seq - Plant sequence entries (including fungi and algae), part 884.
3860. gbpln885.seq - Plant sequence entries (including fungi and algae), part 885.
3861. gbpln886.seq - Plant sequence entries (including fungi and algae), part 886.
3862. gbpln887.seq - Plant sequence entries (including fungi and algae), part 887.
3863. gbpln888.seq - Plant sequence entries (including fungi and algae), part 888.
3864. gbpln889.seq - Plant sequence entries (including fungi and algae), part 889.
3865. gbpln89.seq - Plant sequence entries (including fungi and algae), part 89.
3866. gbpln890.seq - Plant sequence entries (including fungi and algae), part 890.
3867. gbpln891.seq - Plant sequence entries (including fungi and algae), part 891.
3868. gbpln892.seq - Plant sequence entries (including fungi and algae), part 892.
3869. gbpln893.seq - Plant sequence entries (including fungi and algae), part 893.
3870. gbpln894.seq - Plant sequence entries (including fungi and algae), part 894.
3871. gbpln895.seq - Plant sequence entries (including fungi and algae), part 895.
3872. gbpln896.seq - Plant sequence entries (including fungi and algae), part 896.
3873. gbpln897.seq - Plant sequence entries (including fungi and algae), part 897.
3874. gbpln898.seq - Plant sequence entries (including fungi and algae), part 898.
3875. gbpln899.seq - Plant sequence entries (including fungi and algae), part 899.
3876. gbpln9.seq - Plant sequence entries (including fungi and algae), part 9.
3877. gbpln90.seq - Plant sequence entries (including fungi and algae), part 90.
3878. gbpln900.seq - Plant sequence entries (including fungi and algae), part 900.
3879. gbpln901.seq - Plant sequence entries (including fungi and algae), part 901.
3880. gbpln902.seq - Plant sequence entries (including fungi and algae), part 902.
3881. gbpln903.seq - Plant sequence entries (including fungi and algae), part 903.
3882. gbpln904.seq - Plant sequence entries (including fungi and algae), part 904.
3883. gbpln905.seq - Plant sequence entries (including fungi and algae), part 905.
3884. gbpln906.seq - Plant sequence entries (including fungi and algae), part 906.
3885. gbpln907.seq - Plant sequence entries (including fungi and algae), part 907.
3886. gbpln908.seq - Plant sequence entries (including fungi and algae), part 908.
3887. gbpln909.seq - Plant sequence entries (including fungi and algae), part 909.
3888. gbpln91.seq - Plant sequence entries (including fungi and algae), part 91.
3889. gbpln910.seq - Plant sequence entries (including fungi and algae), part 910.
3890. gbpln911.seq - Plant sequence entries (including fungi and algae), part 911.
3891. gbpln912.seq - Plant sequence entries (including fungi and algae), part 912.
3892. gbpln913.seq - Plant sequence entries (including fungi and algae), part 913.
3893. gbpln914.seq - Plant sequence entries (including fungi and algae), part 914.
3894. gbpln915.seq - Plant sequence entries (including fungi and algae), part 915.
3895. gbpln916.seq - Plant sequence entries (including fungi and algae), part 916.
3896. gbpln917.seq - Plant sequence entries (including fungi and algae), part 917.
3897. gbpln918.seq - Plant sequence entries (including fungi and algae), part 918.
3898. gbpln919.seq - Plant sequence entries (including fungi and algae), part 919.
3899. gbpln92.seq - Plant sequence entries (including fungi and algae), part 92.
3900. gbpln920.seq - Plant sequence entries (including fungi and algae), part 920.
3901. gbpln921.seq - Plant sequence entries (including fungi and algae), part 921.
3902. gbpln922.seq - Plant sequence entries (including fungi and algae), part 922.
3903. gbpln923.seq - Plant sequence entries (including fungi and algae), part 923.
3904. gbpln924.seq - Plant sequence entries (including fungi and algae), part 924.
3905. gbpln925.seq - Plant sequence entries (including fungi and algae), part 925.
3906. gbpln926.seq - Plant sequence entries (including fungi and algae), part 926.
3907. gbpln927.seq - Plant sequence entries (including fungi and algae), part 927.
3908. gbpln928.seq - Plant sequence entries (including fungi and algae), part 928.
3909. gbpln929.seq - Plant sequence entries (including fungi and algae), part 929.
3910. gbpln93.seq - Plant sequence entries (including fungi and algae), part 93.
3911. gbpln930.seq - Plant sequence entries (including fungi and algae), part 930.
3912. gbpln931.seq - Plant sequence entries (including fungi and algae), part 931.
3913. gbpln932.seq - Plant sequence entries (including fungi and algae), part 932.
3914. gbpln933.seq - Plant sequence entries (including fungi and algae), part 933.
3915. gbpln934.seq - Plant sequence entries (including fungi and algae), part 934.
3916. gbpln935.seq - Plant sequence entries (including fungi and algae), part 935.
3917. gbpln936.seq - Plant sequence entries (including fungi and algae), part 936.
3918. gbpln937.seq - Plant sequence entries (including fungi and algae), part 937.
3919. gbpln938.seq - Plant sequence entries (including fungi and algae), part 938.
3920. gbpln939.seq - Plant sequence entries (including fungi and algae), part 939.
3921. gbpln94.seq - Plant sequence entries (including fungi and algae), part 94.
3922. gbpln940.seq - Plant sequence entries (including fungi and algae), part 940.
3923. gbpln941.seq - Plant sequence entries (including fungi and algae), part 941.
3924. gbpln942.seq - Plant sequence entries (including fungi and algae), part 942.
3925. gbpln943.seq - Plant sequence entries (including fungi and algae), part 943.
3926. gbpln944.seq - Plant sequence entries (including fungi and algae), part 944.
3927. gbpln945.seq - Plant sequence entries (including fungi and algae), part 945.
3928. gbpln946.seq - Plant sequence entries (including fungi and algae), part 946.
3929. gbpln947.seq - Plant sequence entries (including fungi and algae), part 947.
3930. gbpln948.seq - Plant sequence entries (including fungi and algae), part 948.
3931. gbpln949.seq - Plant sequence entries (including fungi and algae), part 949.
3932. gbpln95.seq - Plant sequence entries (including fungi and algae), part 95.
3933. gbpln950.seq - Plant sequence entries (including fungi and algae), part 950.
3934. gbpln951.seq - Plant sequence entries (including fungi and algae), part 951.
3935. gbpln952.seq - Plant sequence entries (including fungi and algae), part 952.
3936. gbpln953.seq - Plant sequence entries (including fungi and algae), part 953.
3937. gbpln954.seq - Plant sequence entries (including fungi and algae), part 954.
3938. gbpln955.seq - Plant sequence entries (including fungi and algae), part 955.
3939. gbpln956.seq - Plant sequence entries (including fungi and algae), part 956.
3940. gbpln957.seq - Plant sequence entries (including fungi and algae), part 957.
3941. gbpln958.seq - Plant sequence entries (including fungi and algae), part 958.
3942. gbpln959.seq - Plant sequence entries (including fungi and algae), part 959.
3943. gbpln96.seq - Plant sequence entries (including fungi and algae), part 96.
3944. gbpln960.seq - Plant sequence entries (including fungi and algae), part 960.
3945. gbpln961.seq - Plant sequence entries (including fungi and algae), part 961.
3946. gbpln962.seq - Plant sequence entries (including fungi and algae), part 962.
3947. gbpln963.seq - Plant sequence entries (including fungi and algae), part 963.
3948. gbpln964.seq - Plant sequence entries (including fungi and algae), part 964.
3949. gbpln965.seq - Plant sequence entries (including fungi and algae), part 965.
3950. gbpln966.seq - Plant sequence entries (including fungi and algae), part 966.
3951. gbpln967.seq - Plant sequence entries (including fungi and algae), part 967.
3952. gbpln968.seq - Plant sequence entries (including fungi and algae), part 968.
3953. gbpln969.seq - Plant sequence entries (including fungi and algae), part 969.
3954. gbpln97.seq - Plant sequence entries (including fungi and algae), part 97.
3955. gbpln970.seq - Plant sequence entries (including fungi and algae), part 970.
3956. gbpln971.seq - Plant sequence entries (including fungi and algae), part 971.
3957. gbpln972.seq - Plant sequence entries (including fungi and algae), part 972.
3958. gbpln973.seq - Plant sequence entries (including fungi and algae), part 973.
3959. gbpln974.seq - Plant sequence entries (including fungi and algae), part 974.
3960. gbpln975.seq - Plant sequence entries (including fungi and algae), part 975.
3961. gbpln976.seq - Plant sequence entries (including fungi and algae), part 976.
3962. gbpln977.seq - Plant sequence entries (including fungi and algae), part 977.
3963. gbpln978.seq - Plant sequence entries (including fungi and algae), part 978.
3964. gbpln979.seq - Plant sequence entries (including fungi and algae), part 979.
3965. gbpln98.seq - Plant sequence entries (including fungi and algae), part 98.
3966. gbpln980.seq - Plant sequence entries (including fungi and algae), part 980.
3967. gbpln981.seq - Plant sequence entries (including fungi and algae), part 981.
3968. gbpln982.seq - Plant sequence entries (including fungi and algae), part 982.
3969. gbpln983.seq - Plant sequence entries (including fungi and algae), part 983.
3970. gbpln984.seq - Plant sequence entries (including fungi and algae), part 984.
3971. gbpln985.seq - Plant sequence entries (including fungi and algae), part 985.
3972. gbpln986.seq - Plant sequence entries (including fungi and algae), part 986.
3973. gbpln987.seq - Plant sequence entries (including fungi and algae), part 987.
3974. gbpln988.seq - Plant sequence entries (including fungi and algae), part 988.
3975. gbpln989.seq - Plant sequence entries (including fungi and algae), part 989.
3976. gbpln99.seq - Plant sequence entries (including fungi and algae), part 99.
3977. gbpln990.seq - Plant sequence entries (including fungi and algae), part 990.
3978. gbpln991.seq - Plant sequence entries (including fungi and algae), part 991.
3979. gbpln992.seq - Plant sequence entries (including fungi and algae), part 992.
3980. gbpln993.seq - Plant sequence entries (including fungi and algae), part 993.
3981. gbpln994.seq - Plant sequence entries (including fungi and algae), part 994.
3982. gbpln995.seq - Plant sequence entries (including fungi and algae), part 995.
3983. gbpln996.seq - Plant sequence entries (including fungi and algae), part 996.
3984. gbpln997.seq - Plant sequence entries (including fungi and algae), part 997.
3985. gbpln998.seq - Plant sequence entries (including fungi and algae), part 998.
3986. gbpln999.seq - Plant sequence entries (including fungi and algae), part 999.
3987. gbpri1.seq - Primate sequence entries, part 1.
3988. gbpri10.seq - Primate sequence entries, part 10.
3989. gbpri100.seq - Primate sequence entries, part 100.
3990. gbpri101.seq - Primate sequence entries, part 101.
3991. gbpri102.seq - Primate sequence entries, part 102.
3992. gbpri103.seq - Primate sequence entries, part 103.
3993. gbpri104.seq - Primate sequence entries, part 104.
3994. gbpri105.seq - Primate sequence entries, part 105.
3995. gbpri106.seq - Primate sequence entries, part 106.
3996. gbpri107.seq - Primate sequence entries, part 107.
3997. gbpri108.seq - Primate sequence entries, part 108.
3998. gbpri109.seq - Primate sequence entries, part 109.
3999. gbpri11.seq - Primate sequence entries, part 11.
4000. gbpri110.seq - Primate sequence entries, part 110.
4001. gbpri111.seq - Primate sequence entries, part 111.
4002. gbpri112.seq - Primate sequence entries, part 112.
4003. gbpri113.seq - Primate sequence entries, part 113.
4004. gbpri114.seq - Primate sequence entries, part 114.
4005. gbpri115.seq - Primate sequence entries, part 115.
4006. gbpri116.seq - Primate sequence entries, part 116.
4007. gbpri117.seq - Primate sequence entries, part 117.
4008. gbpri118.seq - Primate sequence entries, part 118.
4009. gbpri119.seq - Primate sequence entries, part 119.
4010. gbpri12.seq - Primate sequence entries, part 12.
4011. gbpri120.seq - Primate sequence entries, part 120.
4012. gbpri121.seq - Primate sequence entries, part 121.
4013. gbpri122.seq - Primate sequence entries, part 122.
4014. gbpri123.seq - Primate sequence entries, part 123.
4015. gbpri124.seq - Primate sequence entries, part 124.
4016. gbpri125.seq - Primate sequence entries, part 125.
4017. gbpri126.seq - Primate sequence entries, part 126.
4018. gbpri127.seq - Primate sequence entries, part 127.
4019. gbpri128.seq - Primate sequence entries, part 128.
4020. gbpri129.seq - Primate sequence entries, part 129.
4021. gbpri13.seq - Primate sequence entries, part 13.
4022. gbpri130.seq - Primate sequence entries, part 130.
4023. gbpri131.seq - Primate sequence entries, part 131.
4024. gbpri132.seq - Primate sequence entries, part 132.
4025. gbpri133.seq - Primate sequence entries, part 133.
4026. gbpri134.seq - Primate sequence entries, part 134.
4027. gbpri135.seq - Primate sequence entries, part 135.
4028. gbpri136.seq - Primate sequence entries, part 136.
4029. gbpri137.seq - Primate sequence entries, part 137.
4030. gbpri138.seq - Primate sequence entries, part 138.
4031. gbpri139.seq - Primate sequence entries, part 139.
4032. gbpri14.seq - Primate sequence entries, part 14.
4033. gbpri140.seq - Primate sequence entries, part 140.
4034. gbpri141.seq - Primate sequence entries, part 141.
4035. gbpri142.seq - Primate sequence entries, part 142.
4036. gbpri143.seq - Primate sequence entries, part 143.
4037. gbpri144.seq - Primate sequence entries, part 144.
4038. gbpri145.seq - Primate sequence entries, part 145.
4039. gbpri146.seq - Primate sequence entries, part 146.
4040. gbpri147.seq - Primate sequence entries, part 147.
4041. gbpri148.seq - Primate sequence entries, part 148.
4042. gbpri149.seq - Primate sequence entries, part 149.
4043. gbpri15.seq - Primate sequence entries, part 15.
4044. gbpri150.seq - Primate sequence entries, part 150.
4045. gbpri151.seq - Primate sequence entries, part 151.
4046. gbpri152.seq - Primate sequence entries, part 152.
4047. gbpri153.seq - Primate sequence entries, part 153.
4048. gbpri154.seq - Primate sequence entries, part 154.
4049. gbpri155.seq - Primate sequence entries, part 155.
4050. gbpri156.seq - Primate sequence entries, part 156.
4051. gbpri157.seq - Primate sequence entries, part 157.
4052. gbpri158.seq - Primate sequence entries, part 158.
4053. gbpri159.seq - Primate sequence entries, part 159.
4054. gbpri16.seq - Primate sequence entries, part 16.
4055. gbpri160.seq - Primate sequence entries, part 160.
4056. gbpri161.seq - Primate sequence entries, part 161.
4057. gbpri162.seq - Primate sequence entries, part 162.
4058. gbpri163.seq - Primate sequence entries, part 163.
4059. gbpri164.seq - Primate sequence entries, part 164.
4060. gbpri165.seq - Primate sequence entries, part 165.
4061. gbpri166.seq - Primate sequence entries, part 166.
4062. gbpri167.seq - Primate sequence entries, part 167.
4063. gbpri168.seq - Primate sequence entries, part 168.
4064. gbpri169.seq - Primate sequence entries, part 169.
4065. gbpri17.seq - Primate sequence entries, part 17.
4066. gbpri170.seq - Primate sequence entries, part 170.
4067. gbpri171.seq - Primate sequence entries, part 171.
4068. gbpri172.seq - Primate sequence entries, part 172.
4069. gbpri173.seq - Primate sequence entries, part 173.
4070. gbpri174.seq - Primate sequence entries, part 174.
4071. gbpri175.seq - Primate sequence entries, part 175.
4072. gbpri176.seq - Primate sequence entries, part 176.
4073. gbpri177.seq - Primate sequence entries, part 177.
4074. gbpri178.seq - Primate sequence entries, part 178.
4075. gbpri179.seq - Primate sequence entries, part 179.
4076. gbpri18.seq - Primate sequence entries, part 18.
4077. gbpri180.seq - Primate sequence entries, part 180.
4078. gbpri181.seq - Primate sequence entries, part 181.
4079. gbpri182.seq - Primate sequence entries, part 182.
4080. gbpri183.seq - Primate sequence entries, part 183.
4081. gbpri184.seq - Primate sequence entries, part 184.
4082. gbpri185.seq - Primate sequence entries, part 185.
4083. gbpri186.seq - Primate sequence entries, part 186.
4084. gbpri187.seq - Primate sequence entries, part 187.
4085. gbpri188.seq - Primate sequence entries, part 188.
4086. gbpri189.seq - Primate sequence entries, part 189.
4087. gbpri19.seq - Primate sequence entries, part 19.
4088. gbpri190.seq - Primate sequence entries, part 190.
4089. gbpri191.seq - Primate sequence entries, part 191.
4090. gbpri192.seq - Primate sequence entries, part 192.
4091. gbpri193.seq - Primate sequence entries, part 193.
4092. gbpri194.seq - Primate sequence entries, part 194.
4093. gbpri195.seq - Primate sequence entries, part 195.
4094. gbpri196.seq - Primate sequence entries, part 196.
4095. gbpri197.seq - Primate sequence entries, part 197.
4096. gbpri198.seq - Primate sequence entries, part 198.
4097. gbpri199.seq - Primate sequence entries, part 199.
4098. gbpri2.seq - Primate sequence entries, part 2.
4099. gbpri20.seq - Primate sequence entries, part 20.
4100. gbpri200.seq - Primate sequence entries, part 200.
4101. gbpri201.seq - Primate sequence entries, part 201.
4102. gbpri202.seq - Primate sequence entries, part 202.
4103. gbpri203.seq - Primate sequence entries, part 203.
4104. gbpri204.seq - Primate sequence entries, part 204.
4105. gbpri205.seq - Primate sequence entries, part 205.
4106. gbpri206.seq - Primate sequence entries, part 206.
4107. gbpri207.seq - Primate sequence entries, part 207.
4108. gbpri208.seq - Primate sequence entries, part 208.
4109. gbpri209.seq - Primate sequence entries, part 209.
4110. gbpri21.seq - Primate sequence entries, part 21.
4111. gbpri210.seq - Primate sequence entries, part 210.
4112. gbpri211.seq - Primate sequence entries, part 211.
4113. gbpri212.seq - Primate sequence entries, part 212.
4114. gbpri213.seq - Primate sequence entries, part 213.
4115. gbpri214.seq - Primate sequence entries, part 214.
4116. gbpri215.seq - Primate sequence entries, part 215.
4117. gbpri216.seq - Primate sequence entries, part 216.
4118. gbpri217.seq - Primate sequence entries, part 217.
4119. gbpri218.seq - Primate sequence entries, part 218.
4120. gbpri219.seq - Primate sequence entries, part 219.
4121. gbpri22.seq - Primate sequence entries, part 22.
4122. gbpri220.seq - Primate sequence entries, part 220.
4123. gbpri221.seq - Primate sequence entries, part 221.
4124. gbpri222.seq - Primate sequence entries, part 222.
4125. gbpri223.seq - Primate sequence entries, part 223.
4126. gbpri224.seq - Primate sequence entries, part 224.
4127. gbpri225.seq - Primate sequence entries, part 225.
4128. gbpri226.seq - Primate sequence entries, part 226.
4129. gbpri227.seq - Primate sequence entries, part 227.
4130. gbpri228.seq - Primate sequence entries, part 228.
4131. gbpri229.seq - Primate sequence entries, part 229.
4132. gbpri23.seq - Primate sequence entries, part 23.
4133. gbpri230.seq - Primate sequence entries, part 230.
4134. gbpri231.seq - Primate sequence entries, part 231.
4135. gbpri232.seq - Primate sequence entries, part 232.
4136. gbpri233.seq - Primate sequence entries, part 233.
4137. gbpri234.seq - Primate sequence entries, part 234.
4138. gbpri235.seq - Primate sequence entries, part 235.
4139. gbpri236.seq - Primate sequence entries, part 236.
4140. gbpri237.seq - Primate sequence entries, part 237.
4141. gbpri238.seq - Primate sequence entries, part 238.
4142. gbpri239.seq - Primate sequence entries, part 239.
4143. gbpri24.seq - Primate sequence entries, part 24.
4144. gbpri240.seq - Primate sequence entries, part 240.
4145. gbpri241.seq - Primate sequence entries, part 241.
4146. gbpri242.seq - Primate sequence entries, part 242.
4147. gbpri243.seq - Primate sequence entries, part 243.
4148. gbpri244.seq - Primate sequence entries, part 244.
4149. gbpri245.seq - Primate sequence entries, part 245.
4150. gbpri246.seq - Primate sequence entries, part 246.
4151. gbpri247.seq - Primate sequence entries, part 247.
4152. gbpri248.seq - Primate sequence entries, part 248.
4153. gbpri249.seq - Primate sequence entries, part 249.
4154. gbpri25.seq - Primate sequence entries, part 25.
4155. gbpri250.seq - Primate sequence entries, part 250.
4156. gbpri251.seq - Primate sequence entries, part 251.
4157. gbpri252.seq - Primate sequence entries, part 252.
4158. gbpri253.seq - Primate sequence entries, part 253.
4159. gbpri254.seq - Primate sequence entries, part 254.
4160. gbpri255.seq - Primate sequence entries, part 255.
4161. gbpri256.seq - Primate sequence entries, part 256.
4162. gbpri257.seq - Primate sequence entries, part 257.
4163. gbpri258.seq - Primate sequence entries, part 258.
4164. gbpri259.seq - Primate sequence entries, part 259.
4165. gbpri26.seq - Primate sequence entries, part 26.
4166. gbpri260.seq - Primate sequence entries, part 260.
4167. gbpri261.seq - Primate sequence entries, part 261.
4168. gbpri262.seq - Primate sequence entries, part 262.
4169. gbpri263.seq - Primate sequence entries, part 263.
4170. gbpri264.seq - Primate sequence entries, part 264.
4171. gbpri265.seq - Primate sequence entries, part 265.
4172. gbpri266.seq - Primate sequence entries, part 266.
4173. gbpri267.seq - Primate sequence entries, part 267.
4174. gbpri268.seq - Primate sequence entries, part 268.
4175. gbpri269.seq - Primate sequence entries, part 269.
4176. gbpri27.seq - Primate sequence entries, part 27.
4177. gbpri270.seq - Primate sequence entries, part 270.
4178. gbpri271.seq - Primate sequence entries, part 271.
4179. gbpri272.seq - Primate sequence entries, part 272.
4180. gbpri273.seq - Primate sequence entries, part 273.
4181. gbpri274.seq - Primate sequence entries, part 274.
4182. gbpri275.seq - Primate sequence entries, part 275.
4183. gbpri276.seq - Primate sequence entries, part 276.
4184. gbpri277.seq - Primate sequence entries, part 277.
4185. gbpri278.seq - Primate sequence entries, part 278.
4186. gbpri279.seq - Primate sequence entries, part 279.
4187. gbpri28.seq - Primate sequence entries, part 28.
4188. gbpri280.seq - Primate sequence entries, part 280.
4189. gbpri281.seq - Primate sequence entries, part 281.
4190. gbpri282.seq - Primate sequence entries, part 282.
4191. gbpri283.seq - Primate sequence entries, part 283.
4192. gbpri284.seq - Primate sequence entries, part 284.
4193. gbpri285.seq - Primate sequence entries, part 285.
4194. gbpri286.seq - Primate sequence entries, part 286.
4195. gbpri287.seq - Primate sequence entries, part 287.
4196. gbpri288.seq - Primate sequence entries, part 288.
4197. gbpri289.seq - Primate sequence entries, part 289.
4198. gbpri29.seq - Primate sequence entries, part 29.
4199. gbpri290.seq - Primate sequence entries, part 290.
4200. gbpri291.seq - Primate sequence entries, part 291.
4201. gbpri292.seq - Primate sequence entries, part 292.
4202. gbpri293.seq - Primate sequence entries, part 293.
4203. gbpri294.seq - Primate sequence entries, part 294.
4204. gbpri295.seq - Primate sequence entries, part 295.
4205. gbpri296.seq - Primate sequence entries, part 296.
4206. gbpri297.seq - Primate sequence entries, part 297.
4207. gbpri298.seq - Primate sequence entries, part 298.
4208. gbpri299.seq - Primate sequence entries, part 299.
4209. gbpri3.seq - Primate sequence entries, part 3.
4210. gbpri30.seq - Primate sequence entries, part 30.
4211. gbpri300.seq - Primate sequence entries, part 300.
4212. gbpri301.seq - Primate sequence entries, part 301.
4213. gbpri302.seq - Primate sequence entries, part 302.
4214. gbpri303.seq - Primate sequence entries, part 303.
4215. gbpri304.seq - Primate sequence entries, part 304.
4216. gbpri305.seq - Primate sequence entries, part 305.
4217. gbpri306.seq - Primate sequence entries, part 306.
4218. gbpri307.seq - Primate sequence entries, part 307.
4219. gbpri308.seq - Primate sequence entries, part 308.
4220. gbpri309.seq - Primate sequence entries, part 309.
4221. gbpri31.seq - Primate sequence entries, part 31.
4222. gbpri310.seq - Primate sequence entries, part 310.
4223. gbpri311.seq - Primate sequence entries, part 311.
4224. gbpri312.seq - Primate sequence entries, part 312.
4225. gbpri313.seq - Primate sequence entries, part 313.
4226. gbpri314.seq - Primate sequence entries, part 314.
4227. gbpri315.seq - Primate sequence entries, part 315.
4228. gbpri316.seq - Primate sequence entries, part 316.
4229. gbpri317.seq - Primate sequence entries, part 317.
4230. gbpri318.seq - Primate sequence entries, part 318.
4231. gbpri319.seq - Primate sequence entries, part 319.
4232. gbpri32.seq - Primate sequence entries, part 32.
4233. gbpri320.seq - Primate sequence entries, part 320.
4234. gbpri321.seq - Primate sequence entries, part 321.
4235. gbpri322.seq - Primate sequence entries, part 322.
4236. gbpri323.seq - Primate sequence entries, part 323.
4237. gbpri324.seq - Primate sequence entries, part 324.
4238. gbpri325.seq - Primate sequence entries, part 325.
4239. gbpri326.seq - Primate sequence entries, part 326.
4240. gbpri327.seq - Primate sequence entries, part 327.
4241. gbpri328.seq - Primate sequence entries, part 328.
4242. gbpri329.seq - Primate sequence entries, part 329.
4243. gbpri33.seq - Primate sequence entries, part 33.
4244. gbpri330.seq - Primate sequence entries, part 330.
4245. gbpri331.seq - Primate sequence entries, part 331.
4246. gbpri332.seq - Primate sequence entries, part 332.
4247. gbpri333.seq - Primate sequence entries, part 333.
4248. gbpri334.seq - Primate sequence entries, part 334.
4249. gbpri335.seq - Primate sequence entries, part 335.
4250. gbpri336.seq - Primate sequence entries, part 336.
4251. gbpri337.seq - Primate sequence entries, part 337.
4252. gbpri338.seq - Primate sequence entries, part 338.
4253. gbpri339.seq - Primate sequence entries, part 339.
4254. gbpri34.seq - Primate sequence entries, part 34.
4255. gbpri340.seq - Primate sequence entries, part 340.
4256. gbpri341.seq - Primate sequence entries, part 341.
4257. gbpri342.seq - Primate sequence entries, part 342.
4258. gbpri343.seq - Primate sequence entries, part 343.
4259. gbpri344.seq - Primate sequence entries, part 344.
4260. gbpri345.seq - Primate sequence entries, part 345.
4261. gbpri346.seq - Primate sequence entries, part 346.
4262. gbpri347.seq - Primate sequence entries, part 347.
4263. gbpri348.seq - Primate sequence entries, part 348.
4264. gbpri349.seq - Primate sequence entries, part 349.
4265. gbpri35.seq - Primate sequence entries, part 35.
4266. gbpri350.seq - Primate sequence entries, part 350.
4267. gbpri351.seq - Primate sequence entries, part 351.
4268. gbpri352.seq - Primate sequence entries, part 352.
4269. gbpri353.seq - Primate sequence entries, part 353.
4270. gbpri354.seq - Primate sequence entries, part 354.
4271. gbpri355.seq - Primate sequence entries, part 355.
4272. gbpri356.seq - Primate sequence entries, part 356.
4273. gbpri357.seq - Primate sequence entries, part 357.
4274. gbpri358.seq - Primate sequence entries, part 358.
4275. gbpri359.seq - Primate sequence entries, part 359.
4276. gbpri36.seq - Primate sequence entries, part 36.
4277. gbpri360.seq - Primate sequence entries, part 360.
4278. gbpri361.seq - Primate sequence entries, part 361.
4279. gbpri362.seq - Primate sequence entries, part 362.
4280. gbpri363.seq - Primate sequence entries, part 363.
4281. gbpri364.seq - Primate sequence entries, part 364.
4282. gbpri365.seq - Primate sequence entries, part 365.
4283. gbpri366.seq - Primate sequence entries, part 366.
4284. gbpri367.seq - Primate sequence entries, part 367.
4285. gbpri368.seq - Primate sequence entries, part 368.
4286. gbpri369.seq - Primate sequence entries, part 369.
4287. gbpri37.seq - Primate sequence entries, part 37.
4288. gbpri370.seq - Primate sequence entries, part 370.
4289. gbpri371.seq - Primate sequence entries, part 371.
4290. gbpri372.seq - Primate sequence entries, part 372.
4291. gbpri373.seq - Primate sequence entries, part 373.
4292. gbpri374.seq - Primate sequence entries, part 374.
4293. gbpri375.seq - Primate sequence entries, part 375.
4294. gbpri376.seq - Primate sequence entries, part 376.
4295. gbpri377.seq - Primate sequence entries, part 377.
4296. gbpri378.seq - Primate sequence entries, part 378.
4297. gbpri379.seq - Primate sequence entries, part 379.
4298. gbpri38.seq - Primate sequence entries, part 38.
4299. gbpri380.seq - Primate sequence entries, part 380.
4300. gbpri381.seq - Primate sequence entries, part 381.
4301. gbpri382.seq - Primate sequence entries, part 382.
4302. gbpri383.seq - Primate sequence entries, part 383.
4303. gbpri384.seq - Primate sequence entries, part 384.
4304. gbpri385.seq - Primate sequence entries, part 385.
4305. gbpri386.seq - Primate sequence entries, part 386.
4306. gbpri387.seq - Primate sequence entries, part 387.
4307. gbpri388.seq - Primate sequence entries, part 388.
4308. gbpri389.seq - Primate sequence entries, part 389.
4309. gbpri39.seq - Primate sequence entries, part 39.
4310. gbpri390.seq - Primate sequence entries, part 390.
4311. gbpri391.seq - Primate sequence entries, part 391.
4312. gbpri392.seq - Primate sequence entries, part 392.
4313. gbpri393.seq - Primate sequence entries, part 393.
4314. gbpri394.seq - Primate sequence entries, part 394.
4315. gbpri395.seq - Primate sequence entries, part 395.
4316. gbpri396.seq - Primate sequence entries, part 396.
4317. gbpri397.seq - Primate sequence entries, part 397.
4318. gbpri398.seq - Primate sequence entries, part 398.
4319. gbpri399.seq - Primate sequence entries, part 399.
4320. gbpri4.seq - Primate sequence entries, part 4.
4321. gbpri40.seq - Primate sequence entries, part 40.
4322. gbpri400.seq - Primate sequence entries, part 400.
4323. gbpri401.seq - Primate sequence entries, part 401.
4324. gbpri402.seq - Primate sequence entries, part 402.
4325. gbpri403.seq - Primate sequence entries, part 403.
4326. gbpri404.seq - Primate sequence entries, part 404.
4327. gbpri405.seq - Primate sequence entries, part 405.
4328. gbpri406.seq - Primate sequence entries, part 406.
4329. gbpri407.seq - Primate sequence entries, part 407.
4330. gbpri408.seq - Primate sequence entries, part 408.
4331. gbpri409.seq - Primate sequence entries, part 409.
4332. gbpri41.seq - Primate sequence entries, part 41.
4333. gbpri410.seq - Primate sequence entries, part 410.
4334. gbpri411.seq - Primate sequence entries, part 411.
4335. gbpri412.seq - Primate sequence entries, part 412.
4336. gbpri413.seq - Primate sequence entries, part 413.
4337. gbpri414.seq - Primate sequence entries, part 414.
4338. gbpri415.seq - Primate sequence entries, part 415.
4339. gbpri416.seq - Primate sequence entries, part 416.
4340. gbpri417.seq - Primate sequence entries, part 417.
4341. gbpri418.seq - Primate sequence entries, part 418.
4342. gbpri419.seq - Primate sequence entries, part 419.
4343. gbpri42.seq - Primate sequence entries, part 42.
4344. gbpri420.seq - Primate sequence entries, part 420.
4345. gbpri421.seq - Primate sequence entries, part 421.
4346. gbpri422.seq - Primate sequence entries, part 422.
4347. gbpri423.seq - Primate sequence entries, part 423.
4348. gbpri424.seq - Primate sequence entries, part 424.
4349. gbpri425.seq - Primate sequence entries, part 425.
4350. gbpri426.seq - Primate sequence entries, part 426.
4351. gbpri427.seq - Primate sequence entries, part 427.
4352. gbpri428.seq - Primate sequence entries, part 428.
4353. gbpri429.seq - Primate sequence entries, part 429.
4354. gbpri43.seq - Primate sequence entries, part 43.
4355. gbpri430.seq - Primate sequence entries, part 430.
4356. gbpri431.seq - Primate sequence entries, part 431.
4357. gbpri432.seq - Primate sequence entries, part 432.
4358. gbpri433.seq - Primate sequence entries, part 433.
4359. gbpri434.seq - Primate sequence entries, part 434.
4360. gbpri435.seq - Primate sequence entries, part 435.
4361. gbpri436.seq - Primate sequence entries, part 436.
4362. gbpri437.seq - Primate sequence entries, part 437.
4363. gbpri438.seq - Primate sequence entries, part 438.
4364. gbpri439.seq - Primate sequence entries, part 439.
4365. gbpri44.seq - Primate sequence entries, part 44.
4366. gbpri440.seq - Primate sequence entries, part 440.
4367. gbpri441.seq - Primate sequence entries, part 441.
4368. gbpri442.seq - Primate sequence entries, part 442.
4369. gbpri443.seq - Primate sequence entries, part 443.
4370. gbpri444.seq - Primate sequence entries, part 444.
4371. gbpri445.seq - Primate sequence entries, part 445.
4372. gbpri446.seq - Primate sequence entries, part 446.
4373. gbpri447.seq - Primate sequence entries, part 447.
4374. gbpri448.seq - Primate sequence entries, part 448.
4375. gbpri449.seq - Primate sequence entries, part 449.
4376. gbpri45.seq - Primate sequence entries, part 45.
4377. gbpri450.seq - Primate sequence entries, part 450.
4378. gbpri451.seq - Primate sequence entries, part 451.
4379. gbpri452.seq - Primate sequence entries, part 452.
4380. gbpri453.seq - Primate sequence entries, part 453.
4381. gbpri454.seq - Primate sequence entries, part 454.
4382. gbpri455.seq - Primate sequence entries, part 455.
4383. gbpri456.seq - Primate sequence entries, part 456.
4384. gbpri457.seq - Primate sequence entries, part 457.
4385. gbpri458.seq - Primate sequence entries, part 458.
4386. gbpri459.seq - Primate sequence entries, part 459.
4387. gbpri46.seq - Primate sequence entries, part 46.
4388. gbpri460.seq - Primate sequence entries, part 460.
4389. gbpri461.seq - Primate sequence entries, part 461.
4390. gbpri462.seq - Primate sequence entries, part 462.
4391. gbpri463.seq - Primate sequence entries, part 463.
4392. gbpri464.seq - Primate sequence entries, part 464.
4393. gbpri465.seq - Primate sequence entries, part 465.
4394. gbpri466.seq - Primate sequence entries, part 466.
4395. gbpri467.seq - Primate sequence entries, part 467.
4396. gbpri468.seq - Primate sequence entries, part 468.
4397. gbpri469.seq - Primate sequence entries, part 469.
4398. gbpri47.seq - Primate sequence entries, part 47.
4399. gbpri470.seq - Primate sequence entries, part 470.
4400. gbpri471.seq - Primate sequence entries, part 471.
4401. gbpri472.seq - Primate sequence entries, part 472.
4402. gbpri473.seq - Primate sequence entries, part 473.
4403. gbpri474.seq - Primate sequence entries, part 474.
4404. gbpri475.seq - Primate sequence entries, part 475.
4405. gbpri476.seq - Primate sequence entries, part 476.
4406. gbpri477.seq - Primate sequence entries, part 477.
4407. gbpri478.seq - Primate sequence entries, part 478.
4408. gbpri479.seq - Primate sequence entries, part 479.
4409. gbpri48.seq - Primate sequence entries, part 48.
4410. gbpri480.seq - Primate sequence entries, part 480.
4411. gbpri481.seq - Primate sequence entries, part 481.
4412. gbpri482.seq - Primate sequence entries, part 482.
4413. gbpri483.seq - Primate sequence entries, part 483.
4414. gbpri484.seq - Primate sequence entries, part 484.
4415. gbpri485.seq - Primate sequence entries, part 485.
4416. gbpri486.seq - Primate sequence entries, part 486.
4417. gbpri487.seq - Primate sequence entries, part 487.
4418. gbpri488.seq - Primate sequence entries, part 488.
4419. gbpri489.seq - Primate sequence entries, part 489.
4420. gbpri49.seq - Primate sequence entries, part 49.
4421. gbpri490.seq - Primate sequence entries, part 490.
4422. gbpri491.seq - Primate sequence entries, part 491.
4423. gbpri492.seq - Primate sequence entries, part 492.
4424. gbpri493.seq - Primate sequence entries, part 493.
4425. gbpri494.seq - Primate sequence entries, part 494.
4426. gbpri495.seq - Primate sequence entries, part 495.
4427. gbpri496.seq - Primate sequence entries, part 496.
4428. gbpri497.seq - Primate sequence entries, part 497.
4429. gbpri498.seq - Primate sequence entries, part 498.
4430. gbpri499.seq - Primate sequence entries, part 499.
4431. gbpri5.seq - Primate sequence entries, part 5.
4432. gbpri50.seq - Primate sequence entries, part 50.
4433. gbpri500.seq - Primate sequence entries, part 500.
4434. gbpri501.seq - Primate sequence entries, part 501.
4435. gbpri502.seq - Primate sequence entries, part 502.
4436. gbpri503.seq - Primate sequence entries, part 503.
4437. gbpri504.seq - Primate sequence entries, part 504.
4438. gbpri505.seq - Primate sequence entries, part 505.
4439. gbpri506.seq - Primate sequence entries, part 506.
4440. gbpri507.seq - Primate sequence entries, part 507.
4441. gbpri508.seq - Primate sequence entries, part 508.
4442. gbpri509.seq - Primate sequence entries, part 509.
4443. gbpri51.seq - Primate sequence entries, part 51.
4444. gbpri510.seq - Primate sequence entries, part 510.
4445. gbpri511.seq - Primate sequence entries, part 511.
4446. gbpri512.seq - Primate sequence entries, part 512.
4447. gbpri513.seq - Primate sequence entries, part 513.
4448. gbpri514.seq - Primate sequence entries, part 514.
4449. gbpri515.seq - Primate sequence entries, part 515.
4450. gbpri516.seq - Primate sequence entries, part 516.
4451. gbpri517.seq - Primate sequence entries, part 517.
4452. gbpri518.seq - Primate sequence entries, part 518.
4453. gbpri519.seq - Primate sequence entries, part 519.
4454. gbpri52.seq - Primate sequence entries, part 52.
4455. gbpri520.seq - Primate sequence entries, part 520.
4456. gbpri521.seq - Primate sequence entries, part 521.
4457. gbpri522.seq - Primate sequence entries, part 522.
4458. gbpri523.seq - Primate sequence entries, part 523.
4459. gbpri524.seq - Primate sequence entries, part 524.
4460. gbpri525.seq - Primate sequence entries, part 525.
4461. gbpri526.seq - Primate sequence entries, part 526.
4462. gbpri527.seq - Primate sequence entries, part 527.
4463. gbpri528.seq - Primate sequence entries, part 528.
4464. gbpri529.seq - Primate sequence entries, part 529.
4465. gbpri53.seq - Primate sequence entries, part 53.
4466. gbpri530.seq - Primate sequence entries, part 530.
4467. gbpri531.seq - Primate sequence entries, part 531.
4468. gbpri532.seq - Primate sequence entries, part 532.
4469. gbpri533.seq - Primate sequence entries, part 533.
4470. gbpri534.seq - Primate sequence entries, part 534.
4471. gbpri535.seq - Primate sequence entries, part 535.
4472. gbpri536.seq - Primate sequence entries, part 536.
4473. gbpri537.seq - Primate sequence entries, part 537.
4474. gbpri538.seq - Primate sequence entries, part 538.
4475. gbpri539.seq - Primate sequence entries, part 539.
4476. gbpri54.seq - Primate sequence entries, part 54.
4477. gbpri540.seq - Primate sequence entries, part 540.
4478. gbpri541.seq - Primate sequence entries, part 541.
4479. gbpri542.seq - Primate sequence entries, part 542.
4480. gbpri543.seq - Primate sequence entries, part 543.
4481. gbpri544.seq - Primate sequence entries, part 544.
4482. gbpri545.seq - Primate sequence entries, part 545.
4483. gbpri546.seq - Primate sequence entries, part 546.
4484. gbpri547.seq - Primate sequence entries, part 547.
4485. gbpri548.seq - Primate sequence entries, part 548.
4486. gbpri549.seq - Primate sequence entries, part 549.
4487. gbpri55.seq - Primate sequence entries, part 55.
4488. gbpri550.seq - Primate sequence entries, part 550.
4489. gbpri551.seq - Primate sequence entries, part 551.
4490. gbpri552.seq - Primate sequence entries, part 552.
4491. gbpri553.seq - Primate sequence entries, part 553.
4492. gbpri554.seq - Primate sequence entries, part 554.
4493. gbpri555.seq - Primate sequence entries, part 555.
4494. gbpri556.seq - Primate sequence entries, part 556.
4495. gbpri557.seq - Primate sequence entries, part 557.
4496. gbpri558.seq - Primate sequence entries, part 558.
4497. gbpri559.seq - Primate sequence entries, part 559.
4498. gbpri56.seq - Primate sequence entries, part 56.
4499. gbpri560.seq - Primate sequence entries, part 560.
4500. gbpri561.seq - Primate sequence entries, part 561.
4501. gbpri562.seq - Primate sequence entries, part 562.
4502. gbpri563.seq - Primate sequence entries, part 563.
4503. gbpri564.seq - Primate sequence entries, part 564.
4504. gbpri565.seq - Primate sequence entries, part 565.
4505. gbpri566.seq - Primate sequence entries, part 566.
4506. gbpri567.seq - Primate sequence entries, part 567.
4507. gbpri568.seq - Primate sequence entries, part 568.
4508. gbpri569.seq - Primate sequence entries, part 569.
4509. gbpri57.seq - Primate sequence entries, part 57.
4510. gbpri570.seq - Primate sequence entries, part 570.
4511. gbpri571.seq - Primate sequence entries, part 571.
4512. gbpri572.seq - Primate sequence entries, part 572.
4513. gbpri573.seq - Primate sequence entries, part 573.
4514. gbpri574.seq - Primate sequence entries, part 574.
4515. gbpri575.seq - Primate sequence entries, part 575.
4516. gbpri576.seq - Primate sequence entries, part 576.
4517. gbpri577.seq - Primate sequence entries, part 577.
4518. gbpri578.seq - Primate sequence entries, part 578.
4519. gbpri579.seq - Primate sequence entries, part 579.
4520. gbpri58.seq - Primate sequence entries, part 58.
4521. gbpri580.seq - Primate sequence entries, part 580.
4522. gbpri581.seq - Primate sequence entries, part 581.
4523. gbpri582.seq - Primate sequence entries, part 582.
4524. gbpri583.seq - Primate sequence entries, part 583.
4525. gbpri584.seq - Primate sequence entries, part 584.
4526. gbpri585.seq - Primate sequence entries, part 585.
4527. gbpri586.seq - Primate sequence entries, part 586.
4528. gbpri587.seq - Primate sequence entries, part 587.
4529. gbpri588.seq - Primate sequence entries, part 588.
4530. gbpri589.seq - Primate sequence entries, part 589.
4531. gbpri59.seq - Primate sequence entries, part 59.
4532. gbpri590.seq - Primate sequence entries, part 590.
4533. gbpri591.seq - Primate sequence entries, part 591.
4534. gbpri592.seq - Primate sequence entries, part 592.
4535. gbpri593.seq - Primate sequence entries, part 593.
4536. gbpri594.seq - Primate sequence entries, part 594.
4537. gbpri595.seq - Primate sequence entries, part 595.
4538. gbpri596.seq - Primate sequence entries, part 596.
4539. gbpri597.seq - Primate sequence entries, part 597.
4540. gbpri598.seq - Primate sequence entries, part 598.
4541. gbpri599.seq - Primate sequence entries, part 599.
4542. gbpri6.seq - Primate sequence entries, part 6.
4543. gbpri60.seq - Primate sequence entries, part 60.
4544. gbpri600.seq - Primate sequence entries, part 600.
4545. gbpri601.seq - Primate sequence entries, part 601.
4546. gbpri602.seq - Primate sequence entries, part 602.
4547. gbpri603.seq - Primate sequence entries, part 603.
4548. gbpri604.seq - Primate sequence entries, part 604.
4549. gbpri605.seq - Primate sequence entries, part 605.
4550. gbpri606.seq - Primate sequence entries, part 606.
4551. gbpri607.seq - Primate sequence entries, part 607.
4552. gbpri608.seq - Primate sequence entries, part 608.
4553. gbpri609.seq - Primate sequence entries, part 609.
4554. gbpri61.seq - Primate sequence entries, part 61.
4555. gbpri610.seq - Primate sequence entries, part 610.
4556. gbpri611.seq - Primate sequence entries, part 611.
4557. gbpri612.seq - Primate sequence entries, part 612.
4558. gbpri613.seq - Primate sequence entries, part 613.
4559. gbpri614.seq - Primate sequence entries, part 614.
4560. gbpri615.seq - Primate sequence entries, part 615.
4561. gbpri616.seq - Primate sequence entries, part 616.
4562. gbpri617.seq - Primate sequence entries, part 617.
4563. gbpri618.seq - Primate sequence entries, part 618.
4564. gbpri619.seq - Primate sequence entries, part 619.
4565. gbpri62.seq - Primate sequence entries, part 62.
4566. gbpri620.seq - Primate sequence entries, part 620.
4567. gbpri621.seq - Primate sequence entries, part 621.
4568. gbpri622.seq - Primate sequence entries, part 622.
4569. gbpri623.seq - Primate sequence entries, part 623.
4570. gbpri624.seq - Primate sequence entries, part 624.
4571. gbpri625.seq - Primate sequence entries, part 625.
4572. gbpri626.seq - Primate sequence entries, part 626.
4573. gbpri627.seq - Primate sequence entries, part 627.
4574. gbpri628.seq - Primate sequence entries, part 628.
4575. gbpri629.seq - Primate sequence entries, part 629.
4576. gbpri63.seq - Primate sequence entries, part 63.
4577. gbpri630.seq - Primate sequence entries, part 630.
4578. gbpri631.seq - Primate sequence entries, part 631.
4579. gbpri632.seq - Primate sequence entries, part 632.
4580. gbpri633.seq - Primate sequence entries, part 633.
4581. gbpri634.seq - Primate sequence entries, part 634.
4582. gbpri635.seq - Primate sequence entries, part 635.
4583. gbpri636.seq - Primate sequence entries, part 636.
4584. gbpri637.seq - Primate sequence entries, part 637.
4585. gbpri638.seq - Primate sequence entries, part 638.
4586. gbpri639.seq - Primate sequence entries, part 639.
4587. gbpri64.seq - Primate sequence entries, part 64.
4588. gbpri640.seq - Primate sequence entries, part 640.
4589. gbpri641.seq - Primate sequence entries, part 641.
4590. gbpri642.seq - Primate sequence entries, part 642.
4591. gbpri643.seq - Primate sequence entries, part 643.
4592. gbpri644.seq - Primate sequence entries, part 644.
4593. gbpri645.seq - Primate sequence entries, part 645.
4594. gbpri646.seq - Primate sequence entries, part 646.
4595. gbpri647.seq - Primate sequence entries, part 647.
4596. gbpri648.seq - Primate sequence entries, part 648.
4597. gbpri649.seq - Primate sequence entries, part 649.
4598. gbpri65.seq - Primate sequence entries, part 65.
4599. gbpri650.seq - Primate sequence entries, part 650.
4600. gbpri651.seq - Primate sequence entries, part 651.
4601. gbpri652.seq - Primate sequence entries, part 652.
4602. gbpri653.seq - Primate sequence entries, part 653.
4603. gbpri654.seq - Primate sequence entries, part 654.
4604. gbpri655.seq - Primate sequence entries, part 655.
4605. gbpri656.seq - Primate sequence entries, part 656.
4606. gbpri657.seq - Primate sequence entries, part 657.
4607. gbpri658.seq - Primate sequence entries, part 658.
4608. gbpri659.seq - Primate sequence entries, part 659.
4609. gbpri66.seq - Primate sequence entries, part 66.
4610. gbpri660.seq - Primate sequence entries, part 660.
4611. gbpri661.seq - Primate sequence entries, part 661.
4612. gbpri662.seq - Primate sequence entries, part 662.
4613. gbpri663.seq - Primate sequence entries, part 663.
4614. gbpri664.seq - Primate sequence entries, part 664.
4615. gbpri665.seq - Primate sequence entries, part 665.
4616. gbpri666.seq - Primate sequence entries, part 666.
4617. gbpri667.seq - Primate sequence entries, part 667.
4618. gbpri668.seq - Primate sequence entries, part 668.
4619. gbpri669.seq - Primate sequence entries, part 669.
4620. gbpri67.seq - Primate sequence entries, part 67.
4621. gbpri670.seq - Primate sequence entries, part 670.
4622. gbpri671.seq - Primate sequence entries, part 671.
4623. gbpri672.seq - Primate sequence entries, part 672.
4624. gbpri673.seq - Primate sequence entries, part 673.
4625. gbpri674.seq - Primate sequence entries, part 674.
4626. gbpri675.seq - Primate sequence entries, part 675.
4627. gbpri676.seq - Primate sequence entries, part 676.
4628. gbpri677.seq - Primate sequence entries, part 677.
4629. gbpri678.seq - Primate sequence entries, part 678.
4630. gbpri68.seq - Primate sequence entries, part 68.
4631. gbpri69.seq - Primate sequence entries, part 69.
4632. gbpri7.seq - Primate sequence entries, part 7.
4633. gbpri70.seq - Primate sequence entries, part 70.
4634. gbpri71.seq - Primate sequence entries, part 71.
4635. gbpri72.seq - Primate sequence entries, part 72.
4636. gbpri73.seq - Primate sequence entries, part 73.
4637. gbpri74.seq - Primate sequence entries, part 74.
4638. gbpri75.seq - Primate sequence entries, part 75.
4639. gbpri76.seq - Primate sequence entries, part 76.
4640. gbpri77.seq - Primate sequence entries, part 77.
4641. gbpri78.seq - Primate sequence entries, part 78.
4642. gbpri79.seq - Primate sequence entries, part 79.
4643. gbpri8.seq - Primate sequence entries, part 8.
4644. gbpri80.seq - Primate sequence entries, part 80.
4645. gbpri81.seq - Primate sequence entries, part 81.
4646. gbpri82.seq - Primate sequence entries, part 82.
4647. gbpri83.seq - Primate sequence entries, part 83.
4648. gbpri84.seq - Primate sequence entries, part 84.
4649. gbpri85.seq - Primate sequence entries, part 85.
4650. gbpri86.seq - Primate sequence entries, part 86.
4651. gbpri87.seq - Primate sequence entries, part 87.
4652. gbpri88.seq - Primate sequence entries, part 88.
4653. gbpri89.seq - Primate sequence entries, part 89.
4654. gbpri9.seq - Primate sequence entries, part 9.
4655. gbpri90.seq - Primate sequence entries, part 90.
4656. gbpri91.seq - Primate sequence entries, part 91.
4657. gbpri92.seq - Primate sequence entries, part 92.
4658. gbpri93.seq - Primate sequence entries, part 93.
4659. gbpri94.seq - Primate sequence entries, part 94.
4660. gbpri95.seq - Primate sequence entries, part 95.
4661. gbpri96.seq - Primate sequence entries, part 96.
4662. gbpri97.seq - Primate sequence entries, part 97.
4663. gbpri98.seq - Primate sequence entries, part 98.
4664. gbpri99.seq - Primate sequence entries, part 99.
4665. gbrel.txt - Release notes (this document).
4666. gbrod1.seq - Rodent sequence entries, part 1.
4667. gbrod10.seq - Rodent sequence entries, part 10.
4668. gbrod100.seq - Rodent sequence entries, part 100.
4669. gbrod101.seq - Rodent sequence entries, part 101.
4670. gbrod102.seq - Rodent sequence entries, part 102.
4671. gbrod103.seq - Rodent sequence entries, part 103.
4672. gbrod104.seq - Rodent sequence entries, part 104.
4673. gbrod105.seq - Rodent sequence entries, part 105.
4674. gbrod106.seq - Rodent sequence entries, part 106.
4675. gbrod107.seq - Rodent sequence entries, part 107.
4676. gbrod108.seq - Rodent sequence entries, part 108.
4677. gbrod109.seq - Rodent sequence entries, part 109.
4678. gbrod11.seq - Rodent sequence entries, part 11.
4679. gbrod110.seq - Rodent sequence entries, part 110.
4680. gbrod111.seq - Rodent sequence entries, part 111.
4681. gbrod112.seq - Rodent sequence entries, part 112.
4682. gbrod113.seq - Rodent sequence entries, part 113.
4683. gbrod114.seq - Rodent sequence entries, part 114.
4684. gbrod115.seq - Rodent sequence entries, part 115.
4685. gbrod12.seq - Rodent sequence entries, part 12.
4686. gbrod13.seq - Rodent sequence entries, part 13.
4687. gbrod14.seq - Rodent sequence entries, part 14.
4688. gbrod15.seq - Rodent sequence entries, part 15.
4689. gbrod16.seq - Rodent sequence entries, part 16.
4690. gbrod17.seq - Rodent sequence entries, part 17.
4691. gbrod18.seq - Rodent sequence entries, part 18.
4692. gbrod19.seq - Rodent sequence entries, part 19.
4693. gbrod2.seq - Rodent sequence entries, part 2.
4694. gbrod20.seq - Rodent sequence entries, part 20.
4695. gbrod21.seq - Rodent sequence entries, part 21.
4696. gbrod22.seq - Rodent sequence entries, part 22.
4697. gbrod23.seq - Rodent sequence entries, part 23.
4698. gbrod24.seq - Rodent sequence entries, part 24.
4699. gbrod25.seq - Rodent sequence entries, part 25.
4700. gbrod26.seq - Rodent sequence entries, part 26.
4701. gbrod27.seq - Rodent sequence entries, part 27.
4702. gbrod28.seq - Rodent sequence entries, part 28.
4703. gbrod29.seq - Rodent sequence entries, part 29.
4704. gbrod3.seq - Rodent sequence entries, part 3.
4705. gbrod30.seq - Rodent sequence entries, part 30.
4706. gbrod31.seq - Rodent sequence entries, part 31.
4707. gbrod32.seq - Rodent sequence entries, part 32.
4708. gbrod33.seq - Rodent sequence entries, part 33.
4709. gbrod34.seq - Rodent sequence entries, part 34.
4710. gbrod35.seq - Rodent sequence entries, part 35.
4711. gbrod36.seq - Rodent sequence entries, part 36.
4712. gbrod37.seq - Rodent sequence entries, part 37.
4713. gbrod38.seq - Rodent sequence entries, part 38.
4714. gbrod39.seq - Rodent sequence entries, part 39.
4715. gbrod4.seq - Rodent sequence entries, part 4.
4716. gbrod40.seq - Rodent sequence entries, part 40.
4717. gbrod41.seq - Rodent sequence entries, part 41.
4718. gbrod42.seq - Rodent sequence entries, part 42.
4719. gbrod43.seq - Rodent sequence entries, part 43.
4720. gbrod44.seq - Rodent sequence entries, part 44.
4721. gbrod45.seq - Rodent sequence entries, part 45.
4722. gbrod46.seq - Rodent sequence entries, part 46.
4723. gbrod47.seq - Rodent sequence entries, part 47.
4724. gbrod48.seq - Rodent sequence entries, part 48.
4725. gbrod49.seq - Rodent sequence entries, part 49.
4726. gbrod5.seq - Rodent sequence entries, part 5.
4727. gbrod50.seq - Rodent sequence entries, part 50.
4728. gbrod51.seq - Rodent sequence entries, part 51.
4729. gbrod52.seq - Rodent sequence entries, part 52.
4730. gbrod53.seq - Rodent sequence entries, part 53.
4731. gbrod54.seq - Rodent sequence entries, part 54.
4732. gbrod55.seq - Rodent sequence entries, part 55.
4733. gbrod56.seq - Rodent sequence entries, part 56.
4734. gbrod57.seq - Rodent sequence entries, part 57.
4735. gbrod58.seq - Rodent sequence entries, part 58.
4736. gbrod59.seq - Rodent sequence entries, part 59.
4737. gbrod6.seq - Rodent sequence entries, part 6.
4738. gbrod60.seq - Rodent sequence entries, part 60.
4739. gbrod61.seq - Rodent sequence entries, part 61.
4740. gbrod62.seq - Rodent sequence entries, part 62.
4741. gbrod63.seq - Rodent sequence entries, part 63.
4742. gbrod64.seq - Rodent sequence entries, part 64.
4743. gbrod65.seq - Rodent sequence entries, part 65.
4744. gbrod66.seq - Rodent sequence entries, part 66.
4745. gbrod67.seq - Rodent sequence entries, part 67.
4746. gbrod68.seq - Rodent sequence entries, part 68.
4747. gbrod69.seq - Rodent sequence entries, part 69.
4748. gbrod7.seq - Rodent sequence entries, part 7.
4749. gbrod70.seq - Rodent sequence entries, part 70.
4750. gbrod71.seq - Rodent sequence entries, part 71.
4751. gbrod72.seq - Rodent sequence entries, part 72.
4752. gbrod73.seq - Rodent sequence entries, part 73.
4753. gbrod74.seq - Rodent sequence entries, part 74.
4754. gbrod75.seq - Rodent sequence entries, part 75.
4755. gbrod76.seq - Rodent sequence entries, part 76.
4756. gbrod77.seq - Rodent sequence entries, part 77.
4757. gbrod78.seq - Rodent sequence entries, part 78.
4758. gbrod79.seq - Rodent sequence entries, part 79.
4759. gbrod8.seq - Rodent sequence entries, part 8.
4760. gbrod80.seq - Rodent sequence entries, part 80.
4761. gbrod81.seq - Rodent sequence entries, part 81.
4762. gbrod82.seq - Rodent sequence entries, part 82.
4763. gbrod83.seq - Rodent sequence entries, part 83.
4764. gbrod84.seq - Rodent sequence entries, part 84.
4765. gbrod85.seq - Rodent sequence entries, part 85.
4766. gbrod86.seq - Rodent sequence entries, part 86.
4767. gbrod87.seq - Rodent sequence entries, part 87.
4768. gbrod88.seq - Rodent sequence entries, part 88.
4769. gbrod89.seq - Rodent sequence entries, part 89.
4770. gbrod9.seq - Rodent sequence entries, part 9.
4771. gbrod90.seq - Rodent sequence entries, part 90.
4772. gbrod91.seq - Rodent sequence entries, part 91.
4773. gbrod92.seq - Rodent sequence entries, part 92.
4774. gbrod93.seq - Rodent sequence entries, part 93.
4775. gbrod94.seq - Rodent sequence entries, part 94.
4776. gbrod95.seq - Rodent sequence entries, part 95.
4777. gbrod96.seq - Rodent sequence entries, part 96.
4778. gbrod97.seq - Rodent sequence entries, part 97.
4779. gbrod98.seq - Rodent sequence entries, part 98.
4780. gbrod99.seq - Rodent sequence entries, part 99.
4781. gbsts1.seq - STS (sequence tagged site) sequence entries, part 1.
4782. gbsts2.seq - STS (sequence tagged site) sequence entries, part 2.
4783. gbsts3.seq - STS (sequence tagged site) sequence entries, part 3.
4784. gbsyn1.seq - Synthetic and chimeric sequence entries, part 1.
4785. gbsyn2.seq - Synthetic and chimeric sequence entries, part 2.
4786. gbsyn3.seq - Synthetic and chimeric sequence entries, part 3.
4787. gbsyn4.seq - Synthetic and chimeric sequence entries, part 4.
4788. gbsyn5.seq - Synthetic and chimeric sequence entries, part 5.
4789. gbsyn6.seq - Synthetic and chimeric sequence entries, part 6.
4790. gbsyn7.seq - Synthetic and chimeric sequence entries, part 7.
4791. gbsyn8.seq - Synthetic and chimeric sequence entries, part 8.
4792. gbsyn9.seq - Synthetic and chimeric sequence entries, part 9.
4793. gbtsa1.seq - TSA (transcriptome shotgun assembly) sequence entries, part 1.
4794. gbtsa10.seq - TSA (transcriptome shotgun assembly) sequence entries, part 10.
4795. gbtsa11.seq - TSA (transcriptome shotgun assembly) sequence entries, part 11.
4796. gbtsa12.seq - TSA (transcriptome shotgun assembly) sequence entries, part 12.
4797. gbtsa13.seq - TSA (transcriptome shotgun assembly) sequence entries, part 13.
4798. gbtsa14.seq - TSA (transcriptome shotgun assembly) sequence entries, part 14.
4799. gbtsa15.seq - TSA (transcriptome shotgun assembly) sequence entries, part 15.
4800. gbtsa16.seq - TSA (transcriptome shotgun assembly) sequence entries, part 16.
4801. gbtsa17.seq - TSA (transcriptome shotgun assembly) sequence entries, part 17.
4802. gbtsa18.seq - TSA (transcriptome shotgun assembly) sequence entries, part 18.
4803. gbtsa19.seq - TSA (transcriptome shotgun assembly) sequence entries, part 19.
4804. gbtsa2.seq - TSA (transcriptome shotgun assembly) sequence entries, part 2.
4805. gbtsa20.seq - TSA (transcriptome shotgun assembly) sequence entries, part 20.
4806. gbtsa21.seq - TSA (transcriptome shotgun assembly) sequence entries, part 21.
4807. gbtsa22.seq - TSA (transcriptome shotgun assembly) sequence entries, part 22.
4808. gbtsa23.seq - TSA (transcriptome shotgun assembly) sequence entries, part 23.
4809. gbtsa24.seq - TSA (transcriptome shotgun assembly) sequence entries, part 24.
4810. gbtsa25.seq - TSA (transcriptome shotgun assembly) sequence entries, part 25.
4811. gbtsa26.seq - TSA (transcriptome shotgun assembly) sequence entries, part 26.
4812. gbtsa27.seq - TSA (transcriptome shotgun assembly) sequence entries, part 27.
4813. gbtsa28.seq - TSA (transcriptome shotgun assembly) sequence entries, part 28.
4814. gbtsa29.seq - TSA (transcriptome shotgun assembly) sequence entries, part 29.
4815. gbtsa3.seq - TSA (transcriptome shotgun assembly) sequence entries, part 3.
4816. gbtsa30.seq - TSA (transcriptome shotgun assembly) sequence entries, part 30.
4817. gbtsa31.seq - TSA (transcriptome shotgun assembly) sequence entries, part 31.
4818. gbtsa32.seq - TSA (transcriptome shotgun assembly) sequence entries, part 32.
4819. gbtsa33.seq - TSA (transcriptome shotgun assembly) sequence entries, part 33.
4820. gbtsa34.seq - TSA (transcriptome shotgun assembly) sequence entries, part 34.
4821. gbtsa35.seq - TSA (transcriptome shotgun assembly) sequence entries, part 35.
4822. gbtsa36.seq - TSA (transcriptome shotgun assembly) sequence entries, part 36.
4823. gbtsa37.seq - TSA (transcriptome shotgun assembly) sequence entries, part 37.
4824. gbtsa4.seq - TSA (transcriptome shotgun assembly) sequence entries, part 4.
4825. gbtsa5.seq - TSA (transcriptome shotgun assembly) sequence entries, part 5.
4826. gbtsa6.seq - TSA (transcriptome shotgun assembly) sequence entries, part 6.
4827. gbtsa7.seq - TSA (transcriptome shotgun assembly) sequence entries, part 7.
4828. gbtsa8.seq - TSA (transcriptome shotgun assembly) sequence entries, part 8.
4829. gbtsa9.seq - TSA (transcriptome shotgun assembly) sequence entries, part 9.
4830. gbuna1.seq - Unannotated sequence entries, part 1.
4831. gbvrl1.seq - Viral sequence entries, part 1.
4832. gbvrl10.seq - Viral sequence entries, part 10.
4833. gbvrl100.seq - Viral sequence entries, part 100.
4834. gbvrl101.seq - Viral sequence entries, part 101.
4835. gbvrl102.seq - Viral sequence entries, part 102.
4836. gbvrl103.seq - Viral sequence entries, part 103.
4837. gbvrl104.seq - Viral sequence entries, part 104.
4838. gbvrl105.seq - Viral sequence entries, part 105.
4839. gbvrl106.seq - Viral sequence entries, part 106.
4840. gbvrl107.seq - Viral sequence entries, part 107.
4841. gbvrl108.seq - Viral sequence entries, part 108.
4842. gbvrl109.seq - Viral sequence entries, part 109.
4843. gbvrl11.seq - Viral sequence entries, part 11.
4844. gbvrl110.seq - Viral sequence entries, part 110.
4845. gbvrl111.seq - Viral sequence entries, part 111.
4846. gbvrl112.seq - Viral sequence entries, part 112.
4847. gbvrl113.seq - Viral sequence entries, part 113.
4848. gbvrl114.seq - Viral sequence entries, part 114.
4849. gbvrl115.seq - Viral sequence entries, part 115.
4850. gbvrl116.seq - Viral sequence entries, part 116.
4851. gbvrl117.seq - Viral sequence entries, part 117.
4852. gbvrl118.seq - Viral sequence entries, part 118.
4853. gbvrl119.seq - Viral sequence entries, part 119.
4854. gbvrl12.seq - Viral sequence entries, part 12.
4855. gbvrl120.seq - Viral sequence entries, part 120.
4856. gbvrl121.seq - Viral sequence entries, part 121.
4857. gbvrl122.seq - Viral sequence entries, part 122.
4858. gbvrl123.seq - Viral sequence entries, part 123.
4859. gbvrl124.seq - Viral sequence entries, part 124.
4860. gbvrl125.seq - Viral sequence entries, part 125.
4861. gbvrl126.seq - Viral sequence entries, part 126.
4862. gbvrl127.seq - Viral sequence entries, part 127.
4863. gbvrl128.seq - Viral sequence entries, part 128.
4864. gbvrl129.seq - Viral sequence entries, part 129.
4865. gbvrl13.seq - Viral sequence entries, part 13.
4866. gbvrl130.seq - Viral sequence entries, part 130.
4867. gbvrl131.seq - Viral sequence entries, part 131.
4868. gbvrl132.seq - Viral sequence entries, part 132.
4869. gbvrl133.seq - Viral sequence entries, part 133.
4870. gbvrl134.seq - Viral sequence entries, part 134.
4871. gbvrl135.seq - Viral sequence entries, part 135.
4872. gbvrl136.seq - Viral sequence entries, part 136.
4873. gbvrl137.seq - Viral sequence entries, part 137.
4874. gbvrl138.seq - Viral sequence entries, part 138.
4875. gbvrl139.seq - Viral sequence entries, part 139.
4876. gbvrl14.seq - Viral sequence entries, part 14.
4877. gbvrl140.seq - Viral sequence entries, part 140.
4878. gbvrl141.seq - Viral sequence entries, part 141.
4879. gbvrl142.seq - Viral sequence entries, part 142.
4880. gbvrl143.seq - Viral sequence entries, part 143.
4881. gbvrl144.seq - Viral sequence entries, part 144.
4882. gbvrl145.seq - Viral sequence entries, part 145.
4883. gbvrl146.seq - Viral sequence entries, part 146.
4884. gbvrl147.seq - Viral sequence entries, part 147.
4885. gbvrl148.seq - Viral sequence entries, part 148.
4886. gbvrl149.seq - Viral sequence entries, part 149.
4887. gbvrl15.seq - Viral sequence entries, part 15.
4888. gbvrl150.seq - Viral sequence entries, part 150.
4889. gbvrl151.seq - Viral sequence entries, part 151.
4890. gbvrl152.seq - Viral sequence entries, part 152.
4891. gbvrl153.seq - Viral sequence entries, part 153.
4892. gbvrl154.seq - Viral sequence entries, part 154.
4893. gbvrl155.seq - Viral sequence entries, part 155.
4894. gbvrl156.seq - Viral sequence entries, part 156.
4895. gbvrl157.seq - Viral sequence entries, part 157.
4896. gbvrl158.seq - Viral sequence entries, part 158.
4897. gbvrl159.seq - Viral sequence entries, part 159.
4898. gbvrl16.seq - Viral sequence entries, part 16.
4899. gbvrl160.seq - Viral sequence entries, part 160.
4900. gbvrl161.seq - Viral sequence entries, part 161.
4901. gbvrl162.seq - Viral sequence entries, part 162.
4902. gbvrl163.seq - Viral sequence entries, part 163.
4903. gbvrl164.seq - Viral sequence entries, part 164.
4904. gbvrl165.seq - Viral sequence entries, part 165.
4905. gbvrl166.seq - Viral sequence entries, part 166.
4906. gbvrl167.seq - Viral sequence entries, part 167.
4907. gbvrl168.seq - Viral sequence entries, part 168.
4908. gbvrl169.seq - Viral sequence entries, part 169.
4909. gbvrl17.seq - Viral sequence entries, part 17.
4910. gbvrl170.seq - Viral sequence entries, part 170.
4911. gbvrl171.seq - Viral sequence entries, part 171.
4912. gbvrl172.seq - Viral sequence entries, part 172.
4913. gbvrl173.seq - Viral sequence entries, part 173.
4914. gbvrl174.seq - Viral sequence entries, part 174.
4915. gbvrl175.seq - Viral sequence entries, part 175.
4916. gbvrl176.seq - Viral sequence entries, part 176.
4917. gbvrl177.seq - Viral sequence entries, part 177.
4918. gbvrl178.seq - Viral sequence entries, part 178.
4919. gbvrl179.seq - Viral sequence entries, part 179.
4920. gbvrl18.seq - Viral sequence entries, part 18.
4921. gbvrl180.seq - Viral sequence entries, part 180.
4922. gbvrl181.seq - Viral sequence entries, part 181.
4923. gbvrl182.seq - Viral sequence entries, part 182.
4924. gbvrl183.seq - Viral sequence entries, part 183.
4925. gbvrl184.seq - Viral sequence entries, part 184.
4926. gbvrl185.seq - Viral sequence entries, part 185.
4927. gbvrl186.seq - Viral sequence entries, part 186.
4928. gbvrl187.seq - Viral sequence entries, part 187.
4929. gbvrl188.seq - Viral sequence entries, part 188.
4930. gbvrl189.seq - Viral sequence entries, part 189.
4931. gbvrl19.seq - Viral sequence entries, part 19.
4932. gbvrl190.seq - Viral sequence entries, part 190.
4933. gbvrl191.seq - Viral sequence entries, part 191.
4934. gbvrl192.seq - Viral sequence entries, part 192.
4935. gbvrl193.seq - Viral sequence entries, part 193.
4936. gbvrl194.seq - Viral sequence entries, part 194.
4937. gbvrl195.seq - Viral sequence entries, part 195.
4938. gbvrl196.seq - Viral sequence entries, part 196.
4939. gbvrl197.seq - Viral sequence entries, part 197.
4940. gbvrl198.seq - Viral sequence entries, part 198.
4941. gbvrl199.seq - Viral sequence entries, part 199.
4942. gbvrl2.seq - Viral sequence entries, part 2.
4943. gbvrl20.seq - Viral sequence entries, part 20.
4944. gbvrl200.seq - Viral sequence entries, part 200.
4945. gbvrl201.seq - Viral sequence entries, part 201.
4946. gbvrl202.seq - Viral sequence entries, part 202.
4947. gbvrl203.seq - Viral sequence entries, part 203.
4948. gbvrl204.seq - Viral sequence entries, part 204.
4949. gbvrl205.seq - Viral sequence entries, part 205.
4950. gbvrl206.seq - Viral sequence entries, part 206.
4951. gbvrl207.seq - Viral sequence entries, part 207.
4952. gbvrl208.seq - Viral sequence entries, part 208.
4953. gbvrl209.seq - Viral sequence entries, part 209.
4954. gbvrl21.seq - Viral sequence entries, part 21.
4955. gbvrl210.seq - Viral sequence entries, part 210.
4956. gbvrl211.seq - Viral sequence entries, part 211.
4957. gbvrl212.seq - Viral sequence entries, part 212.
4958. gbvrl213.seq - Viral sequence entries, part 213.
4959. gbvrl214.seq - Viral sequence entries, part 214.
4960. gbvrl215.seq - Viral sequence entries, part 215.
4961. gbvrl216.seq - Viral sequence entries, part 216.
4962. gbvrl217.seq - Viral sequence entries, part 217.
4963. gbvrl218.seq - Viral sequence entries, part 218.
4964. gbvrl219.seq - Viral sequence entries, part 219.
4965. gbvrl22.seq - Viral sequence entries, part 22.
4966. gbvrl220.seq - Viral sequence entries, part 220.
4967. gbvrl221.seq - Viral sequence entries, part 221.
4968. gbvrl222.seq - Viral sequence entries, part 222.
4969. gbvrl223.seq - Viral sequence entries, part 223.
4970. gbvrl224.seq - Viral sequence entries, part 224.
4971. gbvrl225.seq - Viral sequence entries, part 225.
4972. gbvrl226.seq - Viral sequence entries, part 226.
4973. gbvrl227.seq - Viral sequence entries, part 227.
4974. gbvrl228.seq - Viral sequence entries, part 228.
4975. gbvrl229.seq - Viral sequence entries, part 229.
4976. gbvrl23.seq - Viral sequence entries, part 23.
4977. gbvrl230.seq - Viral sequence entries, part 230.
4978. gbvrl231.seq - Viral sequence entries, part 231.
4979. gbvrl232.seq - Viral sequence entries, part 232.
4980. gbvrl233.seq - Viral sequence entries, part 233.
4981. gbvrl234.seq - Viral sequence entries, part 234.
4982. gbvrl235.seq - Viral sequence entries, part 235.
4983. gbvrl236.seq - Viral sequence entries, part 236.
4984. gbvrl237.seq - Viral sequence entries, part 237.
4985. gbvrl238.seq - Viral sequence entries, part 238.
4986. gbvrl239.seq - Viral sequence entries, part 239.
4987. gbvrl24.seq - Viral sequence entries, part 24.
4988. gbvrl240.seq - Viral sequence entries, part 240.
4989. gbvrl241.seq - Viral sequence entries, part 241.
4990. gbvrl242.seq - Viral sequence entries, part 242.
4991. gbvrl243.seq - Viral sequence entries, part 243.
4992. gbvrl244.seq - Viral sequence entries, part 244.
4993. gbvrl245.seq - Viral sequence entries, part 245.
4994. gbvrl246.seq - Viral sequence entries, part 246.
4995. gbvrl247.seq - Viral sequence entries, part 247.
4996. gbvrl248.seq - Viral sequence entries, part 248.
4997. gbvrl249.seq - Viral sequence entries, part 249.
4998. gbvrl25.seq - Viral sequence entries, part 25.
4999. gbvrl250.seq - Viral sequence entries, part 250.
5000. gbvrl251.seq - Viral sequence entries, part 251.
5001. gbvrl252.seq - Viral sequence entries, part 252.
5002. gbvrl253.seq - Viral sequence entries, part 253.
5003. gbvrl254.seq - Viral sequence entries, part 254.
5004. gbvrl255.seq - Viral sequence entries, part 255.
5005. gbvrl256.seq - Viral sequence entries, part 256.
5006. gbvrl257.seq - Viral sequence entries, part 257.
5007. gbvrl258.seq - Viral sequence entries, part 258.
5008. gbvrl259.seq - Viral sequence entries, part 259.
5009. gbvrl26.seq - Viral sequence entries, part 26.
5010. gbvrl260.seq - Viral sequence entries, part 260.
5011. gbvrl261.seq - Viral sequence entries, part 261.
5012. gbvrl262.seq - Viral sequence entries, part 262.
5013. gbvrl263.seq - Viral sequence entries, part 263.
5014. gbvrl264.seq - Viral sequence entries, part 264.
5015. gbvrl265.seq - Viral sequence entries, part 265.
5016. gbvrl266.seq - Viral sequence entries, part 266.
5017. gbvrl267.seq - Viral sequence entries, part 267.
5018. gbvrl268.seq - Viral sequence entries, part 268.
5019. gbvrl269.seq - Viral sequence entries, part 269.
5020. gbvrl27.seq - Viral sequence entries, part 27.
5021. gbvrl270.seq - Viral sequence entries, part 270.
5022. gbvrl271.seq - Viral sequence entries, part 271.
5023. gbvrl272.seq - Viral sequence entries, part 272.
5024. gbvrl273.seq - Viral sequence entries, part 273.
5025. gbvrl274.seq - Viral sequence entries, part 274.
5026. gbvrl275.seq - Viral sequence entries, part 275.
5027. gbvrl276.seq - Viral sequence entries, part 276.
5028. gbvrl277.seq - Viral sequence entries, part 277.
5029. gbvrl278.seq - Viral sequence entries, part 278.
5030. gbvrl279.seq - Viral sequence entries, part 279.
5031. gbvrl28.seq - Viral sequence entries, part 28.
5032. gbvrl280.seq - Viral sequence entries, part 280.
5033. gbvrl281.seq - Viral sequence entries, part 281.
5034. gbvrl282.seq - Viral sequence entries, part 282.
5035. gbvrl283.seq - Viral sequence entries, part 283.
5036. gbvrl284.seq - Viral sequence entries, part 284.
5037. gbvrl285.seq - Viral sequence entries, part 285.
5038. gbvrl286.seq - Viral sequence entries, part 286.
5039. gbvrl287.seq - Viral sequence entries, part 287.
5040. gbvrl288.seq - Viral sequence entries, part 288.
5041. gbvrl289.seq - Viral sequence entries, part 289.
5042. gbvrl29.seq - Viral sequence entries, part 29.
5043. gbvrl290.seq - Viral sequence entries, part 290.
5044. gbvrl291.seq - Viral sequence entries, part 291.
5045. gbvrl292.seq - Viral sequence entries, part 292.
5046. gbvrl293.seq - Viral sequence entries, part 293.
5047. gbvrl294.seq - Viral sequence entries, part 294.
5048. gbvrl295.seq - Viral sequence entries, part 295.
5049. gbvrl296.seq - Viral sequence entries, part 296.
5050. gbvrl297.seq - Viral sequence entries, part 297.
5051. gbvrl298.seq - Viral sequence entries, part 298.
5052. gbvrl299.seq - Viral sequence entries, part 299.
5053. gbvrl3.seq - Viral sequence entries, part 3.
5054. gbvrl30.seq - Viral sequence entries, part 30.
5055. gbvrl300.seq - Viral sequence entries, part 300.
5056. gbvrl301.seq - Viral sequence entries, part 301.
5057. gbvrl302.seq - Viral sequence entries, part 302.
5058. gbvrl303.seq - Viral sequence entries, part 303.
5059. gbvrl304.seq - Viral sequence entries, part 304.
5060. gbvrl305.seq - Viral sequence entries, part 305.
5061. gbvrl306.seq - Viral sequence entries, part 306.
5062. gbvrl307.seq - Viral sequence entries, part 307.
5063. gbvrl308.seq - Viral sequence entries, part 308.
5064. gbvrl309.seq - Viral sequence entries, part 309.
5065. gbvrl31.seq - Viral sequence entries, part 31.
5066. gbvrl310.seq - Viral sequence entries, part 310.
5067. gbvrl311.seq - Viral sequence entries, part 311.
5068. gbvrl312.seq - Viral sequence entries, part 312.
5069. gbvrl313.seq - Viral sequence entries, part 313.
5070. gbvrl314.seq - Viral sequence entries, part 314.
5071. gbvrl315.seq - Viral sequence entries, part 315.
5072. gbvrl316.seq - Viral sequence entries, part 316.
5073. gbvrl317.seq - Viral sequence entries, part 317.
5074. gbvrl318.seq - Viral sequence entries, part 318.
5075. gbvrl319.seq - Viral sequence entries, part 319.
5076. gbvrl32.seq - Viral sequence entries, part 32.
5077. gbvrl320.seq - Viral sequence entries, part 320.
5078. gbvrl321.seq - Viral sequence entries, part 321.
5079. gbvrl322.seq - Viral sequence entries, part 322.
5080. gbvrl323.seq - Viral sequence entries, part 323.
5081. gbvrl324.seq - Viral sequence entries, part 324.
5082. gbvrl325.seq - Viral sequence entries, part 325.
5083. gbvrl326.seq - Viral sequence entries, part 326.
5084. gbvrl327.seq - Viral sequence entries, part 327.
5085. gbvrl328.seq - Viral sequence entries, part 328.
5086. gbvrl329.seq - Viral sequence entries, part 329.
5087. gbvrl33.seq - Viral sequence entries, part 33.
5088. gbvrl330.seq - Viral sequence entries, part 330.
5089. gbvrl331.seq - Viral sequence entries, part 331.
5090. gbvrl332.seq - Viral sequence entries, part 332.
5091. gbvrl333.seq - Viral sequence entries, part 333.
5092. gbvrl34.seq - Viral sequence entries, part 34.
5093. gbvrl35.seq - Viral sequence entries, part 35.
5094. gbvrl36.seq - Viral sequence entries, part 36.
5095. gbvrl37.seq - Viral sequence entries, part 37.
5096. gbvrl38.seq - Viral sequence entries, part 38.
5097. gbvrl39.seq - Viral sequence entries, part 39.
5098. gbvrl4.seq - Viral sequence entries, part 4.
5099. gbvrl40.seq - Viral sequence entries, part 40.
5100. gbvrl41.seq - Viral sequence entries, part 41.
5101. gbvrl42.seq - Viral sequence entries, part 42.
5102. gbvrl43.seq - Viral sequence entries, part 43.
5103. gbvrl44.seq - Viral sequence entries, part 44.
5104. gbvrl45.seq - Viral sequence entries, part 45.
5105. gbvrl46.seq - Viral sequence entries, part 46.
5106. gbvrl47.seq - Viral sequence entries, part 47.
5107. gbvrl48.seq - Viral sequence entries, part 48.
5108. gbvrl49.seq - Viral sequence entries, part 49.
5109. gbvrl5.seq - Viral sequence entries, part 5.
5110. gbvrl50.seq - Viral sequence entries, part 50.
5111. gbvrl51.seq - Viral sequence entries, part 51.
5112. gbvrl52.seq - Viral sequence entries, part 52.
5113. gbvrl53.seq - Viral sequence entries, part 53.
5114. gbvrl54.seq - Viral sequence entries, part 54.
5115. gbvrl55.seq - Viral sequence entries, part 55.
5116. gbvrl56.seq - Viral sequence entries, part 56.
5117. gbvrl57.seq - Viral sequence entries, part 57.
5118. gbvrl58.seq - Viral sequence entries, part 58.
5119. gbvrl59.seq - Viral sequence entries, part 59.
5120. gbvrl6.seq - Viral sequence entries, part 6.
5121. gbvrl60.seq - Viral sequence entries, part 60.
5122. gbvrl61.seq - Viral sequence entries, part 61.
5123. gbvrl62.seq - Viral sequence entries, part 62.
5124. gbvrl63.seq - Viral sequence entries, part 63.
5125. gbvrl64.seq - Viral sequence entries, part 64.
5126. gbvrl65.seq - Viral sequence entries, part 65.
5127. gbvrl66.seq - Viral sequence entries, part 66.
5128. gbvrl67.seq - Viral sequence entries, part 67.
5129. gbvrl68.seq - Viral sequence entries, part 68.
5130. gbvrl69.seq - Viral sequence entries, part 69.
5131. gbvrl7.seq - Viral sequence entries, part 7.
5132. gbvrl70.seq - Viral sequence entries, part 70.
5133. gbvrl71.seq - Viral sequence entries, part 71.
5134. gbvrl72.seq - Viral sequence entries, part 72.
5135. gbvrl73.seq - Viral sequence entries, part 73.
5136. gbvrl74.seq - Viral sequence entries, part 74.
5137. gbvrl75.seq - Viral sequence entries, part 75.
5138. gbvrl76.seq - Viral sequence entries, part 76.
5139. gbvrl77.seq - Viral sequence entries, part 77.
5140. gbvrl78.seq - Viral sequence entries, part 78.
5141. gbvrl79.seq - Viral sequence entries, part 79.
5142. gbvrl8.seq - Viral sequence entries, part 8.
5143. gbvrl80.seq - Viral sequence entries, part 80.
5144. gbvrl81.seq - Viral sequence entries, part 81.
5145. gbvrl82.seq - Viral sequence entries, part 82.
5146. gbvrl83.seq - Viral sequence entries, part 83.
5147. gbvrl84.seq - Viral sequence entries, part 84.
5148. gbvrl85.seq - Viral sequence entries, part 85.
5149. gbvrl86.seq - Viral sequence entries, part 86.
5150. gbvrl87.seq - Viral sequence entries, part 87.
5151. gbvrl88.seq - Viral sequence entries, part 88.
5152. gbvrl89.seq - Viral sequence entries, part 89.
5153. gbvrl9.seq - Viral sequence entries, part 9.
5154. gbvrl90.seq - Viral sequence entries, part 90.
5155. gbvrl91.seq - Viral sequence entries, part 91.
5156. gbvrl92.seq - Viral sequence entries, part 92.
5157. gbvrl93.seq - Viral sequence entries, part 93.
5158. gbvrl94.seq - Viral sequence entries, part 94.
5159. gbvrl95.seq - Viral sequence entries, part 95.
5160. gbvrl96.seq - Viral sequence entries, part 96.
5161. gbvrl97.seq - Viral sequence entries, part 97.
5162. gbvrl98.seq - Viral sequence entries, part 98.
5163. gbvrl99.seq - Viral sequence entries, part 99.
5164. gbvrt1.seq - Other vertebrate sequence entries, part 1.
5165. gbvrt10.seq - Other vertebrate sequence entries, part 10.
5166. gbvrt100.seq - Other vertebrate sequence entries, part 100.
5167. gbvrt101.seq - Other vertebrate sequence entries, part 101.
5168. gbvrt102.seq - Other vertebrate sequence entries, part 102.
5169. gbvrt103.seq - Other vertebrate sequence entries, part 103.
5170. gbvrt104.seq - Other vertebrate sequence entries, part 104.
5171. gbvrt105.seq - Other vertebrate sequence entries, part 105.
5172. gbvrt106.seq - Other vertebrate sequence entries, part 106.
5173. gbvrt107.seq - Other vertebrate sequence entries, part 107.
5174. gbvrt108.seq - Other vertebrate sequence entries, part 108.
5175. gbvrt109.seq - Other vertebrate sequence entries, part 109.
5176. gbvrt11.seq - Other vertebrate sequence entries, part 11.
5177. gbvrt110.seq - Other vertebrate sequence entries, part 110.
5178. gbvrt111.seq - Other vertebrate sequence entries, part 111.
5179. gbvrt112.seq - Other vertebrate sequence entries, part 112.
5180. gbvrt113.seq - Other vertebrate sequence entries, part 113.
5181. gbvrt114.seq - Other vertebrate sequence entries, part 114.
5182. gbvrt115.seq - Other vertebrate sequence entries, part 115.
5183. gbvrt116.seq - Other vertebrate sequence entries, part 116.
5184. gbvrt117.seq - Other vertebrate sequence entries, part 117.
5185. gbvrt118.seq - Other vertebrate sequence entries, part 118.
5186. gbvrt119.seq - Other vertebrate sequence entries, part 119.
5187. gbvrt12.seq - Other vertebrate sequence entries, part 12.
5188. gbvrt120.seq - Other vertebrate sequence entries, part 120.
5189. gbvrt121.seq - Other vertebrate sequence entries, part 121.
5190. gbvrt122.seq - Other vertebrate sequence entries, part 122.
5191. gbvrt123.seq - Other vertebrate sequence entries, part 123.
5192. gbvrt124.seq - Other vertebrate sequence entries, part 124.
5193. gbvrt125.seq - Other vertebrate sequence entries, part 125.
5194. gbvrt126.seq - Other vertebrate sequence entries, part 126.
5195. gbvrt127.seq - Other vertebrate sequence entries, part 127.
5196. gbvrt128.seq - Other vertebrate sequence entries, part 128.
5197. gbvrt129.seq - Other vertebrate sequence entries, part 129.
5198. gbvrt13.seq - Other vertebrate sequence entries, part 13.
5199. gbvrt130.seq - Other vertebrate sequence entries, part 130.
5200. gbvrt131.seq - Other vertebrate sequence entries, part 131.
5201. gbvrt132.seq - Other vertebrate sequence entries, part 132.
5202. gbvrt133.seq - Other vertebrate sequence entries, part 133.
5203. gbvrt134.seq - Other vertebrate sequence entries, part 134.
5204. gbvrt135.seq - Other vertebrate sequence entries, part 135.
5205. gbvrt136.seq - Other vertebrate sequence entries, part 136.
5206. gbvrt137.seq - Other vertebrate sequence entries, part 137.
5207. gbvrt138.seq - Other vertebrate sequence entries, part 138.
5208. gbvrt139.seq - Other vertebrate sequence entries, part 139.
5209. gbvrt14.seq - Other vertebrate sequence entries, part 14.
5210. gbvrt140.seq - Other vertebrate sequence entries, part 140.
5211. gbvrt141.seq - Other vertebrate sequence entries, part 141.
5212. gbvrt142.seq - Other vertebrate sequence entries, part 142.
5213. gbvrt143.seq - Other vertebrate sequence entries, part 143.
5214. gbvrt144.seq - Other vertebrate sequence entries, part 144.
5215. gbvrt145.seq - Other vertebrate sequence entries, part 145.
5216. gbvrt146.seq - Other vertebrate sequence entries, part 146.
5217. gbvrt147.seq - Other vertebrate sequence entries, part 147.
5218. gbvrt148.seq - Other vertebrate sequence entries, part 148.
5219. gbvrt149.seq - Other vertebrate sequence entries, part 149.
5220. gbvrt15.seq - Other vertebrate sequence entries, part 15.
5221. gbvrt150.seq - Other vertebrate sequence entries, part 150.
5222. gbvrt151.seq - Other vertebrate sequence entries, part 151.
5223. gbvrt152.seq - Other vertebrate sequence entries, part 152.
5224. gbvrt153.seq - Other vertebrate sequence entries, part 153.
5225. gbvrt154.seq - Other vertebrate sequence entries, part 154.
5226. gbvrt155.seq - Other vertebrate sequence entries, part 155.
5227. gbvrt156.seq - Other vertebrate sequence entries, part 156.
5228. gbvrt157.seq - Other vertebrate sequence entries, part 157.
5229. gbvrt158.seq - Other vertebrate sequence entries, part 158.
5230. gbvrt159.seq - Other vertebrate sequence entries, part 159.
5231. gbvrt16.seq - Other vertebrate sequence entries, part 16.
5232. gbvrt160.seq - Other vertebrate sequence entries, part 160.
5233. gbvrt161.seq - Other vertebrate sequence entries, part 161.
5234. gbvrt162.seq - Other vertebrate sequence entries, part 162.
5235. gbvrt163.seq - Other vertebrate sequence entries, part 163.
5236. gbvrt164.seq - Other vertebrate sequence entries, part 164.
5237. gbvrt165.seq - Other vertebrate sequence entries, part 165.
5238. gbvrt166.seq - Other vertebrate sequence entries, part 166.
5239. gbvrt167.seq - Other vertebrate sequence entries, part 167.
5240. gbvrt168.seq - Other vertebrate sequence entries, part 168.
5241. gbvrt169.seq - Other vertebrate sequence entries, part 169.
5242. gbvrt17.seq - Other vertebrate sequence entries, part 17.
5243. gbvrt170.seq - Other vertebrate sequence entries, part 170.
5244. gbvrt171.seq - Other vertebrate sequence entries, part 171.
5245. gbvrt172.seq - Other vertebrate sequence entries, part 172.
5246. gbvrt173.seq - Other vertebrate sequence entries, part 173.
5247. gbvrt174.seq - Other vertebrate sequence entries, part 174.
5248. gbvrt175.seq - Other vertebrate sequence entries, part 175.
5249. gbvrt176.seq - Other vertebrate sequence entries, part 176.
5250. gbvrt177.seq - Other vertebrate sequence entries, part 177.
5251. gbvrt178.seq - Other vertebrate sequence entries, part 178.
5252. gbvrt179.seq - Other vertebrate sequence entries, part 179.
5253. gbvrt18.seq - Other vertebrate sequence entries, part 18.
5254. gbvrt180.seq - Other vertebrate sequence entries, part 180.
5255. gbvrt181.seq - Other vertebrate sequence entries, part 181.
5256. gbvrt182.seq - Other vertebrate sequence entries, part 182.
5257. gbvrt183.seq - Other vertebrate sequence entries, part 183.
5258. gbvrt184.seq - Other vertebrate sequence entries, part 184.
5259. gbvrt185.seq - Other vertebrate sequence entries, part 185.
5260. gbvrt186.seq - Other vertebrate sequence entries, part 186.
5261. gbvrt187.seq - Other vertebrate sequence entries, part 187.
5262. gbvrt188.seq - Other vertebrate sequence entries, part 188.
5263. gbvrt189.seq - Other vertebrate sequence entries, part 189.
5264. gbvrt19.seq - Other vertebrate sequence entries, part 19.
5265. gbvrt190.seq - Other vertebrate sequence entries, part 190.
5266. gbvrt191.seq - Other vertebrate sequence entries, part 191.
5267. gbvrt192.seq - Other vertebrate sequence entries, part 192.
5268. gbvrt193.seq - Other vertebrate sequence entries, part 193.
5269. gbvrt194.seq - Other vertebrate sequence entries, part 194.
5270. gbvrt195.seq - Other vertebrate sequence entries, part 195.
5271. gbvrt196.seq - Other vertebrate sequence entries, part 196.
5272. gbvrt197.seq - Other vertebrate sequence entries, part 197.
5273. gbvrt198.seq - Other vertebrate sequence entries, part 198.
5274. gbvrt199.seq - Other vertebrate sequence entries, part 199.
5275. gbvrt2.seq - Other vertebrate sequence entries, part 2.
5276. gbvrt20.seq - Other vertebrate sequence entries, part 20.
5277. gbvrt200.seq - Other vertebrate sequence entries, part 200.
5278. gbvrt201.seq - Other vertebrate sequence entries, part 201.
5279. gbvrt202.seq - Other vertebrate sequence entries, part 202.
5280. gbvrt203.seq - Other vertebrate sequence entries, part 203.
5281. gbvrt204.seq - Other vertebrate sequence entries, part 204.
5282. gbvrt205.seq - Other vertebrate sequence entries, part 205.
5283. gbvrt206.seq - Other vertebrate sequence entries, part 206.
5284. gbvrt207.seq - Other vertebrate sequence entries, part 207.
5285. gbvrt208.seq - Other vertebrate sequence entries, part 208.
5286. gbvrt209.seq - Other vertebrate sequence entries, part 209.
5287. gbvrt21.seq - Other vertebrate sequence entries, part 21.
5288. gbvrt210.seq - Other vertebrate sequence entries, part 210.
5289. gbvrt211.seq - Other vertebrate sequence entries, part 211.
5290. gbvrt212.seq - Other vertebrate sequence entries, part 212.
5291. gbvrt213.seq - Other vertebrate sequence entries, part 213.
5292. gbvrt214.seq - Other vertebrate sequence entries, part 214.
5293. gbvrt215.seq - Other vertebrate sequence entries, part 215.
5294. gbvrt216.seq - Other vertebrate sequence entries, part 216.
5295. gbvrt217.seq - Other vertebrate sequence entries, part 217.
5296. gbvrt218.seq - Other vertebrate sequence entries, part 218.
5297. gbvrt219.seq - Other vertebrate sequence entries, part 219.
5298. gbvrt22.seq - Other vertebrate sequence entries, part 22.
5299. gbvrt220.seq - Other vertebrate sequence entries, part 220.
5300. gbvrt221.seq - Other vertebrate sequence entries, part 221.
5301. gbvrt222.seq - Other vertebrate sequence entries, part 222.
5302. gbvrt223.seq - Other vertebrate sequence entries, part 223.
5303. gbvrt224.seq - Other vertebrate sequence entries, part 224.
5304. gbvrt225.seq - Other vertebrate sequence entries, part 225.
5305. gbvrt226.seq - Other vertebrate sequence entries, part 226.
5306. gbvrt227.seq - Other vertebrate sequence entries, part 227.
5307. gbvrt228.seq - Other vertebrate sequence entries, part 228.
5308. gbvrt229.seq - Other vertebrate sequence entries, part 229.
5309. gbvrt23.seq - Other vertebrate sequence entries, part 23.
5310. gbvrt230.seq - Other vertebrate sequence entries, part 230.
5311. gbvrt231.seq - Other vertebrate sequence entries, part 231.
5312. gbvrt232.seq - Other vertebrate sequence entries, part 232.
5313. gbvrt233.seq - Other vertebrate sequence entries, part 233.
5314. gbvrt234.seq - Other vertebrate sequence entries, part 234.
5315. gbvrt235.seq - Other vertebrate sequence entries, part 235.
5316. gbvrt236.seq - Other vertebrate sequence entries, part 236.
5317. gbvrt237.seq - Other vertebrate sequence entries, part 237.
5318. gbvrt238.seq - Other vertebrate sequence entries, part 238.
5319. gbvrt239.seq - Other vertebrate sequence entries, part 239.
5320. gbvrt24.seq - Other vertebrate sequence entries, part 24.
5321. gbvrt240.seq - Other vertebrate sequence entries, part 240.
5322. gbvrt241.seq - Other vertebrate sequence entries, part 241.
5323. gbvrt242.seq - Other vertebrate sequence entries, part 242.
5324. gbvrt243.seq - Other vertebrate sequence entries, part 243.
5325. gbvrt244.seq - Other vertebrate sequence entries, part 244.
5326. gbvrt245.seq - Other vertebrate sequence entries, part 245.
5327. gbvrt246.seq - Other vertebrate sequence entries, part 246.
5328. gbvrt247.seq - Other vertebrate sequence entries, part 247.
5329. gbvrt248.seq - Other vertebrate sequence entries, part 248.
5330. gbvrt249.seq - Other vertebrate sequence entries, part 249.
5331. gbvrt25.seq - Other vertebrate sequence entries, part 25.
5332. gbvrt250.seq - Other vertebrate sequence entries, part 250.
5333. gbvrt251.seq - Other vertebrate sequence entries, part 251.
5334. gbvrt252.seq - Other vertebrate sequence entries, part 252.
5335. gbvrt253.seq - Other vertebrate sequence entries, part 253.
5336. gbvrt254.seq - Other vertebrate sequence entries, part 254.
5337. gbvrt255.seq - Other vertebrate sequence entries, part 255.
5338. gbvrt256.seq - Other vertebrate sequence entries, part 256.
5339. gbvrt257.seq - Other vertebrate sequence entries, part 257.
5340. gbvrt258.seq - Other vertebrate sequence entries, part 258.
5341. gbvrt259.seq - Other vertebrate sequence entries, part 259.
5342. gbvrt26.seq - Other vertebrate sequence entries, part 26.
5343. gbvrt260.seq - Other vertebrate sequence entries, part 260.
5344. gbvrt261.seq - Other vertebrate sequence entries, part 261.
5345. gbvrt262.seq - Other vertebrate sequence entries, part 262.
5346. gbvrt263.seq - Other vertebrate sequence entries, part 263.
5347. gbvrt264.seq - Other vertebrate sequence entries, part 264.
5348. gbvrt265.seq - Other vertebrate sequence entries, part 265.
5349. gbvrt266.seq - Other vertebrate sequence entries, part 266.
5350. gbvrt267.seq - Other vertebrate sequence entries, part 267.
5351. gbvrt268.seq - Other vertebrate sequence entries, part 268.
5352. gbvrt269.seq - Other vertebrate sequence entries, part 269.
5353. gbvrt27.seq - Other vertebrate sequence entries, part 27.
5354. gbvrt270.seq - Other vertebrate sequence entries, part 270.
5355. gbvrt271.seq - Other vertebrate sequence entries, part 271.
5356. gbvrt272.seq - Other vertebrate sequence entries, part 272.
5357. gbvrt273.seq - Other vertebrate sequence entries, part 273.
5358. gbvrt274.seq - Other vertebrate sequence entries, part 274.
5359. gbvrt275.seq - Other vertebrate sequence entries, part 275.
5360. gbvrt276.seq - Other vertebrate sequence entries, part 276.
5361. gbvrt277.seq - Other vertebrate sequence entries, part 277.
5362. gbvrt278.seq - Other vertebrate sequence entries, part 278.
5363. gbvrt279.seq - Other vertebrate sequence entries, part 279.
5364. gbvrt28.seq - Other vertebrate sequence entries, part 28.
5365. gbvrt280.seq - Other vertebrate sequence entries, part 280.
5366. gbvrt281.seq - Other vertebrate sequence entries, part 281.
5367. gbvrt282.seq - Other vertebrate sequence entries, part 282.
5368. gbvrt283.seq - Other vertebrate sequence entries, part 283.
5369. gbvrt284.seq - Other vertebrate sequence entries, part 284.
5370. gbvrt285.seq - Other vertebrate sequence entries, part 285.
5371. gbvrt286.seq - Other vertebrate sequence entries, part 286.
5372. gbvrt287.seq - Other vertebrate sequence entries, part 287.
5373. gbvrt288.seq - Other vertebrate sequence entries, part 288.
5374. gbvrt289.seq - Other vertebrate sequence entries, part 289.
5375. gbvrt29.seq - Other vertebrate sequence entries, part 29.
5376. gbvrt290.seq - Other vertebrate sequence entries, part 290.
5377. gbvrt291.seq - Other vertebrate sequence entries, part 291.
5378. gbvrt292.seq - Other vertebrate sequence entries, part 292.
5379. gbvrt293.seq - Other vertebrate sequence entries, part 293.
5380. gbvrt294.seq - Other vertebrate sequence entries, part 294.
5381. gbvrt295.seq - Other vertebrate sequence entries, part 295.
5382. gbvrt296.seq - Other vertebrate sequence entries, part 296.
5383. gbvrt297.seq - Other vertebrate sequence entries, part 297.
5384. gbvrt298.seq - Other vertebrate sequence entries, part 298.
5385. gbvrt299.seq - Other vertebrate sequence entries, part 299.
5386. gbvrt3.seq - Other vertebrate sequence entries, part 3.
5387. gbvrt30.seq - Other vertebrate sequence entries, part 30.
5388. gbvrt300.seq - Other vertebrate sequence entries, part 300.
5389. gbvrt301.seq - Other vertebrate sequence entries, part 301.
5390. gbvrt302.seq - Other vertebrate sequence entries, part 302.
5391. gbvrt303.seq - Other vertebrate sequence entries, part 303.
5392. gbvrt304.seq - Other vertebrate sequence entries, part 304.
5393. gbvrt305.seq - Other vertebrate sequence entries, part 305.
5394. gbvrt306.seq - Other vertebrate sequence entries, part 306.
5395. gbvrt307.seq - Other vertebrate sequence entries, part 307.
5396. gbvrt308.seq - Other vertebrate sequence entries, part 308.
5397. gbvrt309.seq - Other vertebrate sequence entries, part 309.
5398. gbvrt31.seq - Other vertebrate sequence entries, part 31.
5399. gbvrt310.seq - Other vertebrate sequence entries, part 310.
5400. gbvrt311.seq - Other vertebrate sequence entries, part 311.
5401. gbvrt312.seq - Other vertebrate sequence entries, part 312.
5402. gbvrt313.seq - Other vertebrate sequence entries, part 313.
5403. gbvrt314.seq - Other vertebrate sequence entries, part 314.
5404. gbvrt315.seq - Other vertebrate sequence entries, part 315.
5405. gbvrt316.seq - Other vertebrate sequence entries, part 316.
5406. gbvrt317.seq - Other vertebrate sequence entries, part 317.
5407. gbvrt32.seq - Other vertebrate sequence entries, part 32.
5408. gbvrt33.seq - Other vertebrate sequence entries, part 33.
5409. gbvrt34.seq - Other vertebrate sequence entries, part 34.
5410. gbvrt35.seq - Other vertebrate sequence entries, part 35.
5411. gbvrt36.seq - Other vertebrate sequence entries, part 36.
5412. gbvrt37.seq - Other vertebrate sequence entries, part 37.
5413. gbvrt38.seq - Other vertebrate sequence entries, part 38.
5414. gbvrt39.seq - Other vertebrate sequence entries, part 39.
5415. gbvrt4.seq - Other vertebrate sequence entries, part 4.
5416. gbvrt40.seq - Other vertebrate sequence entries, part 40.
5417. gbvrt41.seq - Other vertebrate sequence entries, part 41.
5418. gbvrt42.seq - Other vertebrate sequence entries, part 42.
5419. gbvrt43.seq - Other vertebrate sequence entries, part 43.
5420. gbvrt44.seq - Other vertebrate sequence entries, part 44.
5421. gbvrt45.seq - Other vertebrate sequence entries, part 45.
5422. gbvrt46.seq - Other vertebrate sequence entries, part 46.
5423. gbvrt47.seq - Other vertebrate sequence entries, part 47.
5424. gbvrt48.seq - Other vertebrate sequence entries, part 48.
5425. gbvrt49.seq - Other vertebrate sequence entries, part 49.
5426. gbvrt5.seq - Other vertebrate sequence entries, part 5.
5427. gbvrt50.seq - Other vertebrate sequence entries, part 50.
5428. gbvrt51.seq - Other vertebrate sequence entries, part 51.
5429. gbvrt52.seq - Other vertebrate sequence entries, part 52.
5430. gbvrt53.seq - Other vertebrate sequence entries, part 53.
5431. gbvrt54.seq - Other vertebrate sequence entries, part 54.
5432. gbvrt55.seq - Other vertebrate sequence entries, part 55.
5433. gbvrt56.seq - Other vertebrate sequence entries, part 56.
5434. gbvrt57.seq - Other vertebrate sequence entries, part 57.
5435. gbvrt58.seq - Other vertebrate sequence entries, part 58.
5436. gbvrt59.seq - Other vertebrate sequence entries, part 59.
5437. gbvrt6.seq - Other vertebrate sequence entries, part 6.
5438. gbvrt60.seq - Other vertebrate sequence entries, part 60.
5439. gbvrt61.seq - Other vertebrate sequence entries, part 61.
5440. gbvrt62.seq - Other vertebrate sequence entries, part 62.
5441. gbvrt63.seq - Other vertebrate sequence entries, part 63.
5442. gbvrt64.seq - Other vertebrate sequence entries, part 64.
5443. gbvrt65.seq - Other vertebrate sequence entries, part 65.
5444. gbvrt66.seq - Other vertebrate sequence entries, part 66.
5445. gbvrt67.seq - Other vertebrate sequence entries, part 67.
5446. gbvrt68.seq - Other vertebrate sequence entries, part 68.
5447. gbvrt69.seq - Other vertebrate sequence entries, part 69.
5448. gbvrt7.seq - Other vertebrate sequence entries, part 7.
5449. gbvrt70.seq - Other vertebrate sequence entries, part 70.
5450. gbvrt71.seq - Other vertebrate sequence entries, part 71.
5451. gbvrt72.seq - Other vertebrate sequence entries, part 72.
5452. gbvrt73.seq - Other vertebrate sequence entries, part 73.
5453. gbvrt74.seq - Other vertebrate sequence entries, part 74.
5454. gbvrt75.seq - Other vertebrate sequence entries, part 75.
5455. gbvrt76.seq - Other vertebrate sequence entries, part 76.
5456. gbvrt77.seq - Other vertebrate sequence entries, part 77.
5457. gbvrt78.seq - Other vertebrate sequence entries, part 78.
5458. gbvrt79.seq - Other vertebrate sequence entries, part 79.
5459. gbvrt8.seq - Other vertebrate sequence entries, part 8.
5460. gbvrt80.seq - Other vertebrate sequence entries, part 80.
5461. gbvrt81.seq - Other vertebrate sequence entries, part 81.
5462. gbvrt82.seq - Other vertebrate sequence entries, part 82.
5463. gbvrt83.seq - Other vertebrate sequence entries, part 83.
5464. gbvrt84.seq - Other vertebrate sequence entries, part 84.
5465. gbvrt85.seq - Other vertebrate sequence entries, part 85.
5466. gbvrt86.seq - Other vertebrate sequence entries, part 86.
5467. gbvrt87.seq - Other vertebrate sequence entries, part 87.
5468. gbvrt88.seq - Other vertebrate sequence entries, part 88.
5469. gbvrt89.seq - Other vertebrate sequence entries, part 89.
5470. gbvrt9.seq - Other vertebrate sequence entries, part 9.
5471. gbvrt90.seq - Other vertebrate sequence entries, part 90.
5472. gbvrt91.seq - Other vertebrate sequence entries, part 91.
5473. gbvrt92.seq - Other vertebrate sequence entries, part 92.
5474. gbvrt93.seq - Other vertebrate sequence entries, part 93.
5475. gbvrt94.seq - Other vertebrate sequence entries, part 94.
5476. gbvrt95.seq - Other vertebrate sequence entries, part 95.
5477. gbvrt96.seq - Other vertebrate sequence entries, part 96.
5478. gbvrt97.seq - Other vertebrate sequence entries, part 97.
5479. gbvrt98.seq - Other vertebrate sequence entries, part 98.
5480. gbvrt99.seq - Other vertebrate sequence entries, part 99.
Sequences in the CON division data files (gbcon*.seq) are constructed from
other "traditional" sequence records, and are represented in a unique way.
CON records do not contain any sequence data; instead, they utilize a CONTIG
linetype with a join() statement which describes how component sequences
can be assembled to form the larger constructed sequence. Records in the CON
division do not contribute to GenBank Release statistics (Sections 2.2.6,
2.2.7, and 2.2.8), or to the overall release statistics presented in the header
of these release notes. The GenBank README describes the CON division of GenBank
in more detail:
ftp://ftp.ncbi.nih.gov/genbank/README.genbank
2.2.5 File Sizes
Uncompressed, the Release 264.0 flatfiles require roughly 7452 GB,
including the sequence files and the *.txt files.
The following table contains the approximate sizes of the
individual files in this release. Since minor changes to some of the files
might have occurred after these release notes were written, these sizes should
not be used to determine file integrity; they are provided as an aid to
planning only.
File Size File Name
1499991869 gbbct1.seq
1487790277 gbbct10.seq
1492393028 gbbct100.seq
1488981425 gbbct101.seq
1498668595 gbbct102.seq
1496122177 gbbct103.seq
1498363972 gbbct104.seq
1493888109 gbbct105.seq
1494831054 gbbct106.seq
1494723201 gbbct107.seq
1493870254 gbbct108.seq
1491653729 gbbct109.seq
1497575741 gbbct11.seq
1496432003 gbbct110.seq
1495645843 gbbct111.seq
1496660825 gbbct112.seq
1498767136 gbbct113.seq
1492707250 gbbct114.seq
1490532510 gbbct115.seq
1494346056 gbbct116.seq
1483124661 gbbct117.seq
1499797992 gbbct118.seq
1497221920 gbbct119.seq
1496301198 gbbct12.seq
1498594907 gbbct120.seq
1496393414 gbbct121.seq
1490797251 gbbct122.seq
1499596955 gbbct123.seq
1489935511 gbbct124.seq
1490160313 gbbct125.seq
1493957836 gbbct126.seq
1499601074 gbbct127.seq
1490209379 gbbct128.seq
1494014443 gbbct129.seq
1496572781 gbbct13.seq
1497250448 gbbct130.seq
1499626417 gbbct131.seq
1499409158 gbbct132.seq
1497301210 gbbct133.seq
1495903339 gbbct134.seq
1487372001 gbbct135.seq
1499462153 gbbct136.seq
1495049444 gbbct137.seq
1493799088 gbbct138.seq
1494219674 gbbct139.seq
1497338006 gbbct14.seq
1499269924 gbbct140.seq
1499591958 gbbct141.seq
1495375490 gbbct142.seq
1499161702 gbbct143.seq
1498571880 gbbct144.seq
1493598576 gbbct145.seq
1494420175 gbbct146.seq
1496759297 gbbct147.seq
1498244217 gbbct148.seq
1494304168 gbbct149.seq
1493015264 gbbct15.seq
1497347180 gbbct150.seq
1494746298 gbbct151.seq
1497992849 gbbct152.seq
1499985992 gbbct153.seq
1498438812 gbbct154.seq
1499680408 gbbct155.seq
1499784050 gbbct156.seq
1493822393 gbbct157.seq
1497383802 gbbct158.seq
1496884538 gbbct159.seq
1498158731 gbbct16.seq
1495972925 gbbct160.seq
1498329534 gbbct161.seq
1488046386 gbbct162.seq
1489886301 gbbct163.seq
1492271442 gbbct164.seq
1498407773 gbbct165.seq
1499133848 gbbct166.seq
1493474749 gbbct167.seq
1497454140 gbbct168.seq
1495827549 gbbct169.seq
1497678491 gbbct17.seq
1499950874 gbbct170.seq
1487314866 gbbct171.seq
1491772405 gbbct172.seq
1493771983 gbbct173.seq
1496815309 gbbct174.seq
1489149308 gbbct175.seq
1494711438 gbbct176.seq
1491237097 gbbct177.seq
1498666574 gbbct178.seq
1489977048 gbbct179.seq
1496651012 gbbct18.seq
1499823466 gbbct180.seq
1499274310 gbbct181.seq
1495487313 gbbct182.seq
1498906721 gbbct183.seq
1499740579 gbbct184.seq
1494865519 gbbct185.seq
1489314500 gbbct186.seq
1496885183 gbbct187.seq
1499765257 gbbct188.seq
1489871258 gbbct189.seq
1496055097 gbbct19.seq
1482586254 gbbct190.seq
1490104064 gbbct191.seq
1492006531 gbbct192.seq
1496066878 gbbct193.seq
1488330152 gbbct194.seq
1498886382 gbbct195.seq
1497272352 gbbct196.seq
1498656846 gbbct197.seq
1498457984 gbbct198.seq
1498317027 gbbct199.seq
1497192988 gbbct2.seq
1492331108 gbbct20.seq
1499993760 gbbct200.seq
1499922928 gbbct201.seq
1495566217 gbbct202.seq
1498464173 gbbct203.seq
1499763434 gbbct204.seq
1498716756 gbbct205.seq
1492828956 gbbct206.seq
1492837358 gbbct207.seq
1488126937 gbbct208.seq
1491024839 gbbct209.seq
1493205355 gbbct21.seq
1493981039 gbbct210.seq
1496298897 gbbct211.seq
1494118762 gbbct212.seq
1497056808 gbbct213.seq
1492195329 gbbct214.seq
1498710356 gbbct215.seq
1493127201 gbbct216.seq
1491931058 gbbct217.seq
1489158532 gbbct218.seq
1488964895 gbbct219.seq
1499606791 gbbct22.seq
1499719093 gbbct220.seq
1494545573 gbbct221.seq
1499611291 gbbct222.seq
1494834044 gbbct223.seq
1497964945 gbbct224.seq
1495531699 gbbct225.seq
1497465792 gbbct226.seq
1490431252 gbbct227.seq
1491740014 gbbct228.seq
1491437361 gbbct229.seq
1499939208 gbbct23.seq
1497357751 gbbct230.seq
1497233793 gbbct231.seq
1498771606 gbbct232.seq
1499662223 gbbct233.seq
1490340457 gbbct234.seq
1497741740 gbbct235.seq
1485250835 gbbct236.seq
1493398068 gbbct237.seq
1496853966 gbbct238.seq
1499017471 gbbct239.seq
1493173791 gbbct24.seq
1494293466 gbbct240.seq
1499117462 gbbct241.seq
1499234233 gbbct242.seq
1492022489 gbbct243.seq
1494418348 gbbct244.seq
1489912155 gbbct245.seq
1499971701 gbbct246.seq
1495405022 gbbct247.seq
1494874824 gbbct248.seq
1496658228 gbbct249.seq
1499825401 gbbct25.seq
1496788941 gbbct250.seq
1493626197 gbbct251.seq
1493659816 gbbct252.seq
1494512318 gbbct253.seq
1499975695 gbbct254.seq
1493782517 gbbct255.seq
1491840888 gbbct256.seq
1493973066 gbbct257.seq
1499081830 gbbct258.seq
1498143058 gbbct259.seq
1495850295 gbbct26.seq
1490785411 gbbct260.seq
1491155576 gbbct261.seq
1482170454 gbbct262.seq
1491592395 gbbct263.seq
1486348885 gbbct264.seq
1491471960 gbbct265.seq
1487836285 gbbct266.seq
1495360623 gbbct267.seq
1486694742 gbbct268.seq
1496956717 gbbct269.seq
1493414620 gbbct27.seq
1488524743 gbbct270.seq
1493951291 gbbct271.seq
1495568302 gbbct272.seq
1495010245 gbbct273.seq
1494312123 gbbct274.seq
1496261373 gbbct275.seq
1493503695 gbbct276.seq
1498291403 gbbct277.seq
1494715153 gbbct278.seq
1489444922 gbbct279.seq
1492345629 gbbct28.seq
1495633898 gbbct280.seq
1493443969 gbbct281.seq
1489644094 gbbct282.seq
1488866306 gbbct283.seq
1490292170 gbbct284.seq
1494750657 gbbct285.seq
1492795263 gbbct286.seq
1499115536 gbbct287.seq
1496530120 gbbct288.seq
1492094279 gbbct289.seq
1492990117 gbbct29.seq
1488840704 gbbct290.seq
1495436058 gbbct291.seq
1496510891 gbbct292.seq
1497576331 gbbct293.seq
1494271208 gbbct294.seq
1496947935 gbbct295.seq
1498984653 gbbct296.seq
1493566051 gbbct297.seq
1491310914 gbbct298.seq
1492085325 gbbct299.seq
1490889670 gbbct3.seq
1496433877 gbbct30.seq
1498139285 gbbct300.seq
1494638166 gbbct301.seq
1498690522 gbbct302.seq
1499854615 gbbct303.seq
1498847764 gbbct304.seq
1490649203 gbbct305.seq
1497399134 gbbct306.seq
1492409955 gbbct307.seq
1495695929 gbbct308.seq
1489047698 gbbct309.seq
1497698147 gbbct31.seq
1484341351 gbbct310.seq
1497478820 gbbct311.seq
1497754857 gbbct312.seq
1499982593 gbbct313.seq
1498155647 gbbct314.seq
1490201411 gbbct315.seq
1492923771 gbbct316.seq
1496342014 gbbct317.seq
1490947165 gbbct318.seq
1484074225 gbbct319.seq
1497048963 gbbct32.seq
1488062910 gbbct320.seq
1495767709 gbbct321.seq
1498256914 gbbct322.seq
1498644204 gbbct323.seq
1494418095 gbbct324.seq
1498705000 gbbct325.seq
1494232125 gbbct326.seq
1495693908 gbbct327.seq
1495504064 gbbct328.seq
1493787463 gbbct329.seq
1499368729 gbbct33.seq
1490712979 gbbct330.seq
1495293726 gbbct331.seq
1496584890 gbbct332.seq
1498598047 gbbct333.seq
1496789195 gbbct334.seq
1490701054 gbbct335.seq
1498041883 gbbct336.seq
1495231071 gbbct337.seq
1498425949 gbbct338.seq
1499817770 gbbct339.seq
1495540250 gbbct34.seq
1493143288 gbbct340.seq
1485008741 gbbct341.seq
1496749706 gbbct342.seq
1496228541 gbbct343.seq
1494074950 gbbct344.seq
1497259121 gbbct345.seq
1498816516 gbbct346.seq
1491647493 gbbct347.seq
1492208170 gbbct348.seq
1499303142 gbbct349.seq
1489770768 gbbct35.seq
1490456542 gbbct350.seq
1496634495 gbbct351.seq
1497713161 gbbct352.seq
1491484705 gbbct353.seq
1499898136 gbbct354.seq
1497856384 gbbct355.seq
1488949961 gbbct356.seq
1485639848 gbbct357.seq
1486564453 gbbct358.seq
1489348853 gbbct359.seq
1491278462 gbbct36.seq
1488971100 gbbct360.seq
1498881992 gbbct361.seq
1496508042 gbbct362.seq
1499003000 gbbct363.seq
1493853866 gbbct364.seq
1490654098 gbbct365.seq
1496854427 gbbct366.seq
1491251887 gbbct367.seq
1498643261 gbbct368.seq
1493883510 gbbct369.seq
1491795876 gbbct37.seq
1495682121 gbbct370.seq
1498713095 gbbct371.seq
1497485858 gbbct372.seq
1490969894 gbbct373.seq
1494562426 gbbct374.seq
1497107788 gbbct375.seq
1498838978 gbbct376.seq
1498294675 gbbct377.seq
1497960343 gbbct378.seq
1498030964 gbbct379.seq
1497342266 gbbct38.seq
1499999197 gbbct380.seq
1499512846 gbbct381.seq
1498239711 gbbct382.seq
1499999555 gbbct383.seq
1499999637 gbbct384.seq
1499891832 gbbct385.seq
1494474965 gbbct386.seq
1491282957 gbbct387.seq
1487131972 gbbct388.seq
1496637270 gbbct389.seq
1499428856 gbbct39.seq
1494110580 gbbct390.seq
1497725628 gbbct391.seq
1497851769 gbbct392.seq
1499926507 gbbct393.seq
1498252460 gbbct394.seq
1499054700 gbbct395.seq
1496363173 gbbct396.seq
1499999147 gbbct397.seq
1499998756 gbbct398.seq
1499997243 gbbct399.seq
1482821060 gbbct4.seq
1493993204 gbbct40.seq
1495467826 gbbct400.seq
1494215576 gbbct401.seq
1492367099 gbbct402.seq
1490351662 gbbct403.seq
1495858380 gbbct404.seq
1489055856 gbbct405.seq
1496739126 gbbct406.seq
1499399261 gbbct407.seq
1496989097 gbbct408.seq
1499635011 gbbct409.seq
1493035406 gbbct41.seq
1499572426 gbbct410.seq
1498227185 gbbct411.seq
835421259 gbbct412.seq
1498544557 gbbct42.seq
1495406424 gbbct43.seq
1497798655 gbbct44.seq
1495516754 gbbct45.seq
1490164640 gbbct46.seq
1492307250 gbbct47.seq
1496739531 gbbct48.seq
1499181128 gbbct49.seq
1493306525 gbbct5.seq
1499650241 gbbct50.seq
1490857917 gbbct51.seq
1480039143 gbbct52.seq
1498919191 gbbct53.seq
1495404622 gbbct54.seq
1499600870 gbbct55.seq
1499959044 gbbct56.seq
1490730112 gbbct57.seq
1499517701 gbbct58.seq
1497143354 gbbct59.seq
1491759546 gbbct6.seq
1490343340 gbbct60.seq
1498640025 gbbct61.seq
1496244319 gbbct62.seq
1494818011 gbbct63.seq
1498899266 gbbct64.seq
1493123114 gbbct65.seq
1499701097 gbbct66.seq
1496529632 gbbct67.seq
1497915348 gbbct68.seq
1487616173 gbbct69.seq
1499264087 gbbct7.seq
1493748227 gbbct70.seq
1497470366 gbbct71.seq
1491537866 gbbct72.seq
1499879269 gbbct73.seq
1497956581 gbbct74.seq
1492336447 gbbct75.seq
1489801692 gbbct76.seq
1497044782 gbbct77.seq
1482294688 gbbct78.seq
1497825340 gbbct79.seq
1497380243 gbbct8.seq
1496691236 gbbct80.seq
1494505005 gbbct81.seq
1499918423 gbbct82.seq
1494562034 gbbct83.seq
1498983413 gbbct84.seq
1497144785 gbbct85.seq
1487327500 gbbct86.seq
1494960845 gbbct87.seq
1492018788 gbbct88.seq
1495757348 gbbct89.seq
1496114660 gbbct9.seq
1493352144 gbbct90.seq
1490290949 gbbct91.seq
1494169874 gbbct92.seq
1496289604 gbbct93.seq
1499049044 gbbct94.seq
1493033036 gbbct95.seq
1490985469 gbbct96.seq
1495464053 gbbct97.seq
1488756023 gbbct98.seq
1487689456 gbbct99.seq
579305 gbchg.txt
1499996382 gbcon1.seq
1499997618 gbcon10.seq
1499999887 gbcon11.seq
1499999912 gbcon12.seq
1499997942 gbcon13.seq
1499995775 gbcon14.seq
1499997987 gbcon15.seq
1499997192 gbcon16.seq
1499996790 gbcon17.seq
1499998552 gbcon18.seq
1499996927 gbcon19.seq
1496681544 gbcon2.seq
1499999038 gbcon20.seq
1499995313 gbcon21.seq
1499998381 gbcon22.seq
1499790794 gbcon23.seq
1499986050 gbcon24.seq
1499961101 gbcon25.seq
1499995819 gbcon26.seq
1500000221 gbcon27.seq
1499987365 gbcon28.seq
1499989090 gbcon29.seq
1499718267 gbcon3.seq
1499948457 gbcon30.seq
1499949545 gbcon31.seq
1499998681 gbcon32.seq
1499998800 gbcon33.seq
1499998461 gbcon34.seq
1499999198 gbcon35.seq
1499999164 gbcon36.seq
1499986308 gbcon37.seq
1499994733 gbcon38.seq
1499999935 gbcon39.seq
1495139491 gbcon4.seq
1499998118 gbcon40.seq
1499999093 gbcon41.seq
1499998738 gbcon42.seq
1499994863 gbcon43.seq
1499996641 gbcon44.seq
1499667850 gbcon45.seq
1499949602 gbcon46.seq
1499995208 gbcon47.seq
1499950785 gbcon48.seq
1499930858 gbcon49.seq
1492420851 gbcon5.seq
1499997998 gbcon50.seq
1499998963 gbcon51.seq
1499998144 gbcon52.seq
1499403418 gbcon53.seq
1499997195 gbcon54.seq
1500000248 gbcon55.seq
1499999661 gbcon56.seq
1499999440 gbcon57.seq
1499994242 gbcon58.seq
1500000026 gbcon59.seq
1498712135 gbcon6.seq
1499959306 gbcon60.seq
1499784389 gbcon61.seq
1500000171 gbcon62.seq
1499973621 gbcon63.seq
1499972253 gbcon64.seq
1499997073 gbcon65.seq
1499978307 gbcon66.seq
1499966228 gbcon67.seq
629519678 gbcon68.seq
1499998977 gbcon7.seq
1500000027 gbcon8.seq
1498975272 gbcon9.seq
194637 gbdel.txt
1491107451 gbenv1.seq
1499998897 gbenv10.seq
1499999849 gbenv11.seq
1499996070 gbenv12.seq
1499998364 gbenv13.seq
1499998245 gbenv14.seq
1499998306 gbenv15.seq
1499999676 gbenv16.seq
1500000149 gbenv17.seq
1499997787 gbenv18.seq
1499997979 gbenv19.seq
1494453274 gbenv2.seq
1500000181 gbenv20.seq
1500000084 gbenv21.seq
1499945537 gbenv22.seq
1499998836 gbenv23.seq
1498389651 gbenv24.seq
1496821654 gbenv25.seq
1499250109 gbenv26.seq
775109168 gbenv27.seq
1499379526 gbenv3.seq
1495722937 gbenv4.seq
1499999261 gbenv5.seq
1499998853 gbenv6.seq
1499999787 gbenv7.seq
1500000215 gbenv8.seq
1499997536 gbenv9.seq
1500000091 gbest1.seq
1499998152 gbest10.seq
1499997291 gbest100.seq
1500000103 gbest101.seq
1499999594 gbest102.seq
1499997467 gbest103.seq
1499997840 gbest104.seq
1499998267 gbest105.seq
1499998107 gbest106.seq
1499998396 gbest107.seq
1499997665 gbest108.seq
1499997812 gbest109.seq
1499998524 gbest11.seq
1499999458 gbest110.seq
1499997599 gbest111.seq
1499995462 gbest112.seq
1499996635 gbest113.seq
1499997639 gbest114.seq
1499999694 gbest115.seq
1499998775 gbest116.seq
1499999705 gbest117.seq
1499996132 gbest118.seq
1499999871 gbest119.seq
1499996962 gbest12.seq
1499999870 gbest120.seq
1499998346 gbest121.seq
1499997631 gbest122.seq
1499999170 gbest123.seq
1499998002 gbest124.seq
1499999171 gbest125.seq
1499999005 gbest126.seq
1499997406 gbest127.seq
1499998762 gbest128.seq
1499997198 gbest129.seq
1499995934 gbest13.seq
1500000011 gbest130.seq
1500000242 gbest131.seq
1499997096 gbest132.seq
1499999114 gbest133.seq
1499999011 gbest134.seq
1499996583 gbest135.seq
1499998638 gbest136.seq
1499998571 gbest137.seq
1499999486 gbest138.seq
1499996338 gbest139.seq
1499999082 gbest14.seq
1499996973 gbest140.seq
1499998742 gbest141.seq
1499998432 gbest142.seq
1499996336 gbest143.seq
1499999480 gbest144.seq
1499997085 gbest145.seq
1499997526 gbest146.seq
1499998928 gbest147.seq
1499997720 gbest148.seq
1499997618 gbest149.seq
1499999902 gbest15.seq
1499997613 gbest150.seq
1499998735 gbest151.seq
1500000225 gbest152.seq
1500000190 gbest153.seq
1499999886 gbest154.seq
1499998169 gbest155.seq
1499999642 gbest156.seq
1499997955 gbest157.seq
1499999604 gbest158.seq
1499997851 gbest159.seq
1499999473 gbest16.seq
1500000231 gbest160.seq
1499997940 gbest161.seq
1499999320 gbest162.seq
1499999816 gbest163.seq
513938848 gbest164.seq
1500000122 gbest17.seq
1499999232 gbest18.seq
1499995599 gbest19.seq
1499999413 gbest2.seq
1499999113 gbest20.seq
1499999457 gbest21.seq
1499997156 gbest22.seq
1499999372 gbest23.seq
1499999033 gbest24.seq
1499998834 gbest25.seq
1499996330 gbest26.seq
1499998686 gbest27.seq
1499999420 gbest28.seq
1499999838 gbest29.seq
1499999019 gbest3.seq
1499997491 gbest30.seq
1499999804 gbest31.seq
1499999202 gbest32.seq
1499998884 gbest33.seq
1499999744 gbest34.seq
1499999000 gbest35.seq
1499996804 gbest36.seq
1499998249 gbest37.seq
1499998473 gbest38.seq
1499998765 gbest39.seq
1499999796 gbest4.seq
1499998537 gbest40.seq
1499999479 gbest41.seq
1499998117 gbest42.seq
1499999309 gbest43.seq
1499998093 gbest44.seq
1499999434 gbest45.seq
1499998270 gbest46.seq
1499997718 gbest47.seq
1499997361 gbest48.seq
1499997685 gbest49.seq
1499998133 gbest5.seq
1499999407 gbest50.seq
1499999999 gbest51.seq
1500000147 gbest52.seq
1499998827 gbest53.seq
1499999978 gbest54.seq
1499998804 gbest55.seq
1499999669 gbest56.seq
1499999875 gbest57.seq
1499998623 gbest58.seq
1499998445 gbest59.seq
1499999751 gbest6.seq
1499998581 gbest60.seq
1499998748 gbest61.seq
1499998139 gbest62.seq
1499999233 gbest63.seq
1499997233 gbest64.seq
1500000082 gbest65.seq
1499999290 gbest66.seq
1499999411 gbest67.seq
1499998029 gbest68.seq
1499997478 gbest69.seq
1499999180 gbest7.seq
1499997469 gbest70.seq
1500000141 gbest71.seq
1499999476 gbest72.seq
1499998922 gbest73.seq
1499998459 gbest74.seq
1499997572 gbest75.seq
1499998656 gbest76.seq
1499998675 gbest77.seq
1499997712 gbest78.seq
1499999146 gbest79.seq
1499998463 gbest8.seq
1499999371 gbest80.seq
1499997380 gbest81.seq
1499996686 gbest82.seq
1499998137 gbest83.seq
1499996163 gbest84.seq
1499998782 gbest85.seq
1499999186 gbest86.seq
1500000172 gbest87.seq
1499997522 gbest88.seq
1499996945 gbest89.seq
1500000163 gbest9.seq
1499998776 gbest90.seq
1499997974 gbest91.seq
1499999394 gbest92.seq
1499999492 gbest93.seq
1499997148 gbest94.seq
1499998678 gbest95.seq
1499999178 gbest96.seq
1499997610 gbest97.seq
1499999622 gbest98.seq
1499999008 gbest99.seq
1499999166 gbgss1.seq
1499998511 gbgss10.seq
1499999568 gbgss11.seq
1499998818 gbgss12.seq
1499999883 gbgss13.seq
1499998269 gbgss14.seq
1499998459 gbgss15.seq
1500000237 gbgss16.seq
1499997776 gbgss17.seq
1499998560 gbgss18.seq
1499999998 gbgss19.seq
1499997825 gbgss2.seq
1500000044 gbgss20.seq
1499998104 gbgss21.seq
1499997068 gbgss22.seq
1499999725 gbgss23.seq
1499998729 gbgss24.seq
1499999493 gbgss25.seq
1499998431 gbgss26.seq
1499999661 gbgss27.seq
1499998373 gbgss28.seq
1499997959 gbgss29.seq
1499997910 gbgss3.seq
1499997863 gbgss30.seq
1499998246 gbgss31.seq
1499997366 gbgss32.seq
1499997630 gbgss33.seq
1499998304 gbgss34.seq
1499998850 gbgss35.seq
1499999698 gbgss36.seq
1499998783 gbgss37.seq
1499999628 gbgss38.seq
1499999407 gbgss39.seq
1499999260 gbgss4.seq
1499997914 gbgss40.seq
1500000023 gbgss41.seq
1499998339 gbgss42.seq
1499996728 gbgss43.seq
1499998719 gbgss44.seq
1499999664 gbgss45.seq
1499997017 gbgss46.seq
1499999591 gbgss47.seq
1499999531 gbgss48.seq
1499999400 gbgss49.seq
1500000208 gbgss5.seq
1499999169 gbgss50.seq
1499998816 gbgss51.seq
1499998950 gbgss52.seq
1499998428 gbgss53.seq
1499999313 gbgss54.seq
1499999996 gbgss55.seq
1499997362 gbgss56.seq
1499998142 gbgss57.seq
1500000113 gbgss58.seq
1499997561 gbgss59.seq
1499999706 gbgss6.seq
1499999621 gbgss60.seq
1499997128 gbgss61.seq
1499997510 gbgss62.seq
1499999315 gbgss63.seq
1499999588 gbgss64.seq
1499999592 gbgss65.seq
1500000076 gbgss66.seq
1499999693 gbgss67.seq
1499998782 gbgss68.seq
1499999340 gbgss69.seq
1499997198 gbgss7.seq
1499999957 gbgss70.seq
1499998897 gbgss71.seq
1499997628 gbgss72.seq
1499999926 gbgss73.seq
1499998457 gbgss74.seq
1499999127 gbgss75.seq
1499998738 gbgss76.seq
1500000103 gbgss77.seq
1500000256 gbgss78.seq
430264615 gbgss79.seq
1499997889 gbgss8.seq
1499999134 gbgss9.seq
1499996974 gbhtc1.seq
1499996282 gbhtc2.seq
487233644 gbhtc3.seq
1499970679 gbhtg1.seq
1499829019 gbhtg10.seq
1499872343 gbhtg11.seq
1499884544 gbhtg12.seq
1499861752 gbhtg13.seq
1499897929 gbhtg14.seq
1499835864 gbhtg15.seq
1499690417 gbhtg16.seq
1499782068 gbhtg17.seq
1499852511 gbhtg18.seq
1499876752 gbhtg19.seq
1499830411 gbhtg2.seq
1499945647 gbhtg20.seq
1499944231 gbhtg21.seq
1499853450 gbhtg22.seq
1499789537 gbhtg23.seq
1499904773 gbhtg24.seq
780495549 gbhtg25.seq
1499902231 gbhtg3.seq
1499865254 gbhtg4.seq
1499916236 gbhtg5.seq
1499781411 gbhtg6.seq
1499713912 gbhtg7.seq
1499983844 gbhtg8.seq
1499942611 gbhtg9.seq
1499999562 gbinv1.seq
1490190112 gbinv10.seq
1456781561 gbinv100.seq
1498717006 gbinv1000.se
1487994288 gbinv1001.se
1469308457 gbinv1002.se
1425481446 gbinv1003.se
1480826974 gbinv1004.se
1497284905 gbinv1005.se
1424397420 gbinv1006.se
1497510880 gbinv1007.se
1479959544 gbinv1008.se
1496934524 gbinv1009.se
1487918436 gbinv101.seq
1499563247 gbinv1010.se
1499862687 gbinv1011.se
1476819586 gbinv1012.se
1479922716 gbinv1013.se
1498249855 gbinv1014.se
1474219413 gbinv1015.se
1486564580 gbinv1016.se
1497936217 gbinv1017.se
1482863470 gbinv1018.se
1496481428 gbinv1019.se
1498003367 gbinv102.seq
1495804076 gbinv1020.se
1497704655 gbinv1021.se
1435297230 gbinv1022.se
1480297535 gbinv1023.se
1440549582 gbinv1024.se
1359602883 gbinv1025.se
1426066925 gbinv1026.se
1483939418 gbinv1027.se
1415029251 gbinv1028.se
1493129558 gbinv1029.se
1495227925 gbinv103.seq
1494873086 gbinv1030.se
1409542342 gbinv1031.se
1391285952 gbinv1032.se
1495951990 gbinv1033.se
1482188219 gbinv1034.se
1483778998 gbinv1035.se
1497789572 gbinv1036.se
1499207712 gbinv1037.se
1491922333 gbinv1038.se
1486301700 gbinv1039.se
1498961891 gbinv104.seq
1478759681 gbinv1040.se
1458747397 gbinv1041.se
1484045296 gbinv1042.se
1491144891 gbinv1043.se
1444006372 gbinv1044.se
1374242976 gbinv1045.se
1382612499 gbinv1046.se
1374417242 gbinv1047.se
1467511216 gbinv1048.se
1426475869 gbinv1049.se
1485607287 gbinv105.seq
1479962499 gbinv1050.se
1364248913 gbinv1051.se
1480009668 gbinv1052.se
1488611562 gbinv1053.se
1497586601 gbinv1054.se
1430173354 gbinv1055.se
1497408649 gbinv1056.se
1453700015 gbinv1057.se
1493769524 gbinv1058.se
1484381582 gbinv1059.se
1487531032 gbinv106.seq
1473900470 gbinv1060.se
1495262645 gbinv1061.se
1489066335 gbinv1062.se
1497506226 gbinv1063.se
1490095236 gbinv1064.se
1486653915 gbinv1065.se
1485592782 gbinv1066.se
1412205571 gbinv1067.se
1390832704 gbinv1068.se
1488087580 gbinv1069.se
1489229078 gbinv107.seq
1478129189 gbinv1070.se
1474974122 gbinv1071.se
1491109411 gbinv1072.se
1497459124 gbinv1073.se
1354374983 gbinv1074.se
1469722899 gbinv1075.se
1437653463 gbinv1076.se
1485028925 gbinv1077.se
1486963335 gbinv1078.se
1371059316 gbinv1079.se
1465838102 gbinv108.seq
1409654376 gbinv1080.se
1494928557 gbinv1081.se
996912719 gbinv1082.se
1486297182 gbinv109.seq
1434492519 gbinv11.seq
1499999319 gbinv110.seq
1499998287 gbinv111.seq
1499996548 gbinv112.seq
1499999172 gbinv113.seq
1499999178 gbinv114.seq
1499985921 gbinv115.seq
1500000212 gbinv116.seq
1499848342 gbinv117.seq
1499964754 gbinv118.seq
1499775522 gbinv119.seq
1431807980 gbinv12.seq
1499999408 gbinv120.seq
1499966819 gbinv121.seq
1499627632 gbinv122.seq
1499988035 gbinv123.seq
1499999430 gbinv124.seq
1499999486 gbinv125.seq
1499894870 gbinv126.seq
1500000208 gbinv127.seq
1499998228 gbinv128.seq
1499997002 gbinv129.seq
1454705177 gbinv13.seq
1500000083 gbinv130.seq
1494760767 gbinv131.seq
1329587549 gbinv132.seq
1355115367 gbinv133.seq
1494295272 gbinv134.seq
1490465909 gbinv135.seq
1493396208 gbinv136.seq
1474813193 gbinv137.seq
1362747974 gbinv138.seq
1488380318 gbinv139.seq
1321009833 gbinv14.seq
1493323723 gbinv140.seq
1498364387 gbinv141.seq
1485226037 gbinv142.seq
1486419544 gbinv143.seq
1488565082 gbinv144.seq
1406701259 gbinv145.seq
1491796589 gbinv146.seq
1464476152 gbinv147.seq
1494003799 gbinv148.seq
1398044186 gbinv149.seq
1483462462 gbinv15.seq
1484591726 gbinv150.seq
1490496973 gbinv151.seq
1350074646 gbinv152.seq
1469549148 gbinv153.seq
1489342596 gbinv154.seq
1469565358 gbinv155.seq
1491703639 gbinv156.seq
1497978109 gbinv157.seq
1475443766 gbinv158.seq
1493746945 gbinv159.seq
1496255136 gbinv16.seq
1486725769 gbinv160.seq
1474245370 gbinv161.seq
1490171823 gbinv162.seq
1415940595 gbinv163.seq
1476437097 gbinv164.seq
1492039285 gbinv165.seq
1486989889 gbinv166.seq
1391566748 gbinv167.seq
1497850731 gbinv168.seq
1486856363 gbinv169.seq
1463827178 gbinv17.seq
1473461745 gbinv170.seq
1457783743 gbinv171.seq
1432295701 gbinv172.seq
1476859107 gbinv173.seq
1478810991 gbinv174.seq
1470253222 gbinv175.seq
1449415343 gbinv176.seq
1496880191 gbinv177.seq
1456326631 gbinv178.seq
1430905253 gbinv179.seq
1488992096 gbinv18.seq
1347201702 gbinv180.seq
1495706167 gbinv181.seq
1491112830 gbinv182.seq
1441042971 gbinv183.seq
1497192059 gbinv184.seq
1392117025 gbinv185.seq
1413055833 gbinv186.seq
1478247791 gbinv187.seq
1499359194 gbinv188.seq
1444083953 gbinv189.seq
1468329157 gbinv19.seq
1433502188 gbinv190.seq
1491334103 gbinv191.seq
1499090744 gbinv192.seq
1474205648 gbinv193.seq
1352324854 gbinv194.seq
1452357984 gbinv195.seq
1326135021 gbinv196.seq
1474729500 gbinv197.seq
1479215552 gbinv198.seq
1491741492 gbinv199.seq
1484945562 gbinv2.seq
1448894932 gbinv20.seq
1393950408 gbinv200.seq
1494310694 gbinv201.seq
1498810799 gbinv202.seq
1468825102 gbinv203.seq
1475656757 gbinv204.seq
1491813915 gbinv205.seq
1481776571 gbinv206.seq
1483128844 gbinv207.seq
1347544723 gbinv208.seq
1493605679 gbinv209.seq
1481218227 gbinv21.seq
1483808360 gbinv210.seq
1442433573 gbinv211.seq
1483663747 gbinv212.seq
1495736706 gbinv213.seq
1253874201 gbinv214.seq
1494058793 gbinv215.seq
1373457953 gbinv216.seq
1456333883 gbinv217.seq
1484792520 gbinv218.seq
1251829555 gbinv219.seq
1498623648 gbinv22.seq
1496348692 gbinv220.seq
1357064376 gbinv221.seq
1414953531 gbinv222.seq
1400151225 gbinv223.seq
1466945524 gbinv224.seq
1478383808 gbinv225.seq
1496412220 gbinv226.seq
1467309158 gbinv227.seq
1487856483 gbinv228.seq
1487920343 gbinv229.seq
1499542591 gbinv23.seq
1489288989 gbinv230.seq
1487693141 gbinv231.seq
1288775238 gbinv232.seq
1382524196 gbinv233.seq
1357845048 gbinv234.seq
1486585874 gbinv235.seq
1486937267 gbinv236.seq
1488381993 gbinv237.seq
1476145037 gbinv238.seq
1438012610 gbinv239.seq
1497207676 gbinv24.seq
1477110064 gbinv240.seq
1498672461 gbinv241.seq
1473777568 gbinv242.seq
1462092039 gbinv243.seq
1333371159 gbinv244.seq
1385396260 gbinv245.seq
1369192781 gbinv246.seq
1499860066 gbinv247.seq
1475265022 gbinv248.seq
1425069576 gbinv249.seq
1471486214 gbinv25.seq
1420464715 gbinv250.seq
1495216681 gbinv251.seq
1455206750 gbinv252.seq
1472299211 gbinv253.seq
1493240415 gbinv254.seq
1438071355 gbinv255.seq
1352328131 gbinv256.seq
1481801525 gbinv257.seq
1417458943 gbinv258.seq
1498587547 gbinv259.seq
1476133992 gbinv26.seq
1474622826 gbinv260.seq
1469629928 gbinv261.seq
1389695051 gbinv262.seq
1454625956 gbinv263.seq
1473986511 gbinv264.seq
1492283405 gbinv265.seq
1463168127 gbinv266.seq
1391973732 gbinv267.seq
1456232875 gbinv268.seq
1437755108 gbinv269.seq
1476172668 gbinv27.seq
1492924934 gbinv270.seq
1325973548 gbinv271.seq
1499332945 gbinv272.seq
1445909632 gbinv273.seq
1495816197 gbinv274.seq
1443202585 gbinv275.seq
1480225589 gbinv276.seq
1442908071 gbinv277.seq
1478166345 gbinv278.seq
1489195348 gbinv279.seq
1471525090 gbinv28.seq
1480031166 gbinv280.seq
1499676154 gbinv281.seq
1485192064 gbinv282.seq
1372921321 gbinv283.seq
1416726958 gbinv284.seq
1447728294 gbinv285.seq
1439652819 gbinv286.seq
1442618626 gbinv287.seq
1426894153 gbinv288.seq
1447226340 gbinv289.seq
1490892049 gbinv29.seq
1487195331 gbinv290.seq
1483792235 gbinv291.seq
1490454343 gbinv292.seq
1383487701 gbinv293.seq
1488575579 gbinv294.seq
1495179183 gbinv295.seq
1464715247 gbinv296.seq
1493913805 gbinv297.seq
1489979595 gbinv298.seq
1427512355 gbinv299.seq
1496070030 gbinv3.seq
1491031005 gbinv30.seq
1457194355 gbinv300.seq
1489488513 gbinv301.seq
1495947464 gbinv302.seq
1325794030 gbinv303.seq
1494136720 gbinv304.seq
1477159575 gbinv305.seq
1467829201 gbinv306.seq
1454855814 gbinv307.seq
1493852374 gbinv308.seq
1498242095 gbinv309.seq
1496551664 gbinv31.seq
1485124639 gbinv310.seq
1423569097 gbinv311.seq
1476156793 gbinv312.seq
1494695775 gbinv313.seq
1442638155 gbinv314.seq
546209869 gbinv315.seq
2729769834 gbinv316.seq
1951209797 gbinv317.seq
1255792905 gbinv318.seq
898357564 gbinv319.seq
1346512123 gbinv32.seq
1390359247 gbinv320.seq
1466020132 gbinv321.seq
1443272573 gbinv322.seq
1475387842 gbinv323.seq
1497205510 gbinv324.seq
1467101040 gbinv325.seq
1496389311 gbinv326.seq
1499117653 gbinv327.seq
1462931194 gbinv328.seq
1487873497 gbinv329.seq
1393262298 gbinv33.seq
1277578135 gbinv330.seq
1487639321 gbinv331.seq
1456188446 gbinv332.seq
1499002056 gbinv333.seq
1480066049 gbinv334.seq
1454211592 gbinv335.seq
1222756177 gbinv336.seq
1477554828 gbinv337.seq
1486108915 gbinv338.seq
1427447559 gbinv339.seq
1477889088 gbinv34.seq
1483162232 gbinv340.seq
1485243570 gbinv341.seq
1410776048 gbinv342.seq
1475127917 gbinv343.seq
1479038418 gbinv344.seq
1425853319 gbinv345.seq
1481373985 gbinv346.seq
1490243609 gbinv347.seq
1483879579 gbinv348.seq
1414434060 gbinv349.seq
1491191417 gbinv35.seq
1457292205 gbinv350.seq
1477018477 gbinv351.seq
1409025156 gbinv352.seq
1474794456 gbinv353.seq
1494012052 gbinv354.seq
1465696815 gbinv355.seq
1494483077 gbinv356.seq
1459440397 gbinv357.seq
1494957101 gbinv358.seq
1491910109 gbinv359.seq
1429887417 gbinv36.seq
1481624627 gbinv360.seq
1479042031 gbinv361.seq
1495864056 gbinv362.seq
1479577884 gbinv363.seq
1494515876 gbinv364.seq
1364399555 gbinv365.seq
1448613839 gbinv366.seq
1492450027 gbinv367.seq
1481797904 gbinv368.seq
1448615210 gbinv369.seq
1482775396 gbinv37.seq
1497318133 gbinv370.seq
1482942294 gbinv371.seq
1491980118 gbinv372.seq
1474614077 gbinv373.seq
1493902565 gbinv374.seq
1278522756 gbinv375.seq
1482901794 gbinv376.seq
1456649541 gbinv377.seq
1433938244 gbinv378.seq
1484220657 gbinv379.seq
1485006015 gbinv38.seq
1480269708 gbinv380.seq
1477251799 gbinv381.seq
1488642106 gbinv382.seq
1464325796 gbinv383.seq
1338568836 gbinv384.seq
1490699998 gbinv385.seq
1419620460 gbinv386.seq
1476857168 gbinv387.seq
1483484812 gbinv388.seq
1491577966 gbinv389.seq
1325350655 gbinv39.seq
1491112499 gbinv390.seq
1479699030 gbinv391.seq
1480538403 gbinv392.seq
1472167723 gbinv393.seq
1486100359 gbinv394.seq
1481117526 gbinv395.seq
1492071757 gbinv396.seq
1499340126 gbinv397.seq
1497229819 gbinv398.seq
1479610041 gbinv399.seq
1492635630 gbinv4.seq
1264663267 gbinv40.seq
1483481633 gbinv400.seq
1474121526 gbinv401.seq
1490369993 gbinv402.seq
1405673874 gbinv403.seq
1458938909 gbinv404.seq
1349464140 gbinv405.seq
1495749208 gbinv406.seq
1476876176 gbinv407.seq
1473968850 gbinv408.seq
1323353583 gbinv409.seq
1331002479 gbinv41.seq
1491101509 gbinv410.seq
1484946141 gbinv411.seq
1470944398 gbinv412.seq
1472332405 gbinv413.seq
1481542660 gbinv414.seq
1492837082 gbinv415.seq
1479414174 gbinv416.seq
1466552136 gbinv417.seq
1431499002 gbinv418.seq
1485071634 gbinv419.seq
1258736348 gbinv42.seq
1494313967 gbinv420.seq
1493657170 gbinv421.seq
1480261094 gbinv422.seq
1483044191 gbinv423.seq
1445615250 gbinv424.seq
1497887640 gbinv425.seq
1471083260 gbinv426.seq
1497577480 gbinv427.seq
1499666284 gbinv428.seq
1460233365 gbinv429.seq
1458619342 gbinv43.seq
1496183446 gbinv430.seq
1498835879 gbinv431.seq
1473136630 gbinv432.seq
1479632452 gbinv433.seq
1208341643 gbinv434.seq
1475939186 gbinv435.seq
1492673455 gbinv436.seq
1461443834 gbinv437.seq
1499017367 gbinv438.seq
1480639218 gbinv439.seq
1386885295 gbinv44.seq
1489253829 gbinv440.seq
1499684437 gbinv441.seq
1498373944 gbinv442.seq
1477680980 gbinv443.seq
1469115028 gbinv444.seq
1486876777 gbinv445.seq
1494514455 gbinv446.seq
1419644627 gbinv447.seq
1498250624 gbinv448.seq
1487133459 gbinv449.seq
1431698617 gbinv45.seq
1393203164 gbinv450.seq
1408820705 gbinv451.seq
1497592776 gbinv452.seq
1478543833 gbinv453.seq
1392852049 gbinv454.seq
1499169382 gbinv455.seq
1466213638 gbinv456.seq
1469972842 gbinv457.seq
1457228715 gbinv458.seq
1497717270 gbinv459.seq
1431750372 gbinv46.seq
1494988855 gbinv460.seq
1278804881 gbinv461.seq
1380109384 gbinv462.seq
1386694032 gbinv463.seq
1420319566 gbinv464.seq
1318232257 gbinv465.seq
1488909769 gbinv466.seq
1481543720 gbinv467.seq
1481572537 gbinv468.seq
1479361265 gbinv469.seq
1344444822 gbinv47.seq
1401152941 gbinv470.seq
1496970085 gbinv471.seq
1478315198 gbinv472.seq
1429811506 gbinv473.seq
1376843258 gbinv474.seq
1465003259 gbinv475.seq
1497423367 gbinv476.seq
1346892194 gbinv477.seq
1454126994 gbinv478.seq
1487412138 gbinv479.seq
1444379504 gbinv48.seq
1483868694 gbinv480.seq
1473633031 gbinv481.seq
1482689248 gbinv482.seq
1452173892 gbinv483.seq
1499910356 gbinv484.seq
1464467532 gbinv485.seq
1485513855 gbinv486.seq
1482623541 gbinv487.seq
1494124998 gbinv488.seq
1497608690 gbinv489.seq
1425942927 gbinv49.seq
1457065445 gbinv490.seq
1311857016 gbinv491.seq
1474908251 gbinv492.seq
882426802 gbinv493.seq
1391549013 gbinv494.seq
1469092788 gbinv495.seq
1473448155 gbinv496.seq
1478007974 gbinv497.seq
1483031812 gbinv498.seq
1499113062 gbinv499.seq
1495542399 gbinv5.seq
1280180275 gbinv50.seq
1414071112 gbinv500.seq
1488672225 gbinv501.seq
1436891465 gbinv502.seq
1470426165 gbinv503.seq
994114412 gbinv504.seq
1495303361 gbinv505.seq
1489955112 gbinv506.seq
1463095666 gbinv507.seq
1444565030 gbinv508.seq
1476941483 gbinv509.seq
1313437692 gbinv51.seq
1476771081 gbinv510.seq
1383246824 gbinv511.seq
1452869539 gbinv512.seq
1478517605 gbinv513.seq
1495371589 gbinv514.seq
1467297527 gbinv515.seq
1460534329 gbinv516.seq
1461098798 gbinv517.seq
1414146754 gbinv518.seq
1468601310 gbinv519.seq
1326432934 gbinv52.seq
1496553038 gbinv520.seq
1481179326 gbinv521.seq
1496915445 gbinv522.seq
1400120857 gbinv523.seq
1489117723 gbinv524.seq
1489917827 gbinv525.seq
1472324703 gbinv526.seq
1484543524 gbinv527.seq
1497533122 gbinv528.seq
1498095048 gbinv529.seq
1146288120 gbinv53.seq
1485800779 gbinv530.seq
1451959467 gbinv531.seq
1339662122 gbinv532.seq
1285411718 gbinv533.seq
1403179825 gbinv534.seq
1463090834 gbinv535.seq
1487090635 gbinv536.seq
1413426091 gbinv537.seq
1313629197 gbinv538.seq
1478845791 gbinv539.seq
1386619309 gbinv54.seq
1422907245 gbinv540.seq
1482655612 gbinv541.seq
1358286202 gbinv542.seq
1442882432 gbinv543.seq
1494791321 gbinv544.seq
1474942351 gbinv545.seq
1439290780 gbinv546.seq
1449238385 gbinv547.seq
1477198309 gbinv548.seq
1366129901 gbinv549.seq
1370389051 gbinv55.seq
1493069824 gbinv550.seq
1491415882 gbinv551.seq
1473668442 gbinv552.seq
1386898604 gbinv553.seq
1347917131 gbinv554.seq
1309168704 gbinv555.seq
1436243774 gbinv556.seq
1389671116 gbinv557.seq
1449300137 gbinv558.seq
1492678269 gbinv559.seq
1500000250 gbinv56.seq
1458594377 gbinv560.seq
1492844340 gbinv561.seq
1452199723 gbinv562.seq
1476212405 gbinv563.seq
1486194223 gbinv564.seq
1495140895 gbinv565.seq
1287096563 gbinv566.seq
1374386504 gbinv567.seq
1468997307 gbinv568.seq
1494920149 gbinv569.seq
1488166542 gbinv57.seq
1495343415 gbinv570.seq
1490343966 gbinv571.seq
1489624021 gbinv572.seq
1487080559 gbinv573.seq
1498747450 gbinv574.seq
1395302798 gbinv575.seq
1485284949 gbinv576.seq
1435694157 gbinv577.seq
1470723522 gbinv578.seq
1484916015 gbinv579.seq
1497843538 gbinv58.seq
1483150132 gbinv580.seq
1331454162 gbinv581.seq
1356210496 gbinv582.seq
1416749796 gbinv583.seq
1452284984 gbinv584.seq
1488148955 gbinv585.seq
1495268123 gbinv586.seq
1461920210 gbinv587.seq
1490950525 gbinv588.seq
1372238232 gbinv589.seq
1486951187 gbinv59.seq
1390606238 gbinv590.seq
1458894443 gbinv591.seq
1493654155 gbinv592.seq
1499866432 gbinv593.seq
1462171534 gbinv594.seq
1470312188 gbinv595.seq
1491213345 gbinv596.seq
1200607082 gbinv597.seq
1474599992 gbinv598.seq
1226521611 gbinv599.seq
1484462816 gbinv6.seq
1384806830 gbinv60.seq
1438661071 gbinv600.seq
1489193064 gbinv601.seq
1211826488 gbinv602.seq
1440385609 gbinv603.seq
1477656292 gbinv604.seq
1499291058 gbinv605.seq
1499137795 gbinv606.seq
1474254297 gbinv607.seq
1437961059 gbinv608.seq
1465982476 gbinv609.seq
1466490036 gbinv61.seq
1476362632 gbinv610.seq
1353205190 gbinv611.seq
1461561561 gbinv612.seq
1480265953 gbinv613.seq
1477136556 gbinv614.seq
1413880691 gbinv615.seq
1493749227 gbinv616.seq
1489227625 gbinv617.seq
1127804764 gbinv618.seq
1467406139 gbinv619.seq
1497913038 gbinv62.seq
1349338312 gbinv620.seq
1466084609 gbinv621.seq
1499595036 gbinv622.seq
1493518373 gbinv623.seq
1482408313 gbinv624.seq
1489972607 gbinv625.seq
1457477267 gbinv626.seq
1498514187 gbinv627.seq
1484260363 gbinv628.seq
1313458207 gbinv629.seq
1485543135 gbinv63.seq
1489473064 gbinv630.seq
1467231749 gbinv631.seq
1496514080 gbinv632.seq
1476538751 gbinv633.seq
1466376780 gbinv634.seq
1462399182 gbinv635.seq
1477737198 gbinv636.seq
1424791995 gbinv637.seq
1468769087 gbinv638.seq
1497913605 gbinv639.seq
1489822428 gbinv64.seq
1271418322 gbinv640.seq
1301564944 gbinv641.seq
1471879735 gbinv642.seq
1053677687 gbinv643.seq
1380265120 gbinv644.seq
1396131978 gbinv645.seq
1489554947 gbinv646.seq
1433410472 gbinv647.seq
1351353812 gbinv648.seq
1242394563 gbinv649.seq
1489866376 gbinv65.seq
1499324418 gbinv650.seq
1473661888 gbinv651.seq
1449356018 gbinv652.seq
1475967180 gbinv653.seq
1493682979 gbinv654.seq
1495997887 gbinv655.seq
1469126947 gbinv656.seq
1296705383 gbinv657.seq
1466230627 gbinv658.seq
1343924683 gbinv659.seq
1490711516 gbinv66.seq
1496203289 gbinv660.seq
1484700308 gbinv661.seq
1188685701 gbinv662.seq
1441258603 gbinv663.seq
1462772577 gbinv664.seq
1495266184 gbinv665.seq
1494695214 gbinv666.seq
1391522890 gbinv667.seq
1470077879 gbinv668.seq
1294029204 gbinv669.seq
1497689069 gbinv67.seq
1274422615 gbinv670.seq
1205408689 gbinv671.seq
1104142746 gbinv672.seq
1036632038 gbinv673.seq
1332903523 gbinv674.seq
1190138460 gbinv675.seq
1381167273 gbinv676.seq
1482941221 gbinv677.seq
1334265164 gbinv678.seq
1420388772 gbinv679.seq
1475025659 gbinv68.seq
1404385349 gbinv680.seq
1460306287 gbinv681.seq
1462226610 gbinv682.seq
1436988710 gbinv683.seq
1491802675 gbinv684.seq
1492108404 gbinv685.seq
1367921076 gbinv686.seq
1494199652 gbinv687.seq
1123984168 gbinv688.seq
874599051 gbinv689.seq
1474966608 gbinv69.seq
872525010 gbinv690.seq
810605264 gbinv691.seq
791733648 gbinv692.seq
789407447 gbinv693.seq
782472280 gbinv694.seq
1478877159 gbinv695.seq
1425054466 gbinv696.seq
1232428257 gbinv697.seq
1449091071 gbinv698.seq
1494178824 gbinv699.seq
1489984834 gbinv7.seq
1481790507 gbinv70.seq
1451306539 gbinv700.seq
1446725042 gbinv701.seq
1492012562 gbinv702.seq
1485251352 gbinv703.seq
1440797550 gbinv704.seq
1489644341 gbinv705.seq
1129926582 gbinv706.seq
1478985096 gbinv707.seq
1436917067 gbinv708.seq
1304573259 gbinv709.seq
1484232844 gbinv71.seq
1447912985 gbinv710.seq
1477159679 gbinv711.seq
1441002488 gbinv712.seq
1358342669 gbinv713.seq
1495926001 gbinv714.seq
1489540966 gbinv715.seq
1385541461 gbinv716.seq
1490668437 gbinv717.seq
1498773544 gbinv718.seq
1494280310 gbinv719.seq
1476309587 gbinv72.seq
1478659130 gbinv720.seq
1490369912 gbinv721.seq
1454124707 gbinv722.seq
1480065591 gbinv723.seq
1477473627 gbinv724.seq
1458431340 gbinv725.seq
1267258270 gbinv726.seq
1499431451 gbinv727.seq
1384116066 gbinv728.seq
1474301866 gbinv729.seq
1491769496 gbinv73.seq
1204760525 gbinv730.seq
1460137155 gbinv731.seq
1476820917 gbinv732.seq
1353805130 gbinv733.seq
1413692605 gbinv734.seq
1470780301 gbinv735.seq
1484656775 gbinv736.seq
1469691984 gbinv737.seq
1495706071 gbinv738.seq
1297579350 gbinv739.seq
1490188557 gbinv74.seq
1375758712 gbinv740.seq
1454532764 gbinv741.seq
1497622251 gbinv742.seq
1370789184 gbinv743.seq
1487438153 gbinv744.seq
1492926956 gbinv745.seq
1492982005 gbinv746.seq
1447577144 gbinv747.seq
1431751206 gbinv748.seq
1489605332 gbinv749.seq
1495854749 gbinv75.seq
1473901953 gbinv750.seq
1460311830 gbinv751.seq
1453756526 gbinv752.seq
1382808281 gbinv753.seq
1482348831 gbinv754.seq
1487170658 gbinv755.seq
1059460203 gbinv756.seq
1191529685 gbinv757.seq
1176457428 gbinv758.seq
1118724487 gbinv759.seq
1487028202 gbinv76.seq
1448943866 gbinv760.seq
1436999462 gbinv761.seq
1484686767 gbinv762.seq
1440414567 gbinv763.seq
1462302632 gbinv764.seq
1488222097 gbinv765.seq
1477654772 gbinv766.seq
1489253061 gbinv767.seq
1461105919 gbinv768.seq
1476470435 gbinv769.seq
1499999673 gbinv77.seq
1456148858 gbinv770.seq
1414082664 gbinv771.seq
1496084666 gbinv772.seq
1489435912 gbinv773.seq
1434779449 gbinv774.seq
1490169327 gbinv775.seq
1436479661 gbinv776.seq
1443656233 gbinv777.seq
1497278333 gbinv778.seq
1482389324 gbinv779.seq
1499999588 gbinv78.seq
1475136219 gbinv780.seq
1372239389 gbinv781.seq
1391999152 gbinv782.seq
1453801378 gbinv783.seq
1497276181 gbinv784.seq
1488917458 gbinv785.seq
1343377212 gbinv786.seq
1431137590 gbinv787.seq
1470649030 gbinv788.seq
1495673684 gbinv789.seq
1499998624 gbinv79.seq
1484392436 gbinv790.seq
1370380432 gbinv791.seq
1271919212 gbinv792.seq
1302247251 gbinv793.seq
1373305750 gbinv794.seq
1375693754 gbinv795.seq
1464671547 gbinv796.seq
1459541391 gbinv797.seq
1489406014 gbinv798.seq
1490586273 gbinv799.seq
1414297602 gbinv8.seq
1499998570 gbinv80.seq
1493837031 gbinv800.seq
1400217161 gbinv801.seq
1413210457 gbinv802.seq
1490609103 gbinv803.seq
1497732234 gbinv804.seq
1219453804 gbinv805.seq
1264302105 gbinv806.seq
1485822787 gbinv807.seq
1418685694 gbinv808.seq
1482216219 gbinv809.seq
1499998337 gbinv81.seq
1417478148 gbinv810.seq
1494543420 gbinv811.seq
1417238152 gbinv812.seq
1366812572 gbinv813.seq
1494164508 gbinv814.seq
999979249 gbinv815.seq
1368086882 gbinv816.seq
1408574610 gbinv817.seq
1498538060 gbinv818.seq
1397635787 gbinv819.seq
1499995750 gbinv82.seq
1081620411 gbinv820.seq
1431826102 gbinv821.seq
1401372891 gbinv822.seq
1448756584 gbinv823.seq
1488109642 gbinv824.seq
1489078785 gbinv825.seq
1460733085 gbinv826.seq
1474715637 gbinv827.seq
1472124950 gbinv828.seq
1423732997 gbinv829.seq
1499999761 gbinv83.seq
1431479439 gbinv830.seq
1414088464 gbinv831.seq
1427352077 gbinv832.seq
1486209499 gbinv833.seq
1439790711 gbinv834.seq
1345947195 gbinv835.seq
1409851510 gbinv836.seq
1497428187 gbinv837.seq
1491627673 gbinv838.seq
1407776038 gbinv839.seq
1499998118 gbinv84.seq
1486091565 gbinv840.seq
1447417163 gbinv841.seq
1424173333 gbinv842.seq
1471376235 gbinv843.seq
1483914009 gbinv844.seq
1476924389 gbinv845.seq
1495375621 gbinv846.seq
1482546700 gbinv847.seq
1477023133 gbinv848.seq
1484489275 gbinv849.seq
1499996749 gbinv85.seq
1364991275 gbinv850.seq
1327457514 gbinv851.seq
1445905313 gbinv852.seq
1480024427 gbinv853.seq
1492427545 gbinv854.seq
1483237802 gbinv855.seq
1334750785 gbinv856.seq
1340130480 gbinv857.seq
1428711159 gbinv858.seq
1292257015 gbinv859.seq
1499998393 gbinv86.seq
1453904599 gbinv860.seq
1490727749 gbinv861.seq
1479824478 gbinv862.seq
1446168967 gbinv863.seq
1483787681 gbinv864.seq
1234619110 gbinv865.seq
1489639731 gbinv866.seq
1478350948 gbinv867.seq
1472613421 gbinv868.seq
1314863017 gbinv869.seq
1497947958 gbinv87.seq
1492845810 gbinv870.seq
1482657208 gbinv871.seq
1490433581 gbinv872.seq
1491351228 gbinv873.seq
1459189685 gbinv874.seq
1438910128 gbinv875.seq
1165149605 gbinv876.seq
1443358202 gbinv877.seq
1231751195 gbinv878.seq
1465887213 gbinv879.seq
1452778340 gbinv88.seq
1427380300 gbinv880.seq
1498007467 gbinv881.seq
1492780193 gbinv882.seq
1310752098 gbinv883.seq
1491528231 gbinv884.seq
1372427027 gbinv885.seq
1429260753 gbinv886.seq
1491982766 gbinv887.seq
1499828325 gbinv888.seq
1489546318 gbinv889.seq
1497328201 gbinv89.seq
1450002164 gbinv890.seq
1432656175 gbinv891.seq
1492803541 gbinv892.seq
1483685180 gbinv893.seq
1494338837 gbinv894.seq
1489389384 gbinv895.seq
1486778058 gbinv896.seq
1434934286 gbinv897.seq
1455774368 gbinv898.seq
1486106218 gbinv899.seq
1424906729 gbinv9.seq
1489332493 gbinv90.seq
1499848546 gbinv900.seq
1473633903 gbinv901.seq
1482973725 gbinv902.seq
1484222044 gbinv903.seq
1488305213 gbinv904.seq
1341678524 gbinv905.seq
1442932031 gbinv906.seq
1495746307 gbinv907.seq
1498425116 gbinv908.seq
1439194314 gbinv909.seq
1499217229 gbinv91.seq
1478270733 gbinv910.seq
1494920288 gbinv911.seq
1460584282 gbinv912.seq
1487364619 gbinv913.seq
1497676087 gbinv914.seq
1479051946 gbinv915.seq
1487083952 gbinv916.seq
1497354730 gbinv917.seq
1455384863 gbinv918.seq
1481656710 gbinv919.seq
1499961716 gbinv92.seq
1422592874 gbinv920.seq
1486259454 gbinv921.seq
1496078122 gbinv922.seq
1494276352 gbinv923.seq
1497275821 gbinv924.seq
1457705968 gbinv925.seq
1452771475 gbinv926.seq
1337144687 gbinv927.seq
1492176983 gbinv928.seq
1485150868 gbinv929.seq
1457178803 gbinv93.seq
1495278047 gbinv930.seq
1475008435 gbinv931.seq
1498947149 gbinv932.seq
1472536133 gbinv933.seq
1498507310 gbinv934.seq
1499942165 gbinv935.seq
1466341042 gbinv936.seq
1472044394 gbinv937.seq
1492159701 gbinv938.seq
1495894532 gbinv939.seq
1497991080 gbinv94.seq
1496016829 gbinv940.seq
1475317343 gbinv941.seq
1474568294 gbinv942.seq
1438072296 gbinv943.seq
1494607055 gbinv944.seq
1490886729 gbinv945.seq
1479101082 gbinv946.seq
1402632874 gbinv947.seq
1478348328 gbinv948.seq
1445542854 gbinv949.seq
1471704374 gbinv95.seq
1493783690 gbinv950.seq
1494864231 gbinv951.seq
1456882204 gbinv952.seq
1498195733 gbinv953.seq
1481786457 gbinv954.seq
1484032756 gbinv955.seq
1485547351 gbinv956.seq
1486001132 gbinv957.seq
1488420372 gbinv958.seq
1442129992 gbinv959.seq
1490373598 gbinv96.seq
1466077407 gbinv960.seq
1499748615 gbinv961.seq
1451014090 gbinv962.seq
1491533135 gbinv963.seq
1474040893 gbinv964.seq
1377730255 gbinv965.seq
1396391863 gbinv966.seq
1476640185 gbinv967.seq
1489968019 gbinv968.seq
1487861140 gbinv969.seq
1490766577 gbinv97.seq
1485537198 gbinv970.seq
1499625751 gbinv971.seq
1484465404 gbinv972.seq
1426415254 gbinv973.seq
1475823352 gbinv974.seq
1493390820 gbinv975.seq
1454462171 gbinv976.seq
1352129141 gbinv977.seq
1481827757 gbinv978.seq
1485321858 gbinv979.seq
1499567309 gbinv98.seq
1491490205 gbinv980.seq
1473282801 gbinv981.seq
1474812334 gbinv982.seq
1455288730 gbinv983.seq
1460050941 gbinv984.seq
1321445242 gbinv985.seq
1289149103 gbinv986.seq
1295409175 gbinv987.seq
1314219184 gbinv988.seq
1326818662 gbinv989.seq
1490250205 gbinv99.seq
1432750157 gbinv990.seq
1499348985 gbinv991.seq
1402001737 gbinv992.seq
1489762578 gbinv993.seq
1495800702 gbinv994.seq
1499680770 gbinv995.seq
1482267935 gbinv996.seq
1451247651 gbinv997.seq
1489797911 gbinv998.seq
1434543185 gbinv999.seq
1299929280 gbmam1.seq
1433374449 gbmam10.seq
1306087104 gbmam100.seq
1430476511 gbmam101.seq
1449916654 gbmam102.seq
1364157134 gbmam103.seq
1382213566 gbmam104.seq
1498676378 gbmam105.seq
1438757409 gbmam106.seq
1384358697 gbmam107.seq
1344501950 gbmam108.seq
1356418005 gbmam109.seq
1452368889 gbmam11.seq
1450451476 gbmam110.seq
1481466561 gbmam111.seq
1435707480 gbmam112.seq
1421504246 gbmam113.seq
1438731831 gbmam114.seq
1385607504 gbmam115.seq
1446529752 gbmam116.seq
1480279188 gbmam117.seq
1289027473 gbmam118.seq
1383998815 gbmam119.seq
1440036034 gbmam12.seq
1371963584 gbmam120.seq
1408704474 gbmam121.seq
1417170244 gbmam122.seq
1476795247 gbmam123.seq
1393897162 gbmam124.seq
1494577002 gbmam125.seq
1318911633 gbmam126.seq
1475290767 gbmam127.seq
1485363650 gbmam128.seq
1476657140 gbmam129.seq
1497426774 gbmam13.seq
1370959145 gbmam130.seq
1435239182 gbmam131.seq
1421963565 gbmam132.seq
1265661494 gbmam133.seq
1322489185 gbmam134.seq
1498720323 gbmam135.seq
1468071162 gbmam136.seq
1482316458 gbmam137.seq
1406515127 gbmam138.seq
1468808675 gbmam139.seq
1487057346 gbmam14.seq
1486469699 gbmam140.seq
1419745399 gbmam141.seq
1379376566 gbmam142.seq
1392387812 gbmam143.seq
1498621108 gbmam144.seq
1424747897 gbmam145.seq
1444039328 gbmam146.seq
1495905279 gbmam147.seq
1431972134 gbmam148.seq
1453650462 gbmam149.seq
1433300115 gbmam15.seq
1466469937 gbmam150.seq
1359653884 gbmam151.seq
1486040441 gbmam152.seq
1476612439 gbmam153.seq
1250005791 gbmam154.seq
1428977181 gbmam155.seq
1466316389 gbmam156.seq
1440958642 gbmam157.seq
1398606775 gbmam158.seq
1429174374 gbmam159.seq
1485894617 gbmam16.seq
1307257965 gbmam160.seq
1318147645 gbmam161.seq
1407278050 gbmam162.seq
1320959487 gbmam163.seq
1474063572 gbmam164.seq
962782132 gbmam165.seq
1345861608 gbmam17.seq
1404073848 gbmam18.seq
1315922420 gbmam19.seq
1490951841 gbmam2.seq
1367843978 gbmam20.seq
1468252034 gbmam21.seq
1393139762 gbmam22.seq
1466817553 gbmam23.seq
1488080656 gbmam24.seq
1483917563 gbmam25.seq
1434132825 gbmam26.seq
1485351268 gbmam27.seq
1453128998 gbmam28.seq
1494333882 gbmam29.seq
1141243686 gbmam3.seq
1464519465 gbmam30.seq
1441977794 gbmam31.seq
1446827567 gbmam32.seq
1455111173 gbmam33.seq
1385308836 gbmam34.seq
1424749144 gbmam35.seq
1410339361 gbmam36.seq
1378454484 gbmam37.seq
1434286183 gbmam38.seq
1499999524 gbmam39.seq
1342505130 gbmam4.seq
1487401787 gbmam40.seq
1480436127 gbmam41.seq
1406193426 gbmam42.seq
907465328 gbmam43.seq
839494897 gbmam44.seq
1363269325 gbmam45.seq
1343119710 gbmam46.seq
1465682461 gbmam47.seq
1327495418 gbmam48.seq
1455155074 gbmam49.seq
1484831122 gbmam5.seq
1403782937 gbmam50.seq
1389175376 gbmam51.seq
1460772173 gbmam52.seq
1499643620 gbmam53.seq
1494407093 gbmam54.seq
1396535326 gbmam55.seq
1383327549 gbmam56.seq
1473290653 gbmam57.seq
1411021419 gbmam58.seq
1443634265 gbmam59.seq
1429536704 gbmam6.seq
1399808988 gbmam60.seq
1372697093 gbmam61.seq
1445899120 gbmam62.seq
1487459605 gbmam63.seq
1446030419 gbmam64.seq
1491900321 gbmam65.seq
1447662228 gbmam66.seq
1288272320 gbmam67.seq
1489541175 gbmam68.seq
1367385872 gbmam69.seq
1485960787 gbmam7.seq
1433690311 gbmam70.seq
1367200168 gbmam71.seq
1407233551 gbmam72.seq
1437343447 gbmam73.seq
1344751550 gbmam74.seq
1487484232 gbmam75.seq
1418284918 gbmam76.seq
1499602081 gbmam77.seq
1297485464 gbmam78.seq
1441482016 gbmam79.seq
1435168677 gbmam8.seq
1345159341 gbmam80.seq
1472528753 gbmam81.seq
1427875805 gbmam82.seq
1399062857 gbmam83.seq
1414660891 gbmam84.seq
1404065710 gbmam85.seq
1471139449 gbmam86.seq
1360004244 gbmam87.seq
1498868645 gbmam88.seq
1463009812 gbmam89.seq
1460040942 gbmam9.seq
1456467514 gbmam90.seq
1375828745 gbmam91.seq
1499523909 gbmam92.seq
1445611423 gbmam93.seq
1449752142 gbmam94.seq
1496616060 gbmam95.seq
1436171585 gbmam96.seq
1444940922 gbmam97.seq
1410643331 gbmam98.seq
1473092164 gbmam99.seq
31182631 gbnew.txt
1499999533 gbpat1.seq
1499998866 gbpat10.seq
1500000212 gbpat11.seq
1499117685 gbpat12.seq
1500000080 gbpat13.seq
1499999526 gbpat14.seq
1499999810 gbpat15.seq
1500000101 gbpat16.seq
1499999262 gbpat17.seq
1500000031 gbpat18.seq
1499998872 gbpat19.seq
1499997700 gbpat2.seq
1500000033 gbpat20.seq
1500000087 gbpat21.seq
1500000178 gbpat22.seq
1499999529 gbpat23.seq
1499998599 gbpat24.seq
1499999973 gbpat25.seq
1497452296 gbpat26.seq
1499998088 gbpat27.seq
1499946758 gbpat28.seq
1499999160 gbpat29.seq
1499996296 gbpat3.seq
1499999058 gbpat30.seq
1498575921 gbpat31.seq
1499998970 gbpat32.seq
1499999158 gbpat33.seq
1499995693 gbpat34.seq
1499997858 gbpat35.seq
1499998623 gbpat36.seq
1499999862 gbpat37.seq
1500000032 gbpat38.seq
1499999722 gbpat39.seq
1499999332 gbpat4.seq
1498559244 gbpat40.seq
1499940981 gbpat41.seq
1499996775 gbpat42.seq
1499998629 gbpat43.seq
1500000186 gbpat44.seq
1499998965 gbpat45.seq
1499998832 gbpat46.seq
1499992533 gbpat47.seq
1499998804 gbpat48.seq
1499993151 gbpat49.seq
1499909606 gbpat5.seq
1500000126 gbpat50.seq
1499997512 gbpat51.seq
1499920981 gbpat52.seq
1499999330 gbpat53.seq
1499999022 gbpat54.seq
1499999056 gbpat55.seq
1499996080 gbpat56.seq
1500000214 gbpat57.seq
1499998128 gbpat58.seq
1499996741 gbpat59.seq
1499999382 gbpat6.seq
1499986020 gbpat60.seq
1499998796 gbpat61.seq
1500000007 gbpat62.seq
1499843862 gbpat63.seq
1499866922 gbpat64.seq
1499480501 gbpat65.seq
1477061152 gbpat66.seq
1499998595 gbpat67.seq
1499998966 gbpat68.seq
1499999339 gbpat69.seq
1499999417 gbpat7.seq
1499999165 gbpat70.seq
1499999709 gbpat71.seq
1499946499 gbpat72.seq
1499998676 gbpat73.seq
1499998664 gbpat74.seq
1499998904 gbpat75.seq
1499999057 gbpat76.seq
1499999558 gbpat77.seq
1499999181 gbpat78.seq
1499999127 gbpat79.seq
1499969143 gbpat8.seq
600121054 gbpat80.seq
1499999458 gbpat9.seq
1499995029 gbphg1.seq
1499468587 gbphg2.seq
582683811 gbphg3.seq
1499873912 gbpln1.seq
1490892671 gbpln10.seq
1497729906 gbpln100.seq
1471514124 gbpln1000.se
1460672453 gbpln1001.se
847689175 gbpln1002.se
797030463 gbpln1003.se
776617524 gbpln1004.se
1450233858 gbpln1005.se
1469651463 gbpln1006.se
834034797 gbpln1007.se
795540701 gbpln1008.se
776376885 gbpln1009.se
1489362717 gbpln101.seq
1448905128 gbpln1010.se
1457656304 gbpln1011.se
833009352 gbpln1012.se
797524540 gbpln1013.se
773297930 gbpln1014.se
1451244889 gbpln1015.se
1454193216 gbpln1016.se
830169429 gbpln1017.se
793310457 gbpln1018.se
773560290 gbpln1019.se
1499092145 gbpln102.seq
1446231891 gbpln1020.se
1450937303 gbpln1021.se
835938341 gbpln1022.se
795056321 gbpln1023.se
770765157 gbpln1024.se
1475561524 gbpln1025.se
1466579245 gbpln1026.se
829099164 gbpln1027.se
790989379 gbpln1028.se
773398673 gbpln1029.se
1473551999 gbpln103.seq
1462046272 gbpln1030.se
1449910042 gbpln1031.se
837413052 gbpln1032.se
790648527 gbpln1033.se
772176401 gbpln1034.se
1460620041 gbpln1035.se
1455765886 gbpln1036.se
833059054 gbpln1037.se
794545184 gbpln1038.se
774083177 gbpln1039.se
1497683966 gbpln104.seq
1448946753 gbpln1040.se
1458559584 gbpln1041.se
835451342 gbpln1042.se
794577233 gbpln1043.se
775251446 gbpln1044.se
1454531761 gbpln1045.se
1463618989 gbpln1046.se
836809812 gbpln1047.se
806584862 gbpln1048.se
776084155 gbpln1049.se
1339792010 gbpln105.seq
1485075661 gbpln1050.se
1448852265 gbpln1051.se
836125457 gbpln1052.se
794049612 gbpln1053.se
769729355 gbpln1054.se
1469601615 gbpln1055.se
1458361301 gbpln1056.se
840008504 gbpln1057.se
794029694 gbpln1058.se
769623341 gbpln1059.se
946931884 gbpln106.seq
1477482614 gbpln1060.se
1456549528 gbpln1061.se
836931236 gbpln1062.se
792455888 gbpln1063.se
768695354 gbpln1064.se
1450909194 gbpln1065.se
1454926637 gbpln1066.se
835570197 gbpln1067.se
798619346 gbpln1068.se
776375847 gbpln1069.se
1121159029 gbpln107.seq
1468212148 gbpln1070.se
1463519623 gbpln1071.se
832456199 gbpln1072.se
793920035 gbpln1073.se
773324985 gbpln1074.se
1443647684 gbpln1075.se
1458966967 gbpln1076.se
834886228 gbpln1077.se
792465315 gbpln1078.se
766375549 gbpln1079.se
1164001315 gbpln108.seq
1449349195 gbpln1080.se
1457671779 gbpln1081.se
836173230 gbpln1082.se
792990723 gbpln1083.se
774691916 gbpln1084.se
1452432506 gbpln1085.se
797342703 gbpln1086.se
1496638015 gbpln1087.se
804070482 gbpln1088.se
777569920 gbpln1089.se
1483600477 gbpln109.seq
1461158646 gbpln1090.se
1466754128 gbpln1091.se
830451601 gbpln1092.se
798616435 gbpln1093.se
774880678 gbpln1094.se
1455218535 gbpln1095.se
1460523331 gbpln1096.se
837230145 gbpln1097.se
796560308 gbpln1098.se
777015504 gbpln1099.se
1408071661 gbpln11.seq
1314173387 gbpln110.seq
1455593679 gbpln1100.se
1455711383 gbpln1101.se
838785071 gbpln1102.se
791233293 gbpln1103.se
770014685 gbpln1104.se
1450013191 gbpln1105.se
1455309450 gbpln1106.se
835677720 gbpln1107.se
793372574 gbpln1108.se
769401747 gbpln1109.se
946518369 gbpln111.seq
1456544663 gbpln1110.se
1465313453 gbpln1111.se
839230685 gbpln1112.se
803963907 gbpln1113.se
778586682 gbpln1114.se
1463130395 gbpln1115.se
1457728697 gbpln1116.se
832496071 gbpln1117.se
797513192 gbpln1118.se
776551156 gbpln1119.se
1120694900 gbpln112.seq
1449845840 gbpln1120.se
1460493739 gbpln1121.se
839860091 gbpln1122.se
789840368 gbpln1123.se
776969912 gbpln1124.se
1450486337 gbpln1125.se
1492412414 gbpln1126.se
1486347390 gbpln1127.se
1445734827 gbpln1128.se
1251330037 gbpln1129.se
1163541839 gbpln113.seq
1123381446 gbpln1130.se
1111693114 gbpln1131.se
1309334197 gbpln1132.se
1445887647 gbpln1133.se
1075129462 gbpln1134.se
830295693 gbpln1135.se
794035728 gbpln1136.se
766241777 gbpln1137.se
1451959155 gbpln1138.se
1460262157 gbpln1139.se
1476382817 gbpln114.seq
800420442 gbpln1140.se
807100878 gbpln1141.se
813165275 gbpln1142.se
1489858794 gbpln1143.se
1463645427 gbpln1144.se
836403024 gbpln1145.se
797704105 gbpln1146.se
771673145 gbpln1147.se
1489073756 gbpln1148.se
1463000631 gbpln1149.se
1472023278 gbpln115.seq
835021187 gbpln1150.se
794511065 gbpln1151.se
765022160 gbpln1152.se
1450430115 gbpln1153.se
1446394723 gbpln1154.se
837987830 gbpln1155.se
795104781 gbpln1156.se
772053911 gbpln1157.se
1454341387 gbpln1158.se
1471789737 gbpln1159.se
1398752652 gbpln116.seq
850377149 gbpln1160.se
1235921295 gbpln1161.se
820639220 gbpln1162.se
1480990953 gbpln1163.se
791663935 gbpln1164.se
942730875 gbpln1165.se
1413074394 gbpln1166.se
1271934713 gbpln1167.se
1485567802 gbpln1168.se
1184860474 gbpln1169.se
1421926221 gbpln117.seq
1227017136 gbpln1170.se
774219381 gbpln1171.se
1442415305 gbpln1172.se
1485783848 gbpln1173.se
1496789915 gbpln1174.se
1459198915 gbpln1175.se
952026327 gbpln1176.se
818534977 gbpln1177.se
744338029 gbpln1178.se
840481828 gbpln1179.se
1469834257 gbpln118.seq
1482265733 gbpln1180.se
867339882 gbpln1181.se
665178568 gbpln1182.se
840478319 gbpln1183.se
804862544 gbpln1184.se
775136193 gbpln1185.se
1456887584 gbpln1186.se
1470716689 gbpln1187.se
836948259 gbpln1188.se
794972859 gbpln1189.se
1475164725 gbpln119.seq
775455598 gbpln1190.se
1463119445 gbpln1191.se
1451301195 gbpln1192.se
852997313 gbpln1193.se
798187575 gbpln1194.se
776406263 gbpln1195.se
1458385249 gbpln1196.se
1463826120 gbpln1197.se
833048862 gbpln1198.se
794071582 gbpln1199.se
1475360853 gbpln12.seq
1486621137 gbpln120.seq
772684697 gbpln1200.se
1454827832 gbpln1201.se
1451661085 gbpln1202.se
839152730 gbpln1203.se
798464996 gbpln1204.se
775710033 gbpln1205.se
1463986968 gbpln1206.se
1455516963 gbpln1207.se
827472017 gbpln1208.se
799696373 gbpln1209.se
1457160312 gbpln121.seq
771541363 gbpln1210.se
1456098533 gbpln1211.se
1450468258 gbpln1212.se
830011447 gbpln1213.se
803324869 gbpln1214.se
778613518 gbpln1215.se
1485535574 gbpln1216.se
1460285834 gbpln1217.se
834396522 gbpln1218.se
793156442 gbpln1219.se
1454763247 gbpln122.seq
771664945 gbpln1220.se
1460976066 gbpln1221.se
1472747650 gbpln1222.se
831402033 gbpln1223.se
788227480 gbpln1224.se
773608315 gbpln1225.se
1459251214 gbpln1226.se
1457115869 gbpln1227.se
833114761 gbpln1228.se
791988363 gbpln1229.se
1498503243 gbpln123.seq
773778680 gbpln1230.se
1439338108 gbpln1231.se
1459678216 gbpln1232.se
832582978 gbpln1233.se
790630518 gbpln1234.se
774554078 gbpln1235.se
1459431387 gbpln1236.se
1462622889 gbpln1237.se
841885928 gbpln1238.se
814740283 gbpln1239.se
1441635964 gbpln124.seq
781686950 gbpln1240.se
1470777020 gbpln1241.se
1474113031 gbpln1242.se
836345572 gbpln1243.se
803943397 gbpln1244.se
776352617 gbpln1245.se
1461742228 gbpln1246.se
1468260082 gbpln1247.se
833628952 gbpln1248.se
800337028 gbpln1249.se
1486044425 gbpln125.seq
775679569 gbpln1250.se
1485372410 gbpln1251.se
1470684487 gbpln1252.se
837791026 gbpln1253.se
805450455 gbpln1254.se
782697461 gbpln1255.se
1462403294 gbpln1256.se
1471545155 gbpln1257.se
844251896 gbpln1258.se
800661389 gbpln1259.se
1479251541 gbpln126.seq
770104661 gbpln1260.se
1486820730 gbpln1261.se
1437673274 gbpln1262.se
1478905630 gbpln1263.se
1484038098 gbpln1264.se
1459847462 gbpln1265.se
1419009936 gbpln1266.se
1449294852 gbpln1267.se
1432942330 gbpln1268.se
1483752514 gbpln1269.se
1458104721 gbpln127.seq
1440643664 gbpln1270.se
1404423649 gbpln1271.se
1444711390 gbpln1272.se
1488511554 gbpln1273.se
1472104928 gbpln1274.se
1252858539 gbpln1275.se
1227118965 gbpln1276.se
1253367586 gbpln1277.se
1312280922 gbpln1278.se
1221593375 gbpln1279.se
1411028718 gbpln128.seq
1480321489 gbpln1280.se
1413447705 gbpln1281.se
1469526349 gbpln1282.se
1268059309 gbpln1283.se
2734223096 gbpln1284.se
2727931901 gbpln1285.se
2720692598 gbpln1286.se
2732441076 gbpln1287.se
2733260927 gbpln1288.se
157556535 gbpln1289.se
1353855770 gbpln129.seq
2694271430 gbpln1290.se
2735442486 gbpln1291.se
2720859722 gbpln1292.se
2732011308 gbpln1293.se
2383529845 gbpln1294.se
2723191931 gbpln1295.se
2689474086 gbpln1296.se
2737751830 gbpln1297.se
2700210160 gbpln1298.se
2006289519 gbpln1299.se
1437976712 gbpln13.seq
1357941853 gbpln130.seq
2636141786 gbpln1300.se
2722875815 gbpln1301.se
2725415454 gbpln1302.se
2730393002 gbpln1303.se
1948886785 gbpln1304.se
2738131093 gbpln1305.se
2727379378 gbpln1306.se
2679871098 gbpln1307.se
2737685310 gbpln1308.se
786720890 gbpln1309.se
1471747640 gbpln131.seq
2727907345 gbpln1310.se
2657432129 gbpln1311.se
2735229991 gbpln1312.se
2728645371 gbpln1313.se
218791011 gbpln1314.se
2719617838 gbpln1315.se
2721885171 gbpln1316.se
2721092581 gbpln1317.se
2679558604 gbpln1318.se
181580803 gbpln1319.se
1475148766 gbpln132.seq
2722179116 gbpln1320.se
2736369220 gbpln1321.se
2726783046 gbpln1322.se
2440060122 gbpln1323.se
2736724965 gbpln1324.se
2696541624 gbpln1325.se
2737924301 gbpln1326.se
1979539878 gbpln1327.se
2731302183 gbpln1328.se
2702984894 gbpln1329.se
1499375765 gbpln133.seq
2732485324 gbpln1330.se
1906858977 gbpln1331.se
1333776538 gbpln1332.se
1481529082 gbpln1333.se
1126988286 gbpln1334.se
1310090641 gbpln1335.se
1319048578 gbpln1336.se
1215502439 gbpln1337.se
1273213184 gbpln1338.se
1439841247 gbpln1339.se
1499799014 gbpln134.seq
1291263007 gbpln1340.se
1286241557 gbpln1341.se
1294607816 gbpln1342.se
1298830856 gbpln1343.se
1179380341 gbpln1344.se
1227809389 gbpln1345.se
1347974809 gbpln1346.se
1227045645 gbpln1347.se
1241387178 gbpln1348.se
1321199139 gbpln1349.se
1475765369 gbpln135.seq
1307076096 gbpln1350.se
1194598426 gbpln1351.se
1267961203 gbpln1352.se
1465598311 gbpln1353.se
1272760531 gbpln1354.se
1248554044 gbpln1355.se
1285502181 gbpln1356.se
1353649948 gbpln1357.se
1201259963 gbpln1358.se
1114385426 gbpln1359.se
1489368190 gbpln136.seq
1428292861 gbpln1360.se
1254591123 gbpln1361.se
1109371533 gbpln1362.se
1256013571 gbpln1363.se
1193254570 gbpln1364.se
1147797532 gbpln1365.se
1185963587 gbpln1366.se
1176623547 gbpln1367.se
1184486862 gbpln1368.se
1178497787 gbpln1369.se
1491306094 gbpln137.seq
1255058840 gbpln1370.se
1121066110 gbpln1371.se
1150746117 gbpln1372.se
1179251584 gbpln1373.se
1319824235 gbpln1374.se
1194499724 gbpln1375.se
1150884296 gbpln1376.se
1260272463 gbpln1377.se
1277796253 gbpln1378.se
1077009674 gbpln1379.se
1476492903 gbpln138.seq
1159931138 gbpln1380.se
1298671968 gbpln1381.se
1092881836 gbpln1382.se
1120436749 gbpln1383.se
1214127482 gbpln1384.se
1117793566 gbpln1385.se
1019835843 gbpln1386.se
1155398206 gbpln1387.se
1368620545 gbpln1388.se
1144165985 gbpln1389.se
1295984790 gbpln139.seq
1072391985 gbpln1390.se
1263097017 gbpln1391.se
1297997059 gbpln1392.se
1325335044 gbpln1393.se
1216230084 gbpln1394.se
1263623363 gbpln1395.se
1174025244 gbpln1396.se
1229634718 gbpln1397.se
1363681878 gbpln1398.se
1218381112 gbpln1399.se
1499998704 gbpln14.seq
1251274347 gbpln140.seq
1400966271 gbpln1400.se
1382372150 gbpln1401.se
1176735774 gbpln1402.se
1224889930 gbpln1403.se
1310436934 gbpln1404.se
1233749942 gbpln1405.se
1059964644 gbpln1406.se
1254488223 gbpln1407.se
1310744622 gbpln1408.se
1163904965 gbpln1409.se
1453657951 gbpln141.seq
1264654503 gbpln1410.se
1296551517 gbpln1411.se
1158563945 gbpln1412.se
1059918971 gbpln1413.se
1259052983 gbpln1414.se
1206631634 gbpln1415.se
1106849019 gbpln1416.se
1193454949 gbpln1417.se
1254210685 gbpln1418.se
1151910983 gbpln1419.se
1481017758 gbpln142.seq
1118028517 gbpln1420.se
1136283639 gbpln1421.se
1270471759 gbpln1422.se
1106145822 gbpln1423.se
1237358153 gbpln1424.se
1388485833 gbpln1425.se
1221364282 gbpln1426.se
1101728075 gbpln1427.se
1191208317 gbpln1428.se
1212231259 gbpln1429.se
1498606076 gbpln143.seq
1132007157 gbpln1430.se
1441955987 gbpln1431.se
1470274017 gbpln1432.se
1459739391 gbpln1433.se
1471760010 gbpln1434.se
1440847993 gbpln1435.se
1455978021 gbpln1436.se
1445045468 gbpln1437.se
1487079619 gbpln1438.se
1481625137 gbpln1439.se
1442798465 gbpln144.seq
1447279971 gbpln1440.se
1048521841 gbpln1441.se
1038155649 gbpln1442.se
833369914 gbpln1443.se
931292853 gbpln1444.se
811379776 gbpln1445.se
1077992421 gbpln1446.se
812614241 gbpln1447.se
1052276437 gbpln1448.se
1035793500 gbpln1449.se
1457724171 gbpln145.seq
832863065 gbpln1450.se
922247149 gbpln1451.se
807661511 gbpln1452.se
1066166792 gbpln1453.se
997697986 gbpln1454.se
1273669998 gbpln1455.se
1102521608 gbpln1456.se
1209618371 gbpln1457.se
1111089963 gbpln1458.se
1160173863 gbpln1459.se
1479937021 gbpln146.seq
1205643923 gbpln1460.se
1237074429 gbpln1461.se
1242683281 gbpln1462.se
1080809951 gbpln1463.se
1226448377 gbpln1464.se
1349517074 gbpln1465.se
1175767295 gbpln1466.se
1216393612 gbpln1467.se
1294608106 gbpln1468.se
1298831146 gbpln1469.se
1491344801 gbpln147.seq
1179380631 gbpln1470.se
1227809679 gbpln1471.se
1347975099 gbpln1472.se
1227045935 gbpln1473.se
1241387663 gbpln1474.se
1256013573 gbpln1475.se
1193254572 gbpln1476.se
1147797534 gbpln1477.se
1185963589 gbpln1478.se
1176623549 gbpln1479.se
1495551806 gbpln148.seq
1184486864 gbpln1480.se
1178497789 gbpln1481.se
1255058842 gbpln1482.se
1121066112 gbpln1483.se
1150746119 gbpln1484.se
1179251586 gbpln1485.se
1319824237 gbpln1486.se
1194499726 gbpln1487.se
1150884349 gbpln1488.se
1183507690 gbpln1489.se
1492595295 gbpln149.seq
1165156001 gbpln1490.se
1145365871 gbpln1491.se
1114264316 gbpln1492.se
1291707339 gbpln1493.se
1200907808 gbpln1494.se
1185642828 gbpln1495.se
1268692726 gbpln1496.se
1272919740 gbpln1497.se
1103058293 gbpln1498.se
1122948169 gbpln1499.se
1498861659 gbpln15.seq
1475790089 gbpln150.seq
1380211964 gbpln1500.se
1129155752 gbpln1501.se
1160577179 gbpln1502.se
1260272465 gbpln1503.se
1277796255 gbpln1504.se
1077009676 gbpln1505.se
1159931140 gbpln1506.se
1298671970 gbpln1507.se
1092881838 gbpln1508.se
1120436751 gbpln1509.se
1477822066 gbpln151.seq
1214127484 gbpln1510.se
1117793568 gbpln1511.se
1019835845 gbpln1512.se
1155398208 gbpln1513.se
1368620547 gbpln1514.se
1144165987 gbpln1515.se
1072392038 gbpln1516.se
1310090643 gbpln1517.se
1319048580 gbpln1518.se
1215502441 gbpln1519.se
1462101378 gbpln152.seq
1273213186 gbpln1520.se
1439841249 gbpln1521.se
1291263009 gbpln1522.se
1286241610 gbpln1523.se
1263097019 gbpln1524.se
1297997061 gbpln1525.se
1325335047 gbpln1526.se
1216230086 gbpln1527.se
1263623365 gbpln1528.se
1174025246 gbpln1529.se
1497200933 gbpln153.seq
1229634720 gbpln1530.se
1363681880 gbpln1531.se
1218381114 gbpln1532.se
1400966274 gbpln1533.se
1382372152 gbpln1534.se
1176735776 gbpln1535.se
1259998472 gbpln1536.se
1429872810 gbpln1537.se
1290195552 gbpln1538.se
1118855412 gbpln1539.se
1497415098 gbpln154.seq
1286015571 gbpln1540.se
1309057752 gbpln1541.se
1189205456 gbpln1542.se
1088738989 gbpln1543.se
1310436046 gbpln1544.se
1233749054 gbpln1545.se
1059963756 gbpln1546.se
1254487335 gbpln1547.se
1310743734 gbpln1548.se
1233633287 gbpln1549.se
1230413080 gbpln155.seq
1257623330 gbpln1550.se
1136790411 gbpln1551.se
1024083293 gbpln1552.se
1208012116 gbpln1553.se
1341166334 gbpln1554.se
1178296123 gbpln1555.se
1133776595 gbpln1556.se
1321198791 gbpln1557.se
1307075748 gbpln1558.se
1194598078 gbpln1559.se
847363052 gbpln156.seq
1267960855 gbpln1560.se
1465597963 gbpln1561.se
1272760183 gbpln1562.se
1248553572 gbpln1563.se
997697304 gbpln1564.se
1273669316 gbpln1565.se
1102520926 gbpln1566.se
1209617689 gbpln1567.se
1111089281 gbpln1568.se
1160173181 gbpln1569.se
1005396841 gbpln157.seq
1205643241 gbpln1570.se
1237073747 gbpln1571.se
1242682599 gbpln1572.se
1080809269 gbpln1573.se
1226447695 gbpln1574.se
1349516392 gbpln1575.se
1175766613 gbpln1576.se
1216392639 gbpln1577.se
1306535163 gbpln1578.se
1471600767 gbpln1579.se
963947636 gbpln158.seq
1474480099 gbpln1580.se
1442648460 gbpln1581.se
1445144506 gbpln1582.se
1470808023 gbpln1583.se
1400146173 gbpln1584.se
1451194528 gbpln1585.se
1491931525 gbpln1586.se
1485075954 gbpln1587.se
1464218638 gbpln1588.se
1464354463 gbpln1589.se
1459631632 gbpln159.seq
1434708321 gbpln1590.se
1446304634 gbpln1591.se
1481913454 gbpln1592.se
225362530 gbpln1593.se
2549738660 gbpln1594.se
1967027328 gbpln1595.se
1908341558 gbpln1596.se
1899626925 gbpln1597.se
1507440270 gbpln1598.se
1195338085 gbpln1599.se
1499242007 gbpln16.seq
748612126 gbpln160.seq
1471685919 gbpln1600.se
1482476333 gbpln1601.se
1457504784 gbpln1602.se
1489313455 gbpln1603.se
1498865598 gbpln1604.se
997934006 gbpln1605.se
832020729 gbpln1606.se
803030138 gbpln1607.se
771628223 gbpln1608.se
1448711979 gbpln1609.se
952879187 gbpln161.seq
1240387718 gbpln1610.se
1254120972 gbpln1611.se
1355940856 gbpln1612.se
1218508495 gbpln1613.se
1405315859 gbpln1614.se
971627123 gbpln1615.se
850272715 gbpln1616.se
849609082 gbpln1617.se
850190924 gbpln1618.se
976829654 gbpln1619.se
925770625 gbpln162.seq
814643125 gbpln1620.se
879514342 gbpln1621.se
812317704 gbpln1622.se
1488237027 gbpln1623.se
944480603 gbpln1624.se
1488070952 gbpln1625.se
1498634832 gbpln1626.se
1496264712 gbpln1627.se
1489792519 gbpln1628.se
1231600041 gbpln1629.se
679052523 gbpln163.seq
1265330116 gbpln1630.se
1488619214 gbpln1631.se
1499817121 gbpln1632.se
1330362587 gbpln1633.se
1240461713 gbpln1634.se
1332036329 gbpln1635.se
1277787876 gbpln1636.se
1478171319 gbpln1637.se
1308033872 gbpln1638.se
1388656433 gbpln1639.se
891360401 gbpln164.seq
1443471168 gbpln1640.se
1413408953 gbpln1641.se
548537029 gbpln1642.se
1225077527 gbpln1643.se
720006493 gbpln1644.se
919172194 gbpln1645.se
874099561 gbpln1646.se
897784196 gbpln1647.se
876816853 gbpln1648.se
928190368 gbpln1649.se
983898073 gbpln165.seq
951802003 gbpln1650.se
824940722 gbpln1651.se
1489306195 gbpln1652.se
1440059389 gbpln1653.se
1482809012 gbpln1654.se
1486345764 gbpln1655.se
1467102609 gbpln1656.se
1478834238 gbpln1657.se
1444208200 gbpln1658.se
1483418667 gbpln1659.se
816632077 gbpln166.seq
1450848094 gbpln1660.se
1437771931 gbpln1661.se
1444812712 gbpln1662.se
1488993344 gbpln1663.se
1446871084 gbpln1664.se
1494839831 gbpln1665.se
1496741541 gbpln1666.se
1374411960 gbpln1667.se
1182248477 gbpln1668.se
1497598741 gbpln1669.se
1120135193 gbpln167.seq
1491491345 gbpln1670.se
1461709979 gbpln1671.se
1449889995 gbpln1672.se
1495849546 gbpln1673.se
1484634302 gbpln1674.se
1412074936 gbpln1675.se
1405761405 gbpln1676.se
1402453546 gbpln1677.se
1455644102 gbpln1678.se
1455814532 gbpln1679.se
972749686 gbpln168.seq
1446114329 gbpln1680.se
1446417320 gbpln1681.se
917155014 gbpln1682.se
1344094781 gbpln1683.se
1494221919 gbpln1684.se
1499592828 gbpln1685.se
1412833253 gbpln1686.se
1483609453 gbpln1687.se
1452520406 gbpln1688.se
1397047033 gbpln1689.se
850229174 gbpln169.seq
1363158169 gbpln1690.se
1095290873 gbpln1691.se
1407629769 gbpln1692.se
1467698693 gbpln1693.se
1475786928 gbpln1694.se
1473543989 gbpln1695.se
1177921624 gbpln1696.se
1429782007 gbpln1697.se
1449842921 gbpln1698.se
1191589738 gbpln1699.se
1499877669 gbpln17.seq
1055433660 gbpln170.seq
1497010592 gbpln1700.se
1315701164 gbpln1701.se
1281309867 gbpln1702.se
1464811778 gbpln1703.se
1494393829 gbpln1704.se
873807622 gbpln1705.se
1362396542 gbpln1706.se
1296127754 gbpln1707.se
1242755788 gbpln1708.se
1236451053 gbpln1709.se
1010018946 gbpln171.seq
1161997091 gbpln1710.se
1077269694 gbpln1711.se
1063032754 gbpln1712.se
1035835981 gbpln1713.se
1035095313 gbpln1714.se
1031632940 gbpln1715.se
978747642 gbpln1716.se
979039775 gbpln1717.se
970029823 gbpln1718.se
965223462 gbpln1719.se
649020564 gbpln172.seq
968357268 gbpln1720.se
1280849387 gbpln1721.se
1277873606 gbpln1722.se
1033073499 gbpln1723.se
1255917596 gbpln1724.se
1033902901 gbpln1725.se
1338307356 gbpln1726.se
1253985607 gbpln1727.se
1211059423 gbpln1728.se
1165332095 gbpln1729.se
926976142 gbpln173.seq
1473761940 gbpln1730.se
1478507707 gbpln1731.se
1406604626 gbpln1732.se
1497359305 gbpln1733.se
1498148324 gbpln1734.se
1470135810 gbpln1735.se
1271154552 gbpln1736.se
1449537429 gbpln1737.se
878967169 gbpln1738.se
1355240038 gbpln1739.se
1412030056 gbpln174.seq
1480516680 gbpln1740.se
1497401637 gbpln1741.se
1490481944 gbpln1742.se
1420494202 gbpln1743.se
1392744913 gbpln1744.se
1498251308 gbpln1745.se
1248523234 gbpln1746.se
1455420277 gbpln1747.se
1417475415 gbpln1748.se
1382790154 gbpln1749.se
1356887733 gbpln175.seq
1392095099 gbpln1750.se
1438579339 gbpln1751.se
1435206085 gbpln1752.se
1438544862 gbpln1753.se
1473935428 gbpln1754.se
1447579761 gbpln1755.se
1397298339 gbpln1756.se
1202495428 gbpln1757.se
1159422590 gbpln1758.se
1142132932 gbpln1759.se
1468866068 gbpln176.seq
1041331622 gbpln1760.se
957152555 gbpln1761.se
1081839501 gbpln1762.se
1445552919 gbpln1763.se
1319425564 gbpln1764.se
1268533720 gbpln1765.se
1109648066 gbpln1766.se
1486501664 gbpln1767.se
1497707315 gbpln1768.se
1422234672 gbpln1769.se
1486380476 gbpln177.seq
1489590944 gbpln1770.se
1478227713 gbpln1771.se
1402600454 gbpln1772.se
1491759977 gbpln1773.se
1344663270 gbpln1774.se
725493360 gbpln1775.se
868135523 gbpln1776.se
882846605 gbpln1777.se
797751389 gbpln1778.se
806424461 gbpln1779.se
1483755130 gbpln178.seq
733757044 gbpln1780.se
1273734389 gbpln1781.se
1332600147 gbpln1782.se
1391180272 gbpln1783.se
1460414227 gbpln1784.se
1492816679 gbpln1785.se
1449473974 gbpln1786.se
1430029422 gbpln1787.se
1067644063 gbpln1788.se
1460876656 gbpln1789.se
1471551413 gbpln179.seq
1372324559 gbpln1790.se
807214472 gbpln1791.se
1476620950 gbpln1792.se
1383029421 gbpln1793.se
1407240135 gbpln1794.se
823995636 gbpln1795.se
779758590 gbpln1796.se
767138463 gbpln1797.se
1459415295 gbpln1798.se
1318422290 gbpln1799.se
1492321788 gbpln18.seq
1430360286 gbpln180.seq
809577106 gbpln1800.se
767635813 gbpln1801.se
1472481285 gbpln1802.se
1489014285 gbpln1803.se
1470984315 gbpln1804.se
783356383 gbpln1805.se
768556688 gbpln1806.se
1437743364 gbpln1807.se
1455697771 gbpln1808.se
827116263 gbpln1809.se
1354708414 gbpln181.seq
785947999 gbpln1810.se
765845200 gbpln1811.se
1449229608 gbpln1812.se
1406361789 gbpln1813.se
789953322 gbpln1814.se
1476310111 gbpln1815.se
1381424733 gbpln1816.se
1399187032 gbpln1817.se
828245843 gbpln1818.se
784946746 gbpln1819.se
1360985782 gbpln182.seq
762930721 gbpln1820.se
1442020097 gbpln1821.se
1446746274 gbpln1822.se
839668894 gbpln1823.se
780847594 gbpln1824.se
766352668 gbpln1825.se
1433384069 gbpln1826.se
1448399892 gbpln1827.se
830761006 gbpln1828.se
781576153 gbpln1829.se
1498274774 gbpln183.seq
770532847 gbpln1830.se
1451368039 gbpln1831.se
1456351185 gbpln1832.se
1469113773 gbpln1833.se
1493659421 gbpln1834.se
1334364137 gbpln1835.se
1341348990 gbpln1836.se
1487354963 gbpln1837.se
443688365 gbpln1838.se
1310990192 gbpln1839.se
1493955474 gbpln184.seq
936978374 gbpln1840.se
920269142 gbpln1841.se
883112886 gbpln1842.se
832543127 gbpln1843.se
1498857428 gbpln1844.se
1476584173 gbpln1845.se
952859598 gbpln1846.se
787766863 gbpln1847.se
1428004358 gbpln1848.se
755531660 gbpln1849.se
1431959754 gbpln185.seq
1480074698 gbpln1850.se
1469627882 gbpln1851.se
1183963878 gbpln1852.se
1240333955 gbpln1853.se
1318953961 gbpln1854.se
1188607975 gbpln1855.se
1366617485 gbpln1856.se
1335944846 gbpln1857.se
1266250426 gbpln1858.se
1452816684 gbpln1859.se
1485055855 gbpln186.seq
780043620 gbpln1860.se
905108798 gbpln1861.se
1382990824 gbpln1862.se
1232901940 gbpln1863.se
1440152635 gbpln1864.se
1168368744 gbpln1865.se
1199437811 gbpln1866.se
750909446 gbpln1867.se
1409079072 gbpln1868.se
1372624455 gbpln1869.se
1485757436 gbpln187.seq
1289743162 gbpln1870.se
1460859481 gbpln1871.se
790727412 gbpln1872.se
902368242 gbpln1873.se
1499845871 gbpln1874.se
1365966046 gbpln1875.se
1438204134 gbpln188.seq
1426149679 gbpln189.seq
1498836297 gbpln19.seq
1497872888 gbpln190.seq
1495081791 gbpln191.seq
1484404197 gbpln192.seq
1482220170 gbpln193.seq
1480457424 gbpln194.seq
1491210797 gbpln195.seq
1493134101 gbpln196.seq
1493792066 gbpln197.seq
1480359996 gbpln198.seq
1477246073 gbpln199.seq
1499996634 gbpln2.seq
1493444162 gbpln20.seq
1474958682 gbpln200.seq
1499996520 gbpln201.seq
1499999980 gbpln202.seq
1499997700 gbpln203.seq
931486813 gbpln204.seq
1442962999 gbpln205.seq
1432829714 gbpln206.seq
1493844141 gbpln207.seq
838266744 gbpln208.seq
786074578 gbpln209.seq
1461570444 gbpln21.seq
1469406697 gbpln210.seq
1351709444 gbpln211.seq
1499970886 gbpln212.seq
1499998501 gbpln213.seq
1499999242 gbpln214.seq
1499992267 gbpln215.seq
1499999524 gbpln216.seq
1499998942 gbpln217.seq
1499999650 gbpln218.seq
1489481842 gbpln219.seq
1405009495 gbpln22.seq
1444795352 gbpln220.seq
1495724689 gbpln221.seq
968409350 gbpln222.seq
665291577 gbpln223.seq
860028189 gbpln224.seq
800605872 gbpln225.seq
794469115 gbpln226.seq
1492903391 gbpln227.seq
1017585126 gbpln228.seq
924325157 gbpln229.seq
1410349024 gbpln23.seq
1201978654 gbpln230.seq
1227268207 gbpln231.seq
1152253241 gbpln232.seq
1115248374 gbpln233.seq
1125506105 gbpln234.seq
1145303472 gbpln235.seq
1479140921 gbpln236.seq
1462365456 gbpln237.seq
1468069807 gbpln238.seq
724345875 gbpln239.seq
1486602472 gbpln24.seq
887561680 gbpln240.seq
834970472 gbpln241.seq
826391913 gbpln242.seq
792513917 gbpln243.seq
743209872 gbpln244.seq
1498927764 gbpln245.seq
860028189 gbpln246.seq
800605872 gbpln247.seq
794469115 gbpln248.seq
1492903391 gbpln249.seq
1447069404 gbpln25.seq
997390426 gbpln250.seq
663098252 gbpln251.seq
855592604 gbpln252.seq
807031053 gbpln253.seq
793905039 gbpln254.seq
1491456147 gbpln255.seq
1466632070 gbpln256.seq
840180304 gbpln257.seq
796430245 gbpln258.seq
779180715 gbpln259.seq
1443978080 gbpln26.seq
1486604510 gbpln260.seq
1445385427 gbpln261.seq
831209396 gbpln262.seq
783682955 gbpln263.seq
775938782 gbpln264.seq
1442399440 gbpln265.seq
1471877377 gbpln266.seq
872662143 gbpln267.seq
815663229 gbpln268.seq
813528167 gbpln269.seq
1431713844 gbpln27.seq
780491844 gbpln270.seq
734904793 gbpln271.seq
1451981137 gbpln272.seq
824184474 gbpln273.seq
768070182 gbpln274.seq
1491145948 gbpln275.seq
1472604409 gbpln276.seq
1481497172 gbpln277.seq
783385752 gbpln278.seq
770520351 gbpln279.seq
1433132237 gbpln28.seq
1452863252 gbpln280.seq
1486785182 gbpln281.seq
906907390 gbpln282.seq
844110716 gbpln283.seq
841780855 gbpln284.seq
805270043 gbpln285.seq
764396863 gbpln286.seq
841492595 gbpln287.seq
714482811 gbpln288.seq
916127997 gbpln289.seq
1420175010 gbpln29.seq
858459407 gbpln290.seq
848936990 gbpln291.seq
813129213 gbpln292.seq
765593150 gbpln293.seq
862731158 gbpln294.seq
665885634 gbpln295.seq
854365265 gbpln296.seq
802776346 gbpln297.seq
793295912 gbpln298.seq
1480158894 gbpln299.seq
1499949328 gbpln3.seq
1462499991 gbpln30.seq
1429544600 gbpln300.seq
814320946 gbpln301.seq
759349720 gbpln302.seq
1487159826 gbpln303.seq
1463992028 gbpln304.seq
684180819 gbpln305.seq
873292213 gbpln306.seq
827422505 gbpln307.seq
815925825 gbpln308.seq
779009585 gbpln309.seq
1361699247 gbpln31.seq
739747654 gbpln310.seq
1498046242 gbpln311.seq
849628701 gbpln312.seq
803882830 gbpln313.seq
794420470 gbpln314.seq
1474790996 gbpln315.seq
1469965572 gbpln316.seq
854770002 gbpln317.seq
805931576 gbpln318.seq
798923954 gbpln319.seq
1405185513 gbpln32.seq
1489544894 gbpln320.seq
1467528130 gbpln321.seq
854339916 gbpln322.seq
803900400 gbpln323.seq
791449620 gbpln324.seq
1476207543 gbpln325.seq
1475343864 gbpln326.seq
870939392 gbpln327.seq
809408813 gbpln328.seq
801514137 gbpln329.seq
1469659294 gbpln33.seq
1492438448 gbpln330.seq
1476330312 gbpln331.seq
846934671 gbpln332.seq
794708793 gbpln333.seq
789781753 gbpln334.seq
1475691254 gbpln335.seq
1489470879 gbpln336.seq
888406351 gbpln337.seq
835271741 gbpln338.seq
823533989 gbpln339.seq
1463842015 gbpln34.seq
787819193 gbpln340.seq
748786657 gbpln341.seq
1483648703 gbpln342.seq
1197559587 gbpln343.seq
898446949 gbpln344.seq
628489896 gbpln345.seq
1024113089 gbpln346.seq
1032878661 gbpln347.seq
858694781 gbpln348.seq
960391204 gbpln349.seq
1498027548 gbpln35.seq
1090094606 gbpln350.seq
781959143 gbpln351.seq
946995961 gbpln352.seq
857542781 gbpln353.seq
656405285 gbpln354.seq
907889097 gbpln355.seq
896386890 gbpln356.seq
726432335 gbpln357.seq
798296822 gbpln358.seq
918393750 gbpln359.seq
1351882593 gbpln36.seq
584961784 gbpln360.seq
948865971 gbpln361.seq
954536271 gbpln362.seq
819735731 gbpln363.seq
756588093 gbpln364.seq
876067119 gbpln365.seq
625446321 gbpln366.seq
977801494 gbpln367.seq
854357980 gbpln368.seq
807732556 gbpln369.seq
1351800954 gbpln37.seq
947696453 gbpln370.seq
1067629605 gbpln371.seq
822222048 gbpln372.seq
950272996 gbpln373.seq
1488985571 gbpln374.seq
894745096 gbpln375.seq
893352134 gbpln376.seq
1498806035 gbpln377.seq
1491810166 gbpln378.seq
933986451 gbpln379.seq
1468650835 gbpln38.seq
939527664 gbpln380.seq
810117922 gbpln381.seq
765938558 gbpln382.seq
886537018 gbpln383.seq
623519964 gbpln384.seq
996940649 gbpln385.seq
1030190034 gbpln386.seq
832828033 gbpln387.seq
956342979 gbpln388.seq
1134286144 gbpln389.seq
1469755843 gbpln39.seq
790513299 gbpln390.seq
944161893 gbpln391.seq
860035788 gbpln392.seq
647268685 gbpln393.seq
902239623 gbpln394.seq
1345936752 gbpln395.seq
787834228 gbpln396.seq
910724363 gbpln397.seq
606016896 gbpln398.seq
961485234 gbpln399.seq
1484665361 gbpln4.seq
1497034040 gbpln40.seq
1242775191 gbpln400.seq
1453328788 gbpln401.seq
818591771 gbpln402.seq
766580884 gbpln403.seq
1476620557 gbpln404.seq
1460693671 gbpln405.seq
750738544 gbpln406.seq
1496665003 gbpln407.seq
995069022 gbpln408.seq
1012956234 gbpln409.seq
1492343636 gbpln41.seq
827074347 gbpln410.seq
940621783 gbpln411.seq
1079418810 gbpln412.seq
776922106 gbpln413.seq
938380968 gbpln414.seq
1492330319 gbpln415.seq
891714442 gbpln416.seq
878638403 gbpln417.seq
721632671 gbpln418.seq
779156122 gbpln419.seq
1499134618 gbpln42.seq
895553446 gbpln420.seq
604678568 gbpln421.seq
931006295 gbpln422.seq
933660027 gbpln423.seq
810459540 gbpln424.seq
761872100 gbpln425.seq
878702815 gbpln426.seq
627081460 gbpln427.seq
994320235 gbpln428.seq
999434327 gbpln429.seq
1497555328 gbpln43.seq
823789349 gbpln430.seq
945629782 gbpln431.seq
1062113821 gbpln432.seq
792298939 gbpln433.seq
941851700 gbpln434.seq
850142413 gbpln435.seq
656955691 gbpln436.seq
904094753 gbpln437.seq
900193903 gbpln438.seq
1470079206 gbpln439.seq
1482367657 gbpln44.seq
1497721340 gbpln440.seq
937117048 gbpln441.seq
936021119 gbpln442.seq
812696702 gbpln443.seq
746628212 gbpln444.seq
897168807 gbpln445.seq
626698501 gbpln446.seq
1007072101 gbpln447.seq
1000831797 gbpln448.seq
841918855 gbpln449.seq
1489311909 gbpln45.seq
963426816 gbpln450.seq
1093654114 gbpln451.seq
791118382 gbpln452.seq
959940756 gbpln453.seq
853263842 gbpln454.seq
648051398 gbpln455.seq
901282075 gbpln456.seq
923491092 gbpln457.seq
732477869 gbpln458.seq
789987733 gbpln459.seq
1445921549 gbpln46.seq
926022053 gbpln460.seq
610840579 gbpln461.seq
949759032 gbpln462.seq
955444559 gbpln463.seq
818480442 gbpln464.seq
752251380 gbpln465.seq
897893149 gbpln466.seq
631111272 gbpln467.seq
1022032953 gbpln468.seq
1006306956 gbpln469.seq
1443373575 gbpln47.seq
837035085 gbpln470.seq
966140819 gbpln471.seq
1090560006 gbpln472.seq
800164754 gbpln473.seq
959884028 gbpln474.seq
886916735 gbpln475.seq
641540050 gbpln476.seq
910168783 gbpln477.seq
908785549 gbpln478.seq
729527181 gbpln479.seq
1498200088 gbpln48.seq
797552105 gbpln480.seq
910975470 gbpln481.seq
616026199 gbpln482.seq
945685366 gbpln483.seq
953145956 gbpln484.seq
820081609 gbpln485.seq
763165947 gbpln486.seq
1489098826 gbpln487.seq
1009123187 gbpln488.seq
1016689515 gbpln489.seq
1373091983 gbpln49.seq
832912303 gbpln490.seq
952656374 gbpln491.seq
1065835283 gbpln492.seq
776075044 gbpln493.seq
935940025 gbpln494.seq
1488231655 gbpln495.seq
1487557825 gbpln496.seq
720169483 gbpln497.seq
780564861 gbpln498.seq
1499144496 gbpln499.seq
1441200989 gbpln5.seq
1426038992 gbpln50.seq
934713391 gbpln500.seq
1233388213 gbpln501.seq
807542511 gbpln502.seq
757881986 gbpln503.seq
889760627 gbpln504.seq
635890046 gbpln505.seq
1007873898 gbpln506.seq
1015524558 gbpln507.seq
836625022 gbpln508.seq
959076059 gbpln509.seq
1434527576 gbpln51.seq
1077416379 gbpln510.seq
789416089 gbpln511.seq
958430056 gbpln512.seq
877922843 gbpln513.seq
648665455 gbpln514.seq
907513209 gbpln515.seq
904978028 gbpln516.seq
727024880 gbpln517.seq
789120540 gbpln518.seq
898507915 gbpln519.seq
1477836807 gbpln52.seq
617229811 gbpln520.seq
942711764 gbpln521.seq
964780021 gbpln522.seq
818917331 gbpln523.seq
755294557 gbpln524.seq
882064051 gbpln525.seq
627203691 gbpln526.seq
993595919 gbpln527.seq
1021497440 gbpln528.seq
827286497 gbpln529.seq
1479480118 gbpln53.seq
962451301 gbpln530.seq
1082256067 gbpln531.seq
781463827 gbpln532.seq
919665368 gbpln533.seq
1497522046 gbpln534.seq
905574854 gbpln535.seq
906714977 gbpln536.seq
718743537 gbpln537.seq
787529633 gbpln538.seq
910251919 gbpln539.seq
1319684527 gbpln54.seq
608518276 gbpln540.seq
934541265 gbpln541.seq
954054955 gbpln542.seq
806443717 gbpln543.seq
1009766480 gbpln544.seq
1318260463 gbpln545.seq
1253136609 gbpln546.seq
1066198175 gbpln547.seq
1119572655 gbpln548.seq
1040217505 gbpln549.seq
1291834351 gbpln55.seq
1310077288 gbpln550.seq
955690374 gbpln551.seq
1230684440 gbpln552.seq
1179787958 gbpln553.seq
1125383520 gbpln554.seq
1051194518 gbpln555.seq
965656648 gbpln556.seq
1363518112 gbpln557.seq
1497325995 gbpln558.seq
787261705 gbpln559.seq
1497065990 gbpln56.seq
773098599 gbpln560.seq
1456694585 gbpln561.seq
1200145527 gbpln562.seq
1449107426 gbpln563.seq
1445293522 gbpln564.seq
1219201533 gbpln565.seq
1281941476 gbpln566.seq
1485920790 gbpln567.seq
1322806126 gbpln568.seq
756143249 gbpln569.seq
1495889390 gbpln57.seq
878426054 gbpln570.seq
631056251 gbpln571.seq
993852367 gbpln572.seq
1020132695 gbpln573.seq
830166807 gbpln574.seq
955723315 gbpln575.seq
1057964328 gbpln576.seq
784007552 gbpln577.seq
947940191 gbpln578.seq
857511193 gbpln579.seq
1287363361 gbpln58.seq
649137171 gbpln580.seq
903393879 gbpln581.seq
908180396 gbpln582.seq
721135945 gbpln583.seq
786739709 gbpln584.seq
918070756 gbpln585.seq
603192844 gbpln586.seq
938102555 gbpln587.seq
955978436 gbpln588.seq
1498148306 gbpln589.seq
1314132044 gbpln59.seq
1442851988 gbpln590.seq
768159651 gbpln591.seq
891261263 gbpln592.seq
1017239134 gbpln593.seq
1036737053 gbpln594.seq
980587319 gbpln595.seq
1096962209 gbpln596.seq
964715275 gbpln597.seq
883795567 gbpln598.seq
879409471 gbpln599.seq
1472320537 gbpln6.seq
1499888056 gbpln60.seq
922242639 gbpln600.seq
805484043 gbpln601.seq
912391541 gbpln602.seq
954577618 gbpln603.seq
1499998343 gbpln604.seq
1499998184 gbpln605.seq
1499811182 gbpln606.seq
1499821684 gbpln607.seq
1499904843 gbpln608.seq
1500000036 gbpln609.seq
1441635456 gbpln61.seq
1499998132 gbpln610.seq
1499945008 gbpln611.seq
1499388631 gbpln612.seq
1499807211 gbpln613.seq
1499997899 gbpln614.seq
1499841232 gbpln615.seq
1499982986 gbpln616.seq
1467355641 gbpln617.seq
723245216 gbpln618.seq
865045961 gbpln619.seq
1442701563 gbpln62.seq
815791689 gbpln620.seq
802718902 gbpln621.seq
1497835829 gbpln622.seq
1489200818 gbpln623.seq
873797632 gbpln624.seq
820367220 gbpln625.seq
806296382 gbpln626.seq
775209384 gbpln627.seq
744231520 gbpln628.seq
817156402 gbpln629.seq
1396494473 gbpln63.seq
771380170 gbpln630.seq
913253142 gbpln631.seq
634934982 gbpln632.seq
1019175188 gbpln633.seq
1023638564 gbpln634.seq
822225605 gbpln635.seq
961290952 gbpln636.seq
1090804562 gbpln637.seq
813694518 gbpln638.seq
962545328 gbpln639.seq
1357918367 gbpln64.seq
873725319 gbpln640.seq
673190932 gbpln641.seq
905064826 gbpln642.seq
908590682 gbpln643.seq
742712720 gbpln644.seq
793279946 gbpln645.seq
934932909 gbpln646.seq
640700840 gbpln647.seq
961568346 gbpln648.seq
952066709 gbpln649.seq
1227296142 gbpln65.seq
1470907411 gbpln650.seq
1315696038 gbpln651.seq
1451561486 gbpln652.seq
1409767917 gbpln653.seq
1192999645 gbpln654.seq
1105379400 gbpln655.seq
1196658436 gbpln656.seq
1136119548 gbpln657.seq
1284507799 gbpln658.seq
1122567296 gbpln659.seq
1477669894 gbpln66.seq
1192074506 gbpln660.seq
1181896740 gbpln661.seq
1430814492 gbpln662.seq
858786663 gbpln663.seq
1482575758 gbpln664.seq
1256005171 gbpln665.seq
1249214474 gbpln666.seq
1164522681 gbpln667.seq
1002097666 gbpln668.seq
1300955592 gbpln669.seq
1486392750 gbpln67.seq
1317957634 gbpln670.seq
1148040939 gbpln671.seq
1403417765 gbpln672.seq
1375754075 gbpln673.seq
1327873437 gbpln674.seq
1281078332 gbpln675.seq
1383451324 gbpln676.seq
1300107704 gbpln677.seq
1290738490 gbpln678.seq
1459920083 gbpln679.seq
1413265901 gbpln68.seq
1006352199 gbpln680.seq
962815279 gbpln681.seq
975138624 gbpln682.seq
906550423 gbpln683.seq
790269619 gbpln684.seq
956926034 gbpln685.seq
908369814 gbpln686.seq
1035806383 gbpln687.seq
1095241384 gbpln688.seq
889046375 gbpln689.seq
1497433984 gbpln69.seq
920177986 gbpln690.seq
934896187 gbpln691.seq
972756494 gbpln692.seq
1478454737 gbpln693.seq
1479400215 gbpln694.seq
1382640922 gbpln695.seq
1372701817 gbpln696.seq
1490030230 gbpln697.seq
1296249908 gbpln698.seq
1454591651 gbpln699.seq
1486763485 gbpln7.seq
1483539734 gbpln70.seq
1470492456 gbpln700.seq
1449617563 gbpln701.seq
1223515912 gbpln702.seq
1372955396 gbpln703.seq
1437909873 gbpln704.seq
1307026425 gbpln705.seq
1462620068 gbpln706.seq
1466603356 gbpln707.seq
1073063047 gbpln708.seq
890586335 gbpln709.seq
1318317824 gbpln71.seq
628166165 gbpln710.seq
1008494769 gbpln711.seq
987228439 gbpln712.seq
843057145 gbpln713.seq
959088226 gbpln714.seq
1080118899 gbpln715.seq
790032688 gbpln716.seq
943744807 gbpln717.seq
858758922 gbpln718.seq
664109823 gbpln719.seq
1495740283 gbpln72.seq
920678547 gbpln720.seq
888501596 gbpln721.seq
739915903 gbpln722.seq
788736235 gbpln723.seq
944601114 gbpln724.seq
621465898 gbpln725.seq
948555730 gbpln726.seq
954911742 gbpln727.seq
854893069 gbpln728.seq
752395251 gbpln729.seq
1490193530 gbpln73.seq
890282441 gbpln730.seq
626588937 gbpln731.seq
1004358313 gbpln732.seq
1028945402 gbpln733.seq
838465030 gbpln734.seq
950517847 gbpln735.seq
1082441570 gbpln736.seq
789583361 gbpln737.seq
950035125 gbpln738.seq
853507173 gbpln739.seq
1492749723 gbpln74.seq
659807142 gbpln740.seq
902654821 gbpln741.seq
890952839 gbpln742.seq
721824594 gbpln743.seq
785634142 gbpln744.seq
909002040 gbpln745.seq
625532225 gbpln746.seq
945667284 gbpln747.seq
953425672 gbpln748.seq
871481110 gbpln749.seq
1451376875 gbpln75.seq
1254084023 gbpln750.seq
1125916060 gbpln751.seq
1182821230 gbpln752.seq
1211366567 gbpln753.seq
746226477 gbpln754.seq
808684469 gbpln755.seq
907082918 gbpln756.seq
776688264 gbpln757.seq
1492098096 gbpln758.seq
1287386861 gbpln759.seq
1491338637 gbpln76.seq
1186027473 gbpln760.seq
1009876518 gbpln761.seq
1484585650 gbpln762.seq
1144766377 gbpln763.seq
752395251 gbpln764.seq
890282441 gbpln765.seq
626588937 gbpln766.seq
1004358313 gbpln767.seq
1028945402 gbpln768.seq
838465030 gbpln769.seq
1489169168 gbpln77.seq
950517847 gbpln770.seq
1082441570 gbpln771.seq
789583361 gbpln772.seq
950035125 gbpln773.seq
853507173 gbpln774.seq
659807142 gbpln775.seq
902654821 gbpln776.seq
890952839 gbpln777.seq
721824594 gbpln778.seq
785634142 gbpln779.seq
1409365495 gbpln78.seq
909002040 gbpln780.seq
625532225 gbpln781.seq
945667284 gbpln782.seq
953425672 gbpln783.seq
1496387869 gbpln784.seq
660302813 gbpln785.seq
841140962 gbpln786.seq
1479991498 gbpln787.seq
1471774772 gbpln788.seq
1499491526 gbpln789.seq
1472504601 gbpln79.seq
1497490496 gbpln790.seq
1492455770 gbpln791.seq
1465220219 gbpln792.seq
1469411527 gbpln793.seq
1468988514 gbpln794.seq
1470643875 gbpln795.seq
1445523370 gbpln796.seq
1467112589 gbpln797.seq
1473756313 gbpln798.seq
1467448952 gbpln799.seq
1422472053 gbpln8.seq
1449559676 gbpln80.seq
1445506294 gbpln800.seq
1405467369 gbpln801.seq
1440178564 gbpln802.seq
1419442824 gbpln803.seq
1343375454 gbpln804.seq
1368729073 gbpln805.seq
1441459202 gbpln806.seq
1481187930 gbpln807.seq
1441199233 gbpln808.seq
1400519486 gbpln809.seq
1481961805 gbpln81.seq
1484052531 gbpln810.seq
1375272260 gbpln811.seq
898515506 gbpln812.seq
632797874 gbpln813.seq
1008257523 gbpln814.seq
1024893589 gbpln815.seq
849343329 gbpln816.seq
961475028 gbpln817.seq
1105697901 gbpln818.seq
806976002 gbpln819.seq
1484043236 gbpln82.seq
970149905 gbpln820.seq
872154954 gbpln821.seq
676154112 gbpln822.seq
905516393 gbpln823.seq
922918521 gbpln824.seq
742368603 gbpln825.seq
788401116 gbpln826.seq
929538621 gbpln827.seq
641895628 gbpln828.seq
961976136 gbpln829.seq
1439343076 gbpln83.seq
973033369 gbpln830.seq
834845237 gbpln831.seq
1096228945 gbpln832.seq
1065747701 gbpln833.seq
978382753 gbpln834.seq
970377845 gbpln835.seq
932157797 gbpln836.seq
878151180 gbpln837.seq
874085481 gbpln838.seq
829265282 gbpln839.seq
1433849050 gbpln84.seq
863296712 gbpln840.seq
823515696 gbpln841.seq
815413878 gbpln842.seq
1384284611 gbpln843.seq
1351462558 gbpln844.seq
1230738646 gbpln845.seq
541733671 gbpln846.seq
2012725364 gbpln847.seq
2313576156 gbpln848.seq
2199353950 gbpln849.seq
1428892929 gbpln85.seq
2096617948 gbpln850.seq
2106642320 gbpln851.seq
1745413839 gbpln852.seq
1943630373 gbpln853.seq
1096169796 gbpln854.seq
836152673 gbpln855.seq
790234194 gbpln856.seq
768134126 gbpln857.seq
1464177021 gbpln858.seq
1454383718 gbpln859.seq
1437482363 gbpln86.seq
839765734 gbpln860.seq
794136795 gbpln861.seq
777214951 gbpln862.seq
1459963687 gbpln863.seq
1453910479 gbpln864.seq
831555004 gbpln865.seq
787385081 gbpln866.seq
774061568 gbpln867.seq
1444041489 gbpln868.seq
1462025010 gbpln869.seq
1434708607 gbpln87.seq
837904862 gbpln870.seq
793009108 gbpln871.seq
770582515 gbpln872.seq
1458992600 gbpln873.seq
1472670481 gbpln874.seq
837974598 gbpln875.seq
802983165 gbpln876.seq
776399714 gbpln877.seq
1452076153 gbpln878.seq
1467682458 gbpln879.seq
1446968733 gbpln88.seq
841987686 gbpln880.seq
800255273 gbpln881.seq
776782162 gbpln882.seq
765490377 gbpln883.seq
737409430 gbpln884.seq
1467554404 gbpln885.seq
838067528 gbpln886.seq
794050154 gbpln887.seq
769006556 gbpln888.seq
1456537014 gbpln889.seq
1455795139 gbpln89.seq
1456423618 gbpln890.seq
831709069 gbpln891.seq
788018841 gbpln892.seq
776335168 gbpln893.seq
1447227789 gbpln894.seq
1462058949 gbpln895.seq
831948387 gbpln896.seq
792155197 gbpln897.seq
764395261 gbpln898.seq
1469026352 gbpln899.seq
1201022408 gbpln9.seq
1470543353 gbpln90.seq
1457035184 gbpln900.seq
832913530 gbpln901.seq
783381752 gbpln902.seq
777226067 gbpln903.seq
1449010172 gbpln904.seq
1460033796 gbpln905.seq
856583955 gbpln906.seq
800941651 gbpln907.seq
764839741 gbpln908.seq
1463437686 gbpln909.seq
1379500687 gbpln91.seq
1457211427 gbpln910.seq
838548262 gbpln911.seq
802434968 gbpln912.seq
775426579 gbpln913.seq
1468251987 gbpln914.seq
1456996279 gbpln915.seq
836584180 gbpln916.seq
794556423 gbpln917.seq
763379902 gbpln918.seq
1472540375 gbpln919.seq
818536597 gbpln92.seq
1467456048 gbpln920.seq
841588737 gbpln921.seq
793586133 gbpln922.seq
774193866 gbpln923.seq
1483592340 gbpln924.seq
1464730710 gbpln925.seq
832767207 gbpln926.seq
787519847 gbpln927.seq
773580778 gbpln928.seq
1453968537 gbpln929.seq
744339770 gbpln93.seq
1458876981 gbpln930.seq
836647345 gbpln931.seq
804025438 gbpln932.seq
780287537 gbpln933.seq
1456910351 gbpln934.seq
1461116471 gbpln935.seq
847868245 gbpln936.seq
799503371 gbpln937.seq
769858205 gbpln938.seq
1451384310 gbpln939.seq
840483635 gbpln94.seq
1448178188 gbpln940.seq
841182040 gbpln941.seq
790643457 gbpln942.seq
771991395 gbpln943.seq
1449905950 gbpln944.seq
799948093 gbpln945.seq
836052022 gbpln946.seq
791807902 gbpln947.seq
771195580 gbpln948.seq
1452626436 gbpln949.seq
1482268557 gbpln95.seq
1452862184 gbpln950.seq
666670553 gbpln951.seq
841954476 gbpln952.seq
801058907 gbpln953.seq
777293272 gbpln954.seq
1485779605 gbpln955.seq
1452913122 gbpln956.seq
836617454 gbpln957.seq
790837079 gbpln958.seq
777459210 gbpln959.seq
1445216053 gbpln96.seq
1453527109 gbpln960.seq
1454781569 gbpln961.seq
839842770 gbpln962.seq
793797445 gbpln963.seq
776363694 gbpln964.seq
1456772381 gbpln965.seq
1466569983 gbpln966.seq
845148875 gbpln967.seq
804833074 gbpln968.seq
778470839 gbpln969.seq
1499019777 gbpln97.seq
1481006670 gbpln970.seq
1474068832 gbpln971.seq
794180239 gbpln972.seq
774312132 gbpln973.seq
1457303714 gbpln974.seq
835115957 gbpln975.seq
1457626964 gbpln976.seq
836718375 gbpln977.seq
801816183 gbpln978.seq
780710756 gbpln979.seq
1471007440 gbpln98.seq
1487855625 gbpln980.seq
1468374097 gbpln981.seq
835020954 gbpln982.seq
794498287 gbpln983.seq
775035873 gbpln984.seq
1474921681 gbpln985.seq
1459702204 gbpln986.seq
836763143 gbpln987.seq
794319484 gbpln988.seq
771563217 gbpln989.seq
1497460972 gbpln99.seq
1442336041 gbpln990.seq
1461924552 gbpln991.seq
835744192 gbpln992.seq
793808493 gbpln993.seq
775366858 gbpln994.seq
1452650569 gbpln995.seq
1461461119 gbpln996.seq
839340147 gbpln997.seq
793588554 gbpln998.seq
778845058 gbpln999.seq
1499992998 gbpri1.seq
1394043154 gbpri10.seq
1495964572 gbpri100.seq
1318392032 gbpri101.seq
1355571629 gbpri102.seq
1445745824 gbpri103.seq
1442671889 gbpri104.seq
1493536509 gbpri105.seq
1403137257 gbpri106.seq
1444919461 gbpri107.seq
1410522937 gbpri108.seq
1451687101 gbpri109.seq
1308233895 gbpri11.seq
1408933533 gbpri110.seq
1456495937 gbpri111.seq
1387816181 gbpri112.seq
1404931846 gbpri113.seq
1432578708 gbpri114.seq
1405440011 gbpri115.seq
1338627748 gbpri116.seq
1340905028 gbpri117.seq
1453101243 gbpri118.seq
1324362889 gbpri119.seq
1352591724 gbpri12.seq
1324397641 gbpri120.seq
1408571537 gbpri121.seq
1275737568 gbpri122.seq
1421464150 gbpri123.seq
1495167941 gbpri124.seq
1455208542 gbpri125.seq
1403991861 gbpri126.seq
1446257073 gbpri127.seq
1384095134 gbpri128.seq
1445278199 gbpri129.seq
1495555692 gbpri13.seq
1293353386 gbpri130.seq
1433367948 gbpri131.seq
1395378867 gbpri132.seq
1276602476 gbpri133.seq
1438054241 gbpri134.seq
1467541000 gbpri135.seq
1320863092 gbpri136.seq
1456536651 gbpri137.seq
1466610863 gbpri138.seq
1359780806 gbpri139.seq
1402237462 gbpri14.seq
1499943067 gbpri140.seq
1475693129 gbpri141.seq
1260750539 gbpri142.seq
1495098301 gbpri143.seq
1238904125 gbpri144.seq
1242283958 gbpri145.seq
1479001314 gbpri146.seq
1432304969 gbpri147.seq
1492676945 gbpri148.seq
1476290353 gbpri149.seq
1487902997 gbpri15.seq
1442607100 gbpri150.seq
1456981003 gbpri151.seq
1443625247 gbpri152.seq
1400092576 gbpri153.seq
1345137226 gbpri154.seq
1373185934 gbpri155.seq
1434010548 gbpri156.seq
1490297845 gbpri157.seq
1429267901 gbpri158.seq
1484585056 gbpri159.seq
1347857626 gbpri16.seq
1420880036 gbpri160.seq
1285024893 gbpri161.seq
1370173209 gbpri162.seq
1496306681 gbpri163.seq
1450180646 gbpri164.seq
1341467614 gbpri165.seq
1387332345 gbpri166.seq
1470704693 gbpri167.seq
1354403503 gbpri168.seq
1344504790 gbpri169.seq
1491380503 gbpri17.seq
1462427536 gbpri170.seq
1432074004 gbpri171.seq
1333079314 gbpri172.seq
1466026810 gbpri173.seq
1446816413 gbpri174.seq
1384264132 gbpri175.seq
1458853763 gbpri176.seq
1457412745 gbpri177.seq
1364294010 gbpri178.seq
1401919613 gbpri179.seq
1397668469 gbpri18.seq
1348141524 gbpri180.seq
1422975046 gbpri181.seq
1485417814 gbpri182.seq
1476689128 gbpri183.seq
1397626924 gbpri184.seq
1498120792 gbpri185.seq
1387697250 gbpri186.seq
1416144227 gbpri187.seq
1452703693 gbpri188.seq
1407035473 gbpri189.seq
1369669627 gbpri19.seq
1288712580 gbpri190.seq
1248506113 gbpri191.seq
1364854184 gbpri192.seq
1479558812 gbpri193.seq
1366753503 gbpri194.seq
1489166909 gbpri195.seq
1415801198 gbpri196.seq
1384022664 gbpri197.seq
1434572298 gbpri198.seq
1381901910 gbpri199.seq
1499865965 gbpri2.seq
1439722114 gbpri20.seq
1439604557 gbpri200.seq
1405041057 gbpri201.seq
1483127194 gbpri202.seq
1380666928 gbpri203.seq
1470392437 gbpri204.seq
1487830678 gbpri205.seq
1434611604 gbpri206.seq
1456507913 gbpri207.seq
1404327410 gbpri208.seq
1478530987 gbpri209.seq
1499998573 gbpri21.seq
1216965101 gbpri210.seq
1446664469 gbpri211.seq
1423350776 gbpri212.seq
1494349874 gbpri213.seq
1462051519 gbpri214.seq
1487459860 gbpri215.seq
1346932542 gbpri216.seq
1435992514 gbpri217.seq
1471040937 gbpri218.seq
1411620583 gbpri219.seq
1499972210 gbpri22.seq
1484773618 gbpri220.seq
1346264468 gbpri221.seq
1341625721 gbpri222.seq
1396369090 gbpri223.seq
1400881270 gbpri224.seq
1340397469 gbpri225.seq
1438615217 gbpri226.seq
1325442546 gbpri227.seq
1351884774 gbpri228.seq
1453347110 gbpri229.seq
1433886473 gbpri23.seq
1476115506 gbpri230.seq
1364420628 gbpri231.seq
1472683653 gbpri232.seq
1471719526 gbpri233.seq
1426931843 gbpri234.seq
1473415294 gbpri235.seq
1433692077 gbpri236.seq
1419022466 gbpri237.seq
1462223561 gbpri238.seq
1281714719 gbpri239.seq
1499229052 gbpri24.seq
1459018558 gbpri240.seq
1384280699 gbpri241.seq
1371120703 gbpri242.seq
1466988530 gbpri243.seq
1499909991 gbpri244.seq
1421428560 gbpri245.seq
1498574461 gbpri246.seq
1460703428 gbpri247.seq
1470716420 gbpri248.seq
1433800361 gbpri249.seq
1487414233 gbpri25.seq
1480017837 gbpri250.seq
1376936902 gbpri251.seq
1400467397 gbpri252.seq
1475236263 gbpri253.seq
1496630249 gbpri254.seq
1468620991 gbpri255.seq
1474162791 gbpri256.seq
1396104189 gbpri257.seq
1346586479 gbpri258.seq
1347952902 gbpri259.seq
1493262066 gbpri26.seq
1298764233 gbpri260.seq
1427293566 gbpri261.seq
1494008872 gbpri262.seq
1470822249 gbpri263.seq
1419747378 gbpri264.seq
1464271928 gbpri265.seq
1450721835 gbpri266.seq
1396794441 gbpri267.seq
1499094281 gbpri268.seq
1462020778 gbpri269.seq
1407053883 gbpri27.seq
1456716634 gbpri270.seq
1423150660 gbpri271.seq
1334733868 gbpri272.seq
1477093306 gbpri273.seq
1401382229 gbpri274.seq
1344819957 gbpri275.seq
1335018581 gbpri276.seq
1393585317 gbpri277.seq
1492681989 gbpri278.seq
1394057394 gbpri279.seq
1441456060 gbpri28.seq
1306374829 gbpri280.seq
1459492320 gbpri281.seq
1283178271 gbpri282.seq
1394896273 gbpri283.seq
1413425043 gbpri284.seq
1411752861 gbpri285.seq
1458158066 gbpri286.seq
1447911944 gbpri287.seq
1416279069 gbpri288.seq
1354359649 gbpri289.seq
1380240636 gbpri29.seq
1335473768 gbpri290.seq
1477859325 gbpri291.seq
1444661086 gbpri292.seq
1220138079 gbpri293.seq
1454577601 gbpri294.seq
1318715138 gbpri295.seq
1387096617 gbpri296.seq
1386291267 gbpri297.seq
1285515157 gbpri298.seq
1381683190 gbpri299.seq
1499835984 gbpri3.seq
1416177736 gbpri30.seq
1315306325 gbpri300.seq
1344125998 gbpri301.seq
1479620330 gbpri302.seq
1397358101 gbpri303.seq
1380192545 gbpri304.seq
1351740135 gbpri305.seq
1389255921 gbpri306.seq
1454933355 gbpri307.seq
1483361280 gbpri308.seq
1487165286 gbpri309.seq
1449889074 gbpri31.seq
1483238733 gbpri310.seq
1437384214 gbpri311.seq
1449717924 gbpri312.seq
1347588235 gbpri313.seq
1454975982 gbpri314.seq
1420356842 gbpri315.seq
1298170956 gbpri316.seq
1423364495 gbpri317.seq
1446686181 gbpri318.seq
1382434322 gbpri319.seq
1490919852 gbpri32.seq
1336368762 gbpri320.seq
1465383649 gbpri321.seq
1484781680 gbpri322.seq
1443957160 gbpri323.seq
1454606590 gbpri324.seq
1469781588 gbpri325.seq
1450937924 gbpri326.seq
1394994063 gbpri327.seq
1406591232 gbpri328.seq
1357023920 gbpri329.seq
1466190397 gbpri33.seq
1427953248 gbpri330.seq
1447872000 gbpri331.seq
1338229282 gbpri332.seq
1403835377 gbpri333.seq
1429580186 gbpri334.seq
1248333550 gbpri335.seq
1402508561 gbpri336.seq
1422378175 gbpri337.seq
1452195282 gbpri338.seq
1305786268 gbpri339.seq
1440000495 gbpri34.seq
1499725723 gbpri340.seq
1491467888 gbpri341.seq
1430438158 gbpri342.seq
1460937361 gbpri343.seq
1465691916 gbpri344.seq
1497771895 gbpri345.seq
1404242887 gbpri346.seq
1450577537 gbpri347.seq
1392382627 gbpri348.seq
1432052149 gbpri349.seq
1299250150 gbpri35.seq
1334212373 gbpri350.seq
1429020982 gbpri351.seq
1423811698 gbpri352.seq
1384476752 gbpri353.seq
1376938780 gbpri354.seq
1315743817 gbpri355.seq
1296914866 gbpri356.seq
1375431616 gbpri357.seq
1499104053 gbpri358.seq
1337266903 gbpri359.seq
1441505962 gbpri36.seq
1387658377 gbpri360.seq
1447004941 gbpri361.seq
1428215933 gbpri362.seq
1356652960 gbpri363.seq
1450829410 gbpri364.seq
1334734998 gbpri365.seq
1204021778 gbpri366.seq
1242592154 gbpri367.seq
1428199143 gbpri368.seq
1315803328 gbpri369.seq
1442377437 gbpri37.seq
1482804994 gbpri370.seq
1476541419 gbpri371.seq
1332772828 gbpri372.seq
1348388802 gbpri373.seq
1317135705 gbpri374.seq
1471839736 gbpri375.seq
1349875606 gbpri376.seq
1449336746 gbpri377.seq
1481089824 gbpri378.seq
1452204000 gbpri379.seq
1454058016 gbpri38.seq
1433019350 gbpri380.seq
1405902907 gbpri381.seq
1430080558 gbpri382.seq
1485814493 gbpri383.seq
1481394732 gbpri384.seq
1493952422 gbpri385.seq
1483650864 gbpri386.seq
1498174621 gbpri387.seq
1332498510 gbpri388.seq
1492344318 gbpri389.seq
1499749892 gbpri39.seq
1344939899 gbpri390.seq
1374624317 gbpri391.seq
1489875387 gbpri392.seq
1437646849 gbpri393.seq
1485043933 gbpri394.seq
1485744358 gbpri395.seq
1492874798 gbpri396.seq
1482252028 gbpri397.seq
1439310195 gbpri398.seq
1482378168 gbpri399.seq
1499966483 gbpri4.seq
1436112761 gbpri40.seq
1499242761 gbpri400.seq
1442385277 gbpri401.seq
1399203187 gbpri402.seq
1469910956 gbpri403.seq
1444342128 gbpri404.seq
1452739846 gbpri405.seq
1499355586 gbpri406.seq
1489531864 gbpri407.seq
1499124071 gbpri408.seq
1398185797 gbpri409.seq
1447805077 gbpri41.seq
1484387503 gbpri410.seq
1463231009 gbpri411.seq
1462310583 gbpri412.seq
1492396590 gbpri413.seq
1422294696 gbpri414.seq
1485131116 gbpri415.seq
1446691494 gbpri416.seq
1450290362 gbpri417.seq
1493916949 gbpri418.seq
1400353287 gbpri419.seq
1469953918 gbpri42.seq
1436356154 gbpri420.seq
1494870306 gbpri421.seq
1478354423 gbpri422.seq
1489520482 gbpri423.seq
1450655713 gbpri424.seq
1495820714 gbpri425.seq
1493735476 gbpri426.seq
1498619752 gbpri427.seq
1491875632 gbpri428.seq
1497685449 gbpri429.seq
1339666235 gbpri43.seq
1460652003 gbpri430.seq
1458781711 gbpri431.seq
1448622684 gbpri432.seq
1379265128 gbpri433.seq
1485291162 gbpri434.seq
1429631124 gbpri435.seq
1421359972 gbpri436.seq
1479107154 gbpri437.seq
1477232500 gbpri438.seq
1494815850 gbpri439.seq
1445286112 gbpri44.seq
1475640926 gbpri440.seq
1495435072 gbpri441.seq
1499853000 gbpri442.seq
1453600199 gbpri443.seq
1449675356 gbpri444.seq
1441802866 gbpri445.seq
1459507426 gbpri446.seq
1499899011 gbpri447.seq
1422394893 gbpri448.seq
1488584120 gbpri449.seq
1458190513 gbpri45.seq
1366139865 gbpri450.seq
1489791401 gbpri451.seq
1429504375 gbpri452.seq
1494493572 gbpri453.seq
1459477896 gbpri454.seq
1499861206 gbpri455.seq
1478968579 gbpri456.seq
1383168329 gbpri457.seq
1490208533 gbpri458.seq
1481469183 gbpri459.seq
1496305448 gbpri46.seq
1487358118 gbpri460.seq
1418280729 gbpri461.seq
1469473522 gbpri462.seq
1475609586 gbpri463.seq
1483950167 gbpri464.seq
1498266223 gbpri465.seq
1481885255 gbpri466.seq
1455217837 gbpri467.seq
1499971714 gbpri468.seq
1470603011 gbpri469.seq
1486466591 gbpri47.seq
1490055628 gbpri470.seq
1487820198 gbpri471.seq
1492122670 gbpri472.seq
1499621014 gbpri473.seq
1392665956 gbpri474.seq
1497966034 gbpri475.seq
1407245725 gbpri476.seq
1494936297 gbpri477.seq
1464587120 gbpri478.seq
1489388730 gbpri479.seq
1499237528 gbpri48.seq
1453664132 gbpri480.seq
1469874871 gbpri481.seq
1485936595 gbpri482.seq
1464835790 gbpri483.seq
1372581275 gbpri484.seq
1299804542 gbpri485.seq
1498843546 gbpri486.seq
1408871474 gbpri487.seq
1425713151 gbpri488.seq
1438590915 gbpri489.seq
1478814770 gbpri49.seq
1382106129 gbpri490.seq
1464637518 gbpri491.seq
1471163774 gbpri492.seq
1442864381 gbpri493.seq
1497298252 gbpri494.seq
1475522136 gbpri495.seq
1479264018 gbpri496.seq
1455146899 gbpri497.seq
1464226394 gbpri498.seq
1486631211 gbpri499.seq
1499769578 gbpri5.seq
1226472415 gbpri50.seq
1473480932 gbpri500.seq
1458695948 gbpri501.seq
1494522166 gbpri502.seq
1454977289 gbpri503.seq
1437991993 gbpri504.seq
1412405226 gbpri505.seq
1463354391 gbpri506.seq
1498494333 gbpri507.seq
1475240191 gbpri508.seq
1473139012 gbpri509.seq
1410747376 gbpri51.seq
1385796031 gbpri510.seq
1421911234 gbpri511.seq
1481060464 gbpri512.seq
1478696369 gbpri513.seq
1479338477 gbpri514.seq
1498211811 gbpri515.seq
1482951586 gbpri516.seq
1494526720 gbpri517.seq
1431030255 gbpri518.seq
1454888822 gbpri519.seq
1373045505 gbpri52.seq
1485236484 gbpri520.seq
1430456405 gbpri521.seq
1455322553 gbpri522.seq
1416195512 gbpri523.seq
1354257429 gbpri524.seq
1467014700 gbpri525.seq
1493520053 gbpri526.seq
1436826054 gbpri527.seq
1499646865 gbpri528.seq
1489056492 gbpri529.seq
1208942574 gbpri53.seq
1484611944 gbpri530.seq
1453792366 gbpri531.seq
1499828025 gbpri532.seq
1481212036 gbpri533.seq
1454546463 gbpri534.seq
1449525084 gbpri535.seq
1494861403 gbpri536.seq
1473073758 gbpri537.seq
1486637996 gbpri538.seq
1497524132 gbpri539.seq
1492722199 gbpri54.seq
1478472937 gbpri540.seq
1491661481 gbpri541.seq
1455424594 gbpri542.seq
1455410131 gbpri543.seq
1486798120 gbpri544.seq
1441337577 gbpri545.seq
1483251288 gbpri546.seq
1441475428 gbpri547.seq
1403877591 gbpri548.seq
1495708282 gbpri549.seq
1397228467 gbpri55.seq
1443829319 gbpri550.seq
1458144264 gbpri551.seq
1461166920 gbpri552.seq
1456151937 gbpri553.seq
1496379177 gbpri554.seq
1437126770 gbpri555.seq
1485094045 gbpri556.seq
1453438439 gbpri557.seq
1474474081 gbpri558.seq
1460119816 gbpri559.seq
1411410910 gbpri56.seq
1330399589 gbpri560.seq
1414825104 gbpri561.seq
1471697740 gbpri562.seq
1433084067 gbpri563.seq
1478274327 gbpri564.seq
1482687860 gbpri565.seq
1482974764 gbpri566.seq
1480469936 gbpri567.seq
1365267937 gbpri568.seq
1484031460 gbpri569.seq
1340419381 gbpri57.seq
1476809977 gbpri570.seq
1481869552 gbpri571.seq
1470047194 gbpri572.seq
1375002197 gbpri573.seq
1488929328 gbpri574.seq
1489028060 gbpri575.seq
1493835205 gbpri576.seq
1486745077 gbpri577.seq
1437553393 gbpri578.seq
1443179149 gbpri579.seq
1441188568 gbpri58.seq
1460602913 gbpri580.seq
1455986166 gbpri581.seq
1498773877 gbpri582.seq
1499035903 gbpri583.seq
1498350785 gbpri584.seq
1324286020 gbpri585.seq
1342005827 gbpri586.seq
1485309573 gbpri587.seq
1467695018 gbpri588.seq
1475508820 gbpri589.seq
1480666117 gbpri59.seq
1447849220 gbpri590.seq
1433586828 gbpri591.seq
1455303102 gbpri592.seq
1394241071 gbpri593.seq
1428383612 gbpri594.seq
1456849852 gbpri595.seq
1478130441 gbpri596.seq
1430906638 gbpri597.seq
1415832047 gbpri598.seq
1489738461 gbpri599.seq
1372350935 gbpri6.seq
1418186863 gbpri60.seq
1493866735 gbpri600.seq
1458388413 gbpri601.seq
1478199348 gbpri602.seq
1417654857 gbpri603.seq
1497983883 gbpri604.seq
1404955585 gbpri605.seq
1492838254 gbpri606.seq
1497134439 gbpri607.seq
1479735906 gbpri608.seq
1472705450 gbpri609.seq
1439810091 gbpri61.seq
1381720975 gbpri610.seq
1416762592 gbpri611.seq
1495558904 gbpri612.seq
1424515521 gbpri613.seq
1477733469 gbpri614.seq
1464718114 gbpri615.seq
1498933031 gbpri616.seq
1490817778 gbpri617.seq
1491458941 gbpri618.seq
1465681968 gbpri619.seq
1457940176 gbpri62.seq
1496819507 gbpri620.seq
1451050267 gbpri621.seq
1437287082 gbpri622.seq
1440304461 gbpri623.seq
1429844247 gbpri624.seq
1475674737 gbpri625.seq
1449628456 gbpri626.seq
1453162683 gbpri627.seq
1498815168 gbpri628.seq
1492324018 gbpri629.seq
1354428010 gbpri63.seq
1482095198 gbpri630.seq
1467968922 gbpri631.seq
1493794103 gbpri632.seq
1497414154 gbpri633.seq
1493271275 gbpri634.seq
1478807514 gbpri635.seq
1314470939 gbpri636.seq
1449436519 gbpri637.seq
1497023848 gbpri638.seq
1474246118 gbpri639.seq
1498318031 gbpri64.seq
1491146957 gbpri640.seq
1496621910 gbpri641.seq
1472111063 gbpri642.seq
1492255475 gbpri643.seq
1495646498 gbpri644.seq
1476243033 gbpri645.seq
1496643022 gbpri646.seq
1483696357 gbpri647.seq
1382824259 gbpri648.seq
1474515975 gbpri649.seq
1404932319 gbpri65.seq
1451559409 gbpri650.seq
1497404699 gbpri651.seq
1455159667 gbpri652.seq
1470661765 gbpri653.seq
1499809421 gbpri654.seq
1474904775 gbpri655.seq
1496245896 gbpri656.seq
1445251994 gbpri657.seq
1479906220 gbpri658.seq
1499478494 gbpri659.seq
1435930533 gbpri66.seq
1493624391 gbpri660.seq
1499851130 gbpri661.seq
1497674665 gbpri662.seq
1411592327 gbpri663.seq
1489420228 gbpri664.seq
1481062305 gbpri665.seq
1441340535 gbpri666.seq
1497169182 gbpri667.seq
1480589150 gbpri668.seq
1486402030 gbpri669.seq
1499500934 gbpri67.seq
1495900570 gbpri670.seq
1491990715 gbpri671.seq
1496800725 gbpri672.seq
1412443957 gbpri673.seq
1498499804 gbpri674.seq
1429865359 gbpri675.seq
1463482208 gbpri676.seq
1499506329 gbpri677.seq
739672202 gbpri678.seq
1386124160 gbpri68.seq
1294623779 gbpri69.seq
1440746568 gbpri7.seq
1438151750 gbpri70.seq
1430161868 gbpri71.seq
1498693701 gbpri72.seq
1488803493 gbpri73.seq
1367919676 gbpri74.seq
1402453123 gbpri75.seq
1382841152 gbpri76.seq
1486197320 gbpri77.seq
1410633473 gbpri78.seq
1352632885 gbpri79.seq
1473652046 gbpri8.seq
1419080565 gbpri80.seq
1458489606 gbpri81.seq
1291215494 gbpri82.seq
1398782649 gbpri83.seq
1353135812 gbpri84.seq
1403280131 gbpri85.seq
1428137974 gbpri86.seq
1334924951 gbpri87.seq
1417624487 gbpri88.seq
1402680643 gbpri89.seq
1441992627 gbpri9.seq
1477087256 gbpri90.seq
1470398745 gbpri91.seq
1341322037 gbpri92.seq
1474094189 gbpri93.seq
1292086729 gbpri94.seq
1414586173 gbpri95.seq
1434986666 gbpri96.seq
1472844685 gbpri97.seq
1361097032 gbpri98.seq
1397531715 gbpri99.seq
812207 gbrel.txt
1499862285 gbrod1.seq
1477931319 gbrod10.seq
1443709248 gbrod100.seq
1487930170 gbrod101.seq
1352000298 gbrod102.seq
1497255342 gbrod103.seq
1215970140 gbrod104.seq
1323685727 gbrod105.seq
1425029177 gbrod106.seq
1436426304 gbrod107.seq
1498137432 gbrod108.seq
1384334707 gbrod109.seq
1365976721 gbrod11.seq
1497989819 gbrod110.seq
1369805604 gbrod111.seq
1375684152 gbrod112.seq
1183129833 gbrod113.seq
1212798272 gbrod114.seq
1430413982 gbrod115.seq
1470331296 gbrod12.seq
1417227931 gbrod13.seq
1471007422 gbrod14.seq
1438813865 gbrod15.seq
1490543396 gbrod16.seq
1383122131 gbrod17.seq
1420672254 gbrod18.seq
1475952043 gbrod19.seq
1499967437 gbrod2.seq
1397046843 gbrod20.seq
1351547492 gbrod21.seq
1434496523 gbrod22.seq
1387638765 gbrod23.seq
1486251329 gbrod24.seq
1347390436 gbrod25.seq
1452122190 gbrod26.seq
1353193118 gbrod27.seq
1370231234 gbrod28.seq
1370743208 gbrod29.seq
1499850426 gbrod3.seq
1453193685 gbrod30.seq
1484525776 gbrod31.seq
1406105502 gbrod32.seq
1474692538 gbrod33.seq
1404292919 gbrod34.seq
1358612176 gbrod35.seq
1325901204 gbrod36.seq
1445832321 gbrod37.seq
1301809704 gbrod38.seq
1459759409 gbrod39.seq
1499968704 gbrod4.seq
1371820929 gbrod40.seq
1379541974 gbrod41.seq
1447951148 gbrod42.seq
1358076947 gbrod43.seq
1393051649 gbrod44.seq
1377941029 gbrod45.seq
1484184886 gbrod46.seq
1439114050 gbrod47.seq
1409951130 gbrod48.seq
1472027087 gbrod49.seq
1239684965 gbrod5.seq
1372610888 gbrod50.seq
1482622482 gbrod51.seq
1393105943 gbrod52.seq
1451159866 gbrod53.seq
1434520361 gbrod54.seq
1444092726 gbrod55.seq
1361891899 gbrod56.seq
1453486986 gbrod57.seq
1458676727 gbrod58.seq
1379094101 gbrod59.seq
1403075066 gbrod6.seq
1475060334 gbrod60.seq
1359302535 gbrod61.seq
1465899229 gbrod62.seq
1295906456 gbrod63.seq
1477278364 gbrod64.seq
1378018089 gbrod65.seq
1390451722 gbrod66.seq
1462626302 gbrod67.seq
1299128117 gbrod68.seq
1371052535 gbrod69.seq
1462509765 gbrod7.seq
1444445568 gbrod70.seq
1478048412 gbrod71.seq
1480151384 gbrod72.seq
1426832728 gbrod73.seq
1455522110 gbrod74.seq
1332398568 gbrod75.seq
1471786581 gbrod76.seq
1376661169 gbrod77.seq
1454859611 gbrod78.seq
1295571253 gbrod79.seq
1380850319 gbrod8.seq
1399344953 gbrod80.seq
1315896821 gbrod81.seq
1411009597 gbrod82.seq
1453282390 gbrod83.seq
1391252549 gbrod84.seq
1498811032 gbrod85.seq
1444865055 gbrod86.seq
1488474687 gbrod87.seq
1331476829 gbrod88.seq
1465473324 gbrod89.seq
1395344650 gbrod9.seq
1416734769 gbrod90.seq
1486479413 gbrod91.seq
1462152570 gbrod92.seq
1423079792 gbrod93.seq
1368356742 gbrod94.seq
1452029512 gbrod95.seq
1391575059 gbrod96.seq
1477641360 gbrod97.seq
1461787631 gbrod98.seq
1303790964 gbrod99.seq
1499999065 gbsts1.seq
1499999696 gbsts2.seq
1449776269 gbsts3.seq
1434571481 gbsyn1.seq
1317756404 gbsyn2.seq
1363478773 gbsyn3.seq
1429349564 gbsyn4.seq
1317756374 gbsyn5.seq
1363478755 gbsyn6.seq
1492035219 gbsyn7.seq
1499987422 gbsyn8.seq
1430902905 gbsyn9.seq
1499999359 gbtsa1.seq
1499998358 gbtsa10.seq
1499999259 gbtsa11.seq
1499996808 gbtsa12.seq
1499995864 gbtsa13.seq
1499999108 gbtsa14.seq
1499997641 gbtsa15.seq
1500000126 gbtsa16.seq
1499998745 gbtsa17.seq
1499996863 gbtsa18.seq
1499998887 gbtsa19.seq
1499998717 gbtsa2.seq
1499998625 gbtsa20.seq
1499997206 gbtsa21.seq
1499998529 gbtsa22.seq
1499998785 gbtsa23.seq
1499998648 gbtsa24.seq
1499999864 gbtsa25.seq
1499998293 gbtsa26.seq
1499996528 gbtsa27.seq
1500000219 gbtsa28.seq
1500000076 gbtsa29.seq
1499998829 gbtsa3.seq
1499999627 gbtsa30.seq
1499999302 gbtsa31.seq
1499999301 gbtsa32.seq
1499997083 gbtsa33.seq
1499997527 gbtsa34.seq
1499999008 gbtsa35.seq
1499997043 gbtsa36.seq
163789411 gbtsa37.seq
1500000215 gbtsa4.seq
1500000258 gbtsa5.seq
1499998665 gbtsa6.seq
1499999377 gbtsa7.seq
1499999658 gbtsa8.seq
1499997214 gbtsa9.seq
7358236 gbuna1.seq
1499955677 gbvrl1.seq
1499998335 gbvrl10.seq
1499995344 gbvrl100.seq
1499971803 gbvrl101.seq
1499966365 gbvrl102.seq
1499967938 gbvrl103.seq
1499938953 gbvrl104.seq
1499965317 gbvrl105.seq
1499987304 gbvrl106.seq
1499987284 gbvrl107.seq
1499957489 gbvrl108.seq
1499959207 gbvrl109.seq
1499998611 gbvrl11.seq
1499935814 gbvrl110.seq
1499982356 gbvrl111.seq
1499947863 gbvrl112.seq
1499933452 gbvrl113.seq
1499990450 gbvrl114.seq
1499974275 gbvrl115.seq
1499993867 gbvrl116.seq
1499944332 gbvrl117.seq
1499985811 gbvrl118.seq
1499979838 gbvrl119.seq
1499994587 gbvrl12.seq
1499967719 gbvrl120.seq
1499952402 gbvrl121.seq
1499998888 gbvrl122.seq
1499961200 gbvrl123.seq
1499985853 gbvrl124.seq
1499954305 gbvrl125.seq
1499946121 gbvrl126.seq
1499995295 gbvrl127.seq
1499952305 gbvrl128.seq
1499980341 gbvrl129.seq
1499997583 gbvrl13.seq
1499968520 gbvrl130.seq
1499956025 gbvrl131.seq
1499938432 gbvrl132.seq
1499982642 gbvrl133.seq
1499952185 gbvrl134.seq
1499978248 gbvrl135.seq
1499958664 gbvrl136.seq
1499949195 gbvrl137.seq
1499998669 gbvrl138.seq
1499979729 gbvrl139.seq
1499997895 gbvrl14.seq
1499986465 gbvrl140.seq
1499951287 gbvrl141.seq
1499981167 gbvrl142.seq
1499955535 gbvrl143.seq
1499960404 gbvrl144.seq
1499996711 gbvrl145.seq
1499992507 gbvrl146.seq
1499954320 gbvrl147.seq
1499933960 gbvrl148.seq
1499955145 gbvrl149.seq
1499999371 gbvrl15.seq
1499944408 gbvrl150.seq
1499940953 gbvrl151.seq
1499979746 gbvrl152.seq
1499951418 gbvrl153.seq
1499959882 gbvrl154.seq
1499956108 gbvrl155.seq
1499986866 gbvrl156.seq
1499990316 gbvrl157.seq
1499986375 gbvrl158.seq
1499973133 gbvrl159.seq
1499965609 gbvrl16.seq
1499988045 gbvrl160.seq
1499998350 gbvrl161.seq
1499999953 gbvrl162.seq
1499976713 gbvrl163.seq
1499933613 gbvrl164.seq
1499952311 gbvrl165.seq
1499982830 gbvrl166.seq
1499956799 gbvrl167.seq
1499973219 gbvrl168.seq
1499955024 gbvrl169.seq
1499954035 gbvrl17.seq
1499982309 gbvrl170.seq
1499842841 gbvrl171.seq
1499956708 gbvrl172.seq
1499957655 gbvrl173.seq
1499936367 gbvrl174.seq
1499969456 gbvrl175.seq
1499940911 gbvrl176.seq
1499986158 gbvrl177.seq
1499934193 gbvrl178.seq
1499960089 gbvrl179.seq
1499966852 gbvrl18.seq
1499968472 gbvrl180.seq
1499964938 gbvrl181.seq
1499957473 gbvrl182.seq
1499910781 gbvrl183.seq
1499946519 gbvrl184.seq
1499997793 gbvrl185.seq
1499934453 gbvrl186.seq
1499981264 gbvrl187.seq
1499981919 gbvrl188.seq
1499991047 gbvrl189.seq
1499983189 gbvrl19.seq
1499999873 gbvrl190.seq
1499980996 gbvrl191.seq
1499988813 gbvrl192.seq
1499970750 gbvrl193.seq
1499996969 gbvrl194.seq
1499996421 gbvrl195.seq
1499964870 gbvrl196.seq
1499997119 gbvrl197.seq
1499976377 gbvrl198.seq
1499958066 gbvrl199.seq
1499996422 gbvrl2.seq
1499961543 gbvrl20.seq
1499993412 gbvrl200.seq
1499997351 gbvrl201.seq
1499994090 gbvrl202.seq
1499984945 gbvrl203.seq
1499994350 gbvrl204.seq
1499986981 gbvrl205.seq
1499979400 gbvrl206.seq
1499987232 gbvrl207.seq
1499985578 gbvrl208.seq
1499972876 gbvrl209.seq
1499996558 gbvrl21.seq
1499983667 gbvrl210.seq
1499995065 gbvrl211.seq
1499978361 gbvrl212.seq
1499981467 gbvrl213.seq
1499998633 gbvrl214.seq
1499997816 gbvrl215.seq
1499980882 gbvrl216.seq
1499990082 gbvrl217.seq
1499964096 gbvrl218.seq
1499974331 gbvrl219.seq
1499990084 gbvrl22.seq
1499963261 gbvrl220.seq
1499961403 gbvrl221.seq
1499971980 gbvrl222.seq
1499978644 gbvrl223.seq
1499960591 gbvrl224.seq
1499983436 gbvrl225.seq
1499978758 gbvrl226.seq
1499972063 gbvrl227.seq
1499979278 gbvrl228.seq
1499997618 gbvrl229.seq
1499950332 gbvrl23.seq
1499999244 gbvrl230.seq
1499994572 gbvrl231.seq
1499968075 gbvrl232.seq
1499993654 gbvrl233.seq
1499970630 gbvrl234.seq
1499976495 gbvrl235.seq
1499995087 gbvrl236.seq
1499963031 gbvrl237.seq
1499985795 gbvrl238.seq
1499984065 gbvrl239.seq
1499964978 gbvrl24.seq
1499980563 gbvrl240.seq
1499966179 gbvrl241.seq
1499979184 gbvrl242.seq
1499972537 gbvrl243.seq
1499978314 gbvrl244.seq
1499993560 gbvrl245.seq
1499967607 gbvrl246.seq
1499990076 gbvrl247.seq
1499974005 gbvrl248.seq
1500000247 gbvrl249.seq
1499962216 gbvrl25.seq
1499991807 gbvrl250.seq
1499999706 gbvrl251.seq
1499962905 gbvrl252.seq
1499989691 gbvrl253.seq
1499974049 gbvrl254.seq
1499992138 gbvrl255.seq
1499978803 gbvrl256.seq
1499980597 gbvrl257.seq
1499970178 gbvrl258.seq
1499999820 gbvrl259.seq
1499938509 gbvrl26.seq
1499999581 gbvrl260.seq
1499968734 gbvrl261.seq
1499975470 gbvrl262.seq
1499995860 gbvrl263.seq
1499993553 gbvrl264.seq
1499961571 gbvrl265.seq
1499986824 gbvrl266.seq
1499973441 gbvrl267.seq
1499997602 gbvrl268.seq
1499967084 gbvrl269.seq
1499961214 gbvrl27.seq
1499996550 gbvrl270.seq
1499972485 gbvrl271.seq
1499989117 gbvrl272.seq
1499970534 gbvrl273.seq
1499960889 gbvrl274.seq
1499983845 gbvrl275.seq
1499965103 gbvrl276.seq
1499959793 gbvrl277.seq
1499984537 gbvrl278.seq
1499983938 gbvrl279.seq
1499973114 gbvrl28.seq
1499981983 gbvrl280.seq
1499969303 gbvrl281.seq
1499990155 gbvrl282.seq
1499973784 gbvrl283.seq
1499985755 gbvrl284.seq
1499974894 gbvrl285.seq
1499996129 gbvrl286.seq
1499973642 gbvrl287.seq
1499987616 gbvrl288.seq
1499998496 gbvrl289.seq
1499972737 gbvrl29.seq
1499979426 gbvrl290.seq
1499984134 gbvrl291.seq
1499996707 gbvrl292.seq
1499966659 gbvrl293.seq
1499961382 gbvrl294.seq
1499984833 gbvrl295.seq
1499962522 gbvrl296.seq
1499995084 gbvrl297.seq
1499965393 gbvrl298.seq
1499970905 gbvrl299.seq
1499994287 gbvrl3.seq
1499963403 gbvrl30.seq
1499967142 gbvrl300.seq
1499987985 gbvrl301.seq
1499984678 gbvrl302.seq
1499977730 gbvrl303.seq
1499969724 gbvrl304.seq
1499984844 gbvrl305.seq
1499978053 gbvrl306.seq
1499988579 gbvrl307.seq
1499979084 gbvrl308.seq
1499991487 gbvrl309.seq
1499981523 gbvrl31.seq
1499973744 gbvrl310.seq
1499978412 gbvrl311.seq
1499982240 gbvrl312.seq
1499976222 gbvrl313.seq
1499986364 gbvrl314.seq
1499987633 gbvrl315.seq
1499974461 gbvrl316.seq
1499976067 gbvrl317.seq
1499963671 gbvrl318.seq
1499995811 gbvrl319.seq
1499943684 gbvrl32.seq
1499974448 gbvrl320.seq
1499940717 gbvrl321.seq
1499957564 gbvrl322.seq
1499991812 gbvrl323.seq
1499936369 gbvrl324.seq
1499951573 gbvrl325.seq
1499983602 gbvrl326.seq
1499960244 gbvrl327.seq
1499965414 gbvrl328.seq
1499960118 gbvrl329.seq
1499985957 gbvrl33.seq
1499995673 gbvrl330.seq
1499947062 gbvrl331.seq
1499979583 gbvrl332.seq
621520049 gbvrl333.seq
1499957255 gbvrl34.seq
1499993346 gbvrl35.seq
1499992300 gbvrl36.seq
1499980992 gbvrl37.seq
1499983645 gbvrl38.seq
1499943056 gbvrl39.seq
1499972234 gbvrl4.seq
1499999469 gbvrl40.seq
1499984521 gbvrl41.seq
1499977131 gbvrl42.seq
1499978151 gbvrl43.seq
1499958018 gbvrl44.seq
1499999211 gbvrl45.seq
1499967431 gbvrl46.seq
1499984761 gbvrl47.seq
1499990755 gbvrl48.seq
1499988766 gbvrl49.seq
1499998615 gbvrl5.seq
1499996409 gbvrl50.seq
1499954386 gbvrl51.seq
1499960654 gbvrl52.seq
1499965917 gbvrl53.seq
1499967921 gbvrl54.seq
1499940725 gbvrl55.seq
1499978417 gbvrl56.seq
1499963742 gbvrl57.seq
1499953893 gbvrl58.seq
1499974498 gbvrl59.seq
1499994292 gbvrl6.seq
1499992412 gbvrl60.seq
1499965269 gbvrl61.seq
1499953511 gbvrl62.seq
1499977316 gbvrl63.seq
1499993342 gbvrl64.seq
1499934235 gbvrl65.seq
1499992945 gbvrl66.seq
1499940828 gbvrl67.seq
1499957486 gbvrl68.seq
1499989843 gbvrl69.seq
1499996473 gbvrl7.seq
1499985624 gbvrl70.seq
1499989663 gbvrl71.seq
1499959114 gbvrl72.seq
1499955442 gbvrl73.seq
1499965838 gbvrl74.seq
1499952128 gbvrl75.seq
1499941041 gbvrl76.seq
1499934928 gbvrl77.seq
1499967300 gbvrl78.seq
1499940208 gbvrl79.seq
1499997597 gbvrl8.seq
1499981174 gbvrl80.seq
1499946585 gbvrl81.seq
1499987862 gbvrl82.seq
1499994172 gbvrl83.seq
1499934985 gbvrl84.seq
1499954757 gbvrl85.seq
1499939218 gbvrl86.seq
1499975362 gbvrl87.seq
1499935044 gbvrl88.seq
1499988517 gbvrl89.seq
1499989067 gbvrl9.seq
1499961049 gbvrl90.seq
1499966880 gbvrl91.seq
1499984696 gbvrl92.seq
1499933338 gbvrl93.seq
1499989571 gbvrl94.seq
1499952714 gbvrl95.seq
1499987854 gbvrl96.seq
1499938148 gbvrl97.seq
1499953800 gbvrl98.seq
1499973828 gbvrl99.seq
1468704363 gbvrt1.seq
1499577589 gbvrt10.seq
1462386314 gbvrt100.seq
1154838449 gbvrt101.seq
1262095184 gbvrt102.seq
1090722360 gbvrt103.seq
1424049174 gbvrt104.seq
1496909957 gbvrt105.seq
1493025075 gbvrt106.seq
1320575219 gbvrt107.seq
1436638097 gbvrt108.seq
1458922406 gbvrt109.seq
1306595972 gbvrt11.seq
1465167303 gbvrt110.seq
1318097988 gbvrt111.seq
1411652468 gbvrt112.seq
1421545558 gbvrt113.seq
1476891269 gbvrt114.seq
1386060829 gbvrt115.seq
1433021643 gbvrt116.seq
1497612563 gbvrt117.seq
1486330678 gbvrt118.seq
1462604299 gbvrt119.seq
1480326998 gbvrt12.seq
1476857854 gbvrt120.seq
1488438777 gbvrt121.seq
1462478284 gbvrt122.seq
1498078979 gbvrt123.seq
1484861739 gbvrt124.seq
1477143564 gbvrt125.seq
1483219404 gbvrt126.seq
1463588150 gbvrt127.seq
1491354277 gbvrt128.seq
1497114650 gbvrt129.seq
1475027624 gbvrt13.seq
1478208496 gbvrt130.seq
1462060438 gbvrt131.seq
1385749837 gbvrt132.seq
1470368193 gbvrt133.seq
1486674105 gbvrt134.seq
1419336196 gbvrt135.seq
1491622767 gbvrt136.seq
1480809421 gbvrt137.seq
1474597440 gbvrt138.seq
1498459033 gbvrt139.seq
1443153129 gbvrt14.seq
1436819628 gbvrt140.seq
1480754470 gbvrt141.seq
1473702580 gbvrt142.seq
1483456760 gbvrt143.seq
1460587689 gbvrt144.seq
1491277907 gbvrt145.seq
1433698722 gbvrt146.seq
1392969255 gbvrt147.seq
1458594989 gbvrt148.seq
1497316015 gbvrt149.seq
1469618929 gbvrt15.seq
1416739574 gbvrt150.seq
1485249531 gbvrt151.seq
1468995634 gbvrt152.seq
1495839785 gbvrt153.seq
1361029027 gbvrt154.seq
1454564111 gbvrt155.seq
1463902579 gbvrt156.seq
1483704254 gbvrt157.seq
1320939161 gbvrt158.seq
1450812981 gbvrt159.seq
1498326298 gbvrt16.seq
1478017801 gbvrt160.seq
1392442116 gbvrt161.seq
1496121979 gbvrt162.seq
1429716567 gbvrt163.seq
1495014546 gbvrt164.seq
1444533644 gbvrt165.seq
1472525288 gbvrt166.seq
1371889473 gbvrt167.seq
1458168336 gbvrt168.seq
1480325666 gbvrt169.seq
1499856808 gbvrt17.seq
1333470830 gbvrt170.seq
1339390452 gbvrt171.seq
1446769447 gbvrt172.seq
1432904863 gbvrt173.seq
1469966670 gbvrt174.seq
1484040009 gbvrt175.seq
1496855706 gbvrt176.seq
1433040470 gbvrt177.seq
1375266246 gbvrt178.seq
1483347947 gbvrt179.seq
1499999476 gbvrt18.seq
1363503090 gbvrt180.seq
1442347330 gbvrt181.seq
1494535064 gbvrt182.seq
1440727248 gbvrt183.seq
1472724385 gbvrt184.seq
1399605061 gbvrt185.seq
1291348384 gbvrt186.seq
1492986566 gbvrt187.seq
1497829903 gbvrt188.seq
1436699186 gbvrt189.seq
1492323235 gbvrt19.seq
1173719027 gbvrt190.seq
1470502273 gbvrt191.seq
1336897357 gbvrt192.seq
1451022601 gbvrt193.seq
1496444625 gbvrt194.seq
1452606394 gbvrt195.seq
1498405608 gbvrt196.seq
1458261551 gbvrt197.seq
1422476619 gbvrt198.seq
1465708115 gbvrt199.seq
1488073608 gbvrt2.seq
1499977540 gbvrt20.seq
1479745451 gbvrt200.seq
1495244154 gbvrt201.seq
1468455350 gbvrt202.seq
1484551004 gbvrt203.seq
1341285700 gbvrt204.seq
1391197912 gbvrt205.seq
1409281707 gbvrt206.seq
1244065533 gbvrt207.seq
1487136121 gbvrt208.seq
1489780401 gbvrt209.seq
1499998471 gbvrt21.seq
1493866969 gbvrt210.seq
1487035640 gbvrt211.seq
1478584592 gbvrt212.seq
1485918275 gbvrt213.seq
1444589689 gbvrt214.seq
1499541605 gbvrt215.seq
1448188156 gbvrt216.seq
889072804 gbvrt217.seq
1750969594 gbvrt218.seq
1582584122 gbvrt219.seq
1499998299 gbvrt22.seq
1439178988 gbvrt220.seq
1385914538 gbvrt221.seq
1260623871 gbvrt222.seq
1241027078 gbvrt223.seq
1394205943 gbvrt224.seq
647635060 gbvrt225.seq
1800655812 gbvrt226.seq
1625880297 gbvrt227.seq
1452341451 gbvrt228.seq
1413268707 gbvrt229.seq
1497572035 gbvrt23.seq
1301679404 gbvrt230.seq
1265017882 gbvrt231.seq
1398329117 gbvrt232.seq
646313711 gbvrt233.seq
2486764648 gbvrt234.seq
2399841711 gbvrt235.seq
2168065652 gbvrt236.seq
1730481357 gbvrt237.seq
1674077467 gbvrt238.seq
1643880041 gbvrt239.seq
1500000075 gbvrt24.seq
1613167793 gbvrt240.seq
1585967368 gbvrt241.seq
1573317635 gbvrt242.seq
1525189779 gbvrt243.seq
1522308102 gbvrt244.seq
1503557506 gbvrt245.seq
1502833827 gbvrt246.seq
1439581620 gbvrt247.seq
1297818631 gbvrt248.seq
1258324368 gbvrt249.seq
1482680520 gbvrt25.seq
1369247334 gbvrt250.seq
1368865938 gbvrt251.seq
1472115430 gbvrt252.seq
1449680126 gbvrt253.seq
1309689855 gbvrt254.seq
1469430849 gbvrt255.seq
1466100957 gbvrt256.seq
1392101492 gbvrt257.seq
1390671725 gbvrt258.seq
1408841519 gbvrt259.seq
1484980244 gbvrt26.seq
1498224495 gbvrt260.seq
1475026708 gbvrt261.seq
1464576040 gbvrt262.seq
1459906041 gbvrt263.seq
1465282649 gbvrt264.seq
286802878 gbvrt265.seq
2737865440 gbvrt266.seq
582597811 gbvrt267.seq
2729824435 gbvrt268.seq
666748676 gbvrt269.seq
1498744695 gbvrt27.seq
2720117404 gbvrt270.seq
646964638 gbvrt271.seq
2731547963 gbvrt272.seq
195179179 gbvrt273.seq
2734657827 gbvrt274.seq
21623841 gbvrt275.seq
2728895745 gbvrt276.seq
2505979018 gbvrt277.seq
2204702755 gbvrt278.seq
1642333222 gbvrt279.seq
1490692340 gbvrt28.seq
1549476405 gbvrt280.seq
1535228181 gbvrt281.seq
1466613005 gbvrt282.seq
1478204774 gbvrt283.seq
1470950309 gbvrt284.seq
186687778 gbvrt285.seq
2736013151 gbvrt286.seq
466831313 gbvrt287.seq
2724707547 gbvrt288.seq
428842069 gbvrt289.seq
1480834605 gbvrt29.seq
2726904396 gbvrt290.seq
418344636 gbvrt291.seq
2737394570 gbvrt292.seq
32900508 gbvrt293.seq
2595542382 gbvrt294.seq
2455087006 gbvrt295.seq
2265220339 gbvrt296.seq
2012454031 gbvrt297.seq
1582208555 gbvrt298.seq
1469382459 gbvrt299.seq
1487660705 gbvrt3.seq
1338749465 gbvrt30.seq
1410611776 gbvrt300.seq
1422190236 gbvrt301.seq
1462005873 gbvrt302.seq
1484741743 gbvrt303.seq
1485090814 gbvrt304.seq
1490723364 gbvrt305.seq
1409295542 gbvrt306.seq
1415524312 gbvrt307.seq
1419887839 gbvrt308.seq
1489003648 gbvrt309.seq
1423257163 gbvrt31.seq
1450997370 gbvrt310.seq
1416322818 gbvrt311.seq
1087669617 gbvrt312.seq
1499731259 gbvrt313.seq
1497257661 gbvrt314.seq
1481805507 gbvrt315.seq
1479706062 gbvrt316.seq
726088557 gbvrt317.seq
1389228052 gbvrt32.seq
1467789570 gbvrt33.seq
1490583831 gbvrt34.seq
1048495703 gbvrt35.seq
1063697372 gbvrt36.seq
1045817455 gbvrt37.seq
1371630420 gbvrt38.seq
1358087426 gbvrt39.seq
1499992628 gbvrt4.seq
1409890116 gbvrt40.seq
1495658777 gbvrt41.seq
1468214202 gbvrt42.seq
1497507497 gbvrt43.seq
1392041424 gbvrt44.seq
838606763 gbvrt45.seq
1154852032 gbvrt46.seq
1294541035 gbvrt47.seq
1495334811 gbvrt48.seq
1471849771 gbvrt49.seq
1460025258 gbvrt5.seq
1495075479 gbvrt50.seq
1443062910 gbvrt51.seq
1495785632 gbvrt52.seq
1476013646 gbvrt53.seq
1465137855 gbvrt54.seq
1282827292 gbvrt55.seq
1432076811 gbvrt56.seq
1499422517 gbvrt57.seq
1473624134 gbvrt58.seq
1494431972 gbvrt59.seq
1488052262 gbvrt6.seq
1230349555 gbvrt60.seq
1413618697 gbvrt61.seq
1330262106 gbvrt62.seq
1463202068 gbvrt63.seq
1491604647 gbvrt64.seq
1469825980 gbvrt65.seq
1495977022 gbvrt66.seq
1412203616 gbvrt67.seq
1485152845 gbvrt68.seq
1499863036 gbvrt69.seq
1498753855 gbvrt7.seq
1421892042 gbvrt70.seq
1440473233 gbvrt71.seq
1451333745 gbvrt72.seq
1480202965 gbvrt73.seq
1472327219 gbvrt74.seq
1468479423 gbvrt75.seq
1483155919 gbvrt76.seq
566961473 gbvrt77.seq
1068402515 gbvrt78.seq
1067356332 gbvrt79.seq
1480906084 gbvrt8.seq
896844818 gbvrt80.seq
805318346 gbvrt81.seq
1275607077 gbvrt82.seq
1208361643 gbvrt83.seq
874873714 gbvrt84.seq
1313422786 gbvrt85.seq
1438940816 gbvrt86.seq
1490321479 gbvrt87.seq
1497249551 gbvrt88.seq
1499997625 gbvrt89.seq
1490946714 gbvrt9.seq
1499999710 gbvrt90.seq
1456553791 gbvrt91.seq
1483558245 gbvrt92.seq
1491731612 gbvrt93.seq
1438387067 gbvrt94.seq
1455534996 gbvrt95.seq
1485012342 gbvrt96.seq
1488248379 gbvrt97.seq
1470679083 gbvrt98.seq
1492360931 gbvrt99.seq
2.2.6 Per-Division Statistics
The following table provides a per-division breakdown of the number of
sequence entries and the total number of bases of DNA/RNA in each non-CON
and non-WGS sequence data file.
CON division records, which are constructed from other sequence records,
are not represented here because their inclusion would essentially be a
form of double-counting.
Sequences from Whole Genome Shotgun (WGS) sequencing projects are not
represented here because all WGS project data are made available on
a per-project basis:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
rather than being incorporated within the GenBank release distribution.
Division Entries Bases
BCT1 179284 605564943
BCT10 328 678449857
BCT100 258 653923313
BCT101 359 666225283
BCT102 382 696334557
BCT103 245 677775589
BCT104 482 698739746
BCT105 408 682352277
BCT106 468 715318023
BCT107 243 704231055
BCT108 1256 675354276
BCT109 334 654032984
BCT11 398 744648257
BCT110 554 679882975
BCT111 380 662058224
BCT112 427 673149175
BCT113 329 698888880
BCT114 420 680908242
BCT115 327 686296985
BCT116 241 668134081
BCT117 417 665145326
BCT118 430 716996313
BCT119 338 709981986
BCT12 435 754400246
BCT120 231 647784523
BCT121 319 704567319
BCT122 412 670422985
BCT123 662 742273805
BCT124 410 717152916
BCT125 321 683354877
BCT126 297 677891448
BCT127 364 666326934
BCT128 375 781152754
BCT129 318 742043566
BCT13 425 683822718
BCT130 343 670116773
BCT131 405 678786483
BCT132 462 671933260
BCT133 416 686432617
BCT134 402 666124654
BCT135 301 688028886
BCT136 349 761125294
BCT137 354 666397801
BCT138 280 705757914
BCT139 348 664476844
BCT14 577 673816566
BCT140 370 703293834
BCT141 590 645714165
BCT142 296 690904276
BCT143 360 740744954
BCT144 352 677083265
BCT145 319 657661635
BCT146 373 665845086
BCT147 370 664802484
BCT148 823 642524889
BCT149 436 653729620
BCT15 535 671362816
BCT150 493 642663218
BCT151 433 637559932
BCT152 429 639152736
BCT153 427 666799655
BCT154 497 701020063
BCT155 359 678999086
BCT156 439 709219624
BCT157 281 680750761
BCT158 315 746965603
BCT159 446 676199636
BCT16 474 674222103
BCT160 438 668562329
BCT161 380 703501094
BCT162 379 652797711
BCT163 323 668467527
BCT164 505 805501339
BCT165 558 737131098
BCT166 299 679515109
BCT167 300 678258608
BCT168 393 657353752
BCT169 389 658150329
BCT17 311 674180150
BCT170 543 675918377
BCT171 314 678098648
BCT172 513 643910152
BCT173 417 675085408
BCT174 440 664708932
BCT175 401 701050972
BCT176 395 713342384
BCT177 491 683028888
BCT178 373 720617570
BCT179 319 664913032
BCT18 344 676004182
BCT180 363 674628433
BCT181 320 677441321
BCT182 403 669780395
BCT183 429 688867623
BCT184 491 701304637
BCT185 344 663652282
BCT186 387 647871336
BCT187 316 654620175
BCT188 247 646407798
BCT189 512 758846451
BCT19 70027 655383623
BCT190 173 661330423
BCT191 351 652024521
BCT192 344 666342670
BCT193 332 648631216
BCT194 374 681359815
BCT195 372 678730747
BCT196 366 766243201
BCT197 369 932926129
BCT198 393 661835970
BCT199 437 651597274
BCT2 26409 631602615
BCT20 468 673645700
BCT200 412 732795946
BCT201 348 698431104
BCT202 464 708422169
BCT203 537 664226632
BCT204 395 695696610
BCT205 394 641460067
BCT206 432 656304485
BCT207 436 690455904
BCT208 411 670684800
BCT209 413 691698017
BCT21 354 671500075
BCT210 418 665685393
BCT211 355 672685526
BCT212 242 651256533
BCT213 316 676834783
BCT214 412 661098129
BCT215 468 660304733
BCT216 445 693357127
BCT217 274 657840434
BCT218 390 632301559
BCT219 391 646774861
BCT22 470 675185718
BCT220 325 697315878
BCT221 330 691600154
BCT222 358 673368396
BCT223 360 684365716
BCT224 305 663814183
BCT225 400 651649994
BCT226 399 660013263
BCT227 363 676851864
BCT228 246 642444177
BCT229 345 633362681
BCT23 444 676371204
BCT230 311 638993752
BCT231 443 652447670
BCT232 382 656055031
BCT233 562 673125964
BCT234 384 658511744
BCT235 322 699790950
BCT236 347 644453986
BCT237 325 664344637
BCT238 364 639274556
BCT239 391 634115249
BCT24 419 672736918
BCT240 369 621956922
BCT241 319 622001434
BCT242 319 638280773
BCT243 510 755482091
BCT244 431 623488822
BCT245 446 679064917
BCT246 384 648871588
BCT247 273 658962899
BCT248 405 654539611
BCT249 278 663020520
BCT25 387 669570630
BCT250 449 651119210
BCT251 318 644064483
BCT252 344 640971062
BCT253 353 640203068
BCT254 346 667928337
BCT255 336 663965113
BCT256 362 741819082
BCT257 115 649106896
BCT258 120 649642176
BCT259 117 651093970
BCT26 356 683686294
BCT260 142 648325885
BCT261 132 648462192
BCT262 166 645781303
BCT263 154 649572121
BCT264 134 645288206
BCT265 120 648674112
BCT266 148 646806570
BCT267 131 649766889
BCT268 141 646519417
BCT269 311 667371380
BCT27 381 692212796
BCT270 372 695397861
BCT271 327 650349466
BCT272 668 651595974
BCT273 1316 628081928
BCT274 439 663887590
BCT275 271 674245123
BCT276 501 698000880
BCT277 205 628675293
BCT278 305 633512213
BCT279 449 657191988
BCT28 395 694555001
BCT280 357 648862223
BCT281 460 642628835
BCT282 249 628073268
BCT283 459 680382341
BCT284 262 630840981
BCT285 365 702992359
BCT286 414 666751352
BCT287 464 676700325
BCT288 357 641345248
BCT289 306 674229667
BCT29 797 706541943
BCT290 338 646910493
BCT291 416 718107356
BCT292 541 646177494
BCT293 534 672326407
BCT294 508 662494101
BCT295 383 625949983
BCT296 381 619809637
BCT297 388 646721165
BCT298 203 633255201
BCT299 322 633367139
BCT3 380 727573230
BCT30 362 681525364
BCT300 359 630368058
BCT301 340 633335476
BCT302 389 631796772
BCT303 275 650724899
BCT304 407 615278408
BCT305 453 633414690
BCT306 356 671712723
BCT307 312 850868588
BCT308 713 789273469
BCT309 415 666237017
BCT31 294 679385944
BCT310 371 647517554
BCT311 318 663859104
BCT312 270 625321581
BCT313 411 647328671
BCT314 318 643832859
BCT315 482 628393694
BCT316 329 702286044
BCT317 318 660665527
BCT318 344 658431203
BCT319 291 638278501
BCT32 182 650382815
BCT320 392 665189541
BCT321 436 682036639
BCT322 337 648358542
BCT323 352 628298871
BCT324 353 639072464
BCT325 362 660249485
BCT326 371 647631763
BCT327 190 638200382
BCT328 231 618242086
BCT329 478 636646683
BCT33 176 650756403
BCT330 339 634536040
BCT331 327 642989797
BCT332 494 612190954
BCT333 362 679074262
BCT334 425 643580568
BCT335 360 680028674
BCT336 341 646710504
BCT337 517 613881153
BCT338 419 623787467
BCT339 341 632308274
BCT34 333 687723495
BCT340 295 632543316
BCT341 113 618507089
BCT342 266 668801918
BCT343 421 653616692
BCT344 310 629511082
BCT345 272 622630660
BCT346 312 637894463
BCT347 338 601981573
BCT348 374 599208417
BCT349 387 601525446
BCT35 252 702099748
BCT350 365 598357794
BCT351 385 616163718
BCT352 307 624939585
BCT353 207 632667914
BCT354 395 636769916
BCT355 349 669910947
BCT356 347 632382669
BCT357 333 604556585
BCT358 337 627084434
BCT359 293 647765044
BCT36 258 684841890
BCT360 513 647889378
BCT361 361 626706967
BCT362 387 635411203
BCT363 444 611273621
BCT364 572 607252596
BCT365 581 605952139
BCT366 481 623295680
BCT367 328 622233711
BCT368 320 651717444
BCT369 303 624383182
BCT37 308 703122979
BCT370 402 641451922
BCT371 380 608345724
BCT372 346 670143545
BCT373 378 683968002
BCT374 533 646551795
BCT375 448 816528373
BCT376 308 632163702
BCT377 291 659560602
BCT378 373 616218862
BCT379 309 700285684
BCT38 338 696859766
BCT380 255196 521311510
BCT381 18895 618873764
BCT382 118473 633284264
BCT383 143606 579734955
BCT384 439090 461175686
BCT385 345575 540007666
BCT386 33721 770820064
BCT387 4480 720323907
BCT388 183 657588772
BCT389 2054 756028244
BCT39 314 659257489
BCT390 1702 842858069
BCT391 4967 796872965
BCT392 1216 1156273752
BCT393 2519 808926693
BCT394 3244 698256460
BCT395 2651 760172440
BCT396 5471 831696930
BCT397 67452 757229384
BCT398 342861 579261871
BCT399 274795 692028055
BCT4 488 735049964
BCT40 470 666601624
BCT400 186116 737636405
BCT401 551 647045161
BCT402 539 616420277
BCT403 614 618419202
BCT404 721 626903512
BCT405 1355 763548097
BCT406 1331 757463592
BCT407 752 1079352001
BCT408 788 1181222364
BCT409 772 1180452809
BCT41 257 671604557
BCT410 747 1183293812
BCT411 908 1122804354
BCT412 135909 391267116
BCT42 254 674524865
BCT43 253 663878043
BCT44 269 678666910
BCT45 356 671837402
BCT46 296 667279769
BCT47 302 680142930
BCT48 354 666916704
BCT49 318 666142082
BCT5 535 720960951
BCT50 307 659968085
BCT51 404 660945473
BCT52 355 658397269
BCT53 370 666058724
BCT54 352 679695209
BCT55 310 676113332
BCT56 380 665494040
BCT57 314 675189980
BCT58 351 687094772
BCT59 283 680689662
BCT6 421 681407729
BCT60 306 668229610
BCT61 364 676660585
BCT62 385 669830558
BCT63 389 666924900
BCT64 270 664587007
BCT65 378 705487235
BCT66 334 680380801
BCT67 346 668579124
BCT68 365 715856299
BCT69 405 658187753
BCT7 483 668491491
BCT70 303 681477148
BCT71 302 685883371
BCT72 294 680301340
BCT73 332 681219414
BCT74 261 812788435
BCT75 420 673521896
BCT76 546 719959641
BCT77 283 673303473
BCT78 264 674459536
BCT79 295 675721565
BCT8 358 692645123
BCT80 335 744698483
BCT81 326 696770230
BCT82 321 718133404
BCT83 298 718817245
BCT84 445 833910977
BCT85 229 695310061
BCT86 367 683973809
BCT87 308 664161816
BCT88 317 672990666
BCT89 328 687644224
BCT9 306 695151837
BCT90 274 671365532
BCT91 290 695681051
BCT92 368 673844841
BCT93 449 674784714
BCT94 384 712045076
BCT95 333 673735065
BCT96 392 671670238
BCT97 384 682299053
BCT98 304 664052267
BCT99 279 693104913
ENV1 404936 504137599
ENV10 566799 376334904
ENV11 473832 456622585
ENV12 540812 319425255
ENV13 478760 384840200
ENV14 578160 347669877
ENV15 475682 407146652
ENV16 599554 294288615
ENV17 639667 272903480
ENV18 635544 304500635
ENV19 556784 333243476
ENV2 392 739108087
ENV20 580969 418988540
ENV21 517950 394391457
ENV22 263631 577165603
ENV23 230250 723610461
ENV24 35255 1134035872
ENV25 556 1180839460
ENV26 3628 1150410199
ENV27 59602 493112753
ENV3 228 657217903
ENV4 362 694381595
ENV5 190811 642446362
ENV6 587432 403125385
ENV7 619181 388785028
ENV8 601409 331729500
ENV9 654120 366070006
EST1 465977 174308554
EST10 482043 205967454
EST100 517292 306923062
EST101 572037 237459407
EST102 559294 267726281
EST103 438882 278539371
EST104 452379 282544321
EST105 457768 286423598
EST106 453648 316507926
EST107 467276 316307309
EST108 406793 276435371
EST109 452021 300764871
EST11 471711 197507946
EST110 443989 266985079
EST111 429972 269203166
EST112 464096 260991632
EST113 350998 223319813
EST114 476308 240216312
EST115 485257 274643989
EST116 395717 254669198
EST117 482639 288166713
EST118 382325 254197422
EST119 370653 210357762
EST12 322583 106753943
EST120 445442 110879500
EST121 655163 335230361
EST122 444989 268689753
EST123 525350 276989596
EST124 589765 303709580
EST125 513385 307281996
EST126 516694 335998529
EST127 491527 334500574
EST128 532637 311323503
EST129 556498 334057210
EST13 301749 92372308
EST130 598413 377593104
EST131 586158 424805683
EST132 516013 257492321
EST133 450086 57158888
EST134 437282 143245366
EST135 493832 303944482
EST136 425206 296888986
EST137 466065 305456128
EST138 478066 185339736
EST139 439961 279386128
EST14 347472 167081303
EST140 484777 311107403
EST141 426411 268353582
EST142 474499 271881990
EST143 415419 262731400
EST144 308344 202758336
EST145 387556 241562421
EST146 471867 264993844
EST147 468153 269893637
EST148 477754 306027432
EST149 549437 329225324
EST15 493156 244488995
EST150 402350 268360026
EST151 558737 237612444
EST152 547224 277957727
EST153 557383 344790066
EST154 546025 301306957
EST155 604175 356770958
EST156 550234 334143831
EST157 454074 288984513
EST158 470217 251396385
EST159 496106 288116407
EST16 474032 251368095
EST160 524086 332289726
EST161 526572 335112749
EST162 704335 310582306
EST163 523885 268059220
EST164 160508 62179656
EST17 457757 255514548
EST18 450196 229864133
EST19 474469 243734254
EST2 491819 192418565
EST20 456042 290329202
EST21 490016 267396255
EST22 438186 247245089
EST23 475097 272528135
EST24 580925 324451383
EST25 475163 257856181
EST26 435810 254794016
EST27 459609 251074031
EST28 612286 324496600
EST29 477763 253024467
EST3 502232 208186542
EST30 458347 254207984
EST31 441030 288328606
EST32 407520 291487028
EST33 506128 301706328
EST34 646422 372155166
EST35 492892 313664390
EST36 399185 228718847
EST37 251826 94149042
EST38 250653 102524611
EST39 326753 158114824
EST4 481134 204966535
EST40 458553 260614853
EST41 481776 267321459
EST42 445859 239425658
EST43 478003 281971780
EST44 514559 258507525
EST45 432115 256080139
EST46 555545 284627171
EST47 428549 244644468
EST48 427350 248367124
EST49 356408 171252905
EST5 553081 304493059
EST50 380013 160923523
EST51 497766 268661754
EST52 567821 321096038
EST53 424697 286367550
EST54 443979 244346760
EST55 479995 282630884
EST56 435436 238017594
EST57 475812 267264809
EST58 456697 277492215
EST59 423516 247601577
EST6 554208 330648550
EST60 493790 328213670
EST61 453345 279929538
EST62 446534 228511008
EST63 442054 273170269
EST64 430879 276096116
EST65 387044 256147759
EST66 499348 272756277
EST67 492309 275432928
EST68 504996 275600854
EST69 546290 305077232
EST7 540105 306846766
EST70 553829 334809249
EST71 537336 343664681
EST72 571859 312688191
EST73 457976 272413041
EST74 455395 315122095
EST75 437072 292981329
EST76 478581 283595158
EST77 381953 266593478
EST78 394074 275427532
EST79 387013 268154609
EST8 444485 136281758
EST80 405918 312454106
EST81 482029 303562360
EST82 444072 320726420
EST83 527304 302552612
EST84 595653 185509320
EST85 484936 324185653
EST86 500884 319871396
EST87 514673 307428564
EST88 665381 324722530
EST89 573480 246149740
EST9 610686 285528423
EST90 502848 317635102
EST91 506437 296786309
EST92 556465 189646982
EST93 522816 322339813
EST94 435662 248284254
EST95 565188 195459952
EST96 539298 245456385
EST97 565908 213435810
EST98 480324 291578683
EST99 493591 315895139
GSS1 483479 349296758
GSS10 549398 306200402
GSS11 509423 310376613
GSS12 538965 349860615
GSS13 509966 374571319
GSS14 512828 347179763
GSS15 616180 341875744
GSS16 601325 382166328
GSS17 554041 299119263
GSS18 526423 376158987
GSS19 511572 348071364
GSS2 460201 347841793
GSS20 577692 368004477
GSS21 604911 430653437
GSS22 539650 313867816
GSS23 480128 288835407
GSS24 520556 344312424
GSS25 527717 338255365
GSS26 534248 340858599
GSS27 635961 302776424
GSS28 603256 311457182
GSS29 565793 359083465
GSS3 458540 341240724
GSS30 481776 375188147
GSS31 477307 346769440
GSS32 527310 371157179
GSS33 582683 334711180
GSS34 455748 343138471
GSS35 528008 355610411
GSS36 503502 237594580
GSS37 571262 298776721
GSS38 410423 304951180
GSS39 400436 328705208
GSS4 570402 278278440
GSS40 413921 339245797
GSS41 405497 322825444
GSS42 412914 336687443
GSS43 411124 339534803
GSS44 403630 324267442
GSS45 492110 342591421
GSS46 551425 342687655
GSS47 595773 396914217
GSS48 591336 415945153
GSS49 485562 343093739
GSS5 490746 253738527
GSS50 503549 287770639
GSS51 554830 374121090
GSS52 550430 333256703
GSS53 524885 392924779
GSS54 619764 367277711
GSS55 482999 336634680
GSS56 452062 410212064
GSS57 449905 353090294
GSS58 541536 372218794
GSS59 549588 336343465
GSS6 467594 255861593
GSS60 603164 386815772
GSS61 550814 394198266
GSS62 479566 405372981
GSS63 483522 432108982
GSS64 500594 386846589
GSS65 693919 182281475
GSS66 722417 183320408
GSS67 550656 296527024
GSS68 486339 437767473
GSS69 664155 209652989
GSS7 387194 193364516
GSS70 497910 271795430
GSS71 469823 373072015
GSS72 558235 396415803
GSS73 514612 301975971
GSS74 536492 324108794
GSS75 577883 423388755
GSS76 592228 423063871
GSS77 614795 293252526
GSS78 578512 442245852
GSS79 218692 107340587
GSS8 446633 219821351
GSS9 493291 281336228
HTC1 105590 213533747
HTC2 401591 390665398
HTC3 144384 137071023
HTG1 11398 1117560132
HTG10 6350 1134106153
HTG11 7062 1123865166
HTG12 7026 1130939026
HTG13 7013 1154694359
HTG14 7057 1150125682
HTG15 6831 1156870599
HTG16 6287 1141547857
HTG17 6819 1143695002
HTG18 8686 1144543963
HTG19 9215 1092227754
HTG2 7566 1119083438
HTG20 9512 1082832923
HTG21 8342 1123201930
HTG22 7079 1136335249
HTG23 6609 1155598595
HTG24 7648 1153326826
HTG25 5037 585490676
HTG3 5928 1131528069
HTG4 5455 1141252380
HTG5 5356 1144862828
HTG6 5358 1145015310
HTG7 6607 1133078642
HTG8 6863 1144292626
HTG9 6252 1140248232
INV1 273492 651552751
INV10 51 1175944582
INV100 90 1149938021
INV100 24 1183019498
INV100 9 1174682958
INV100 16 1159910001
INV100 10 1125198822
INV100 8 1168893861
INV100 10 1181886938
INV100 11 1124349472
INV100 17 1182045163
INV100 66 1168249651
INV100 46 1181676885
INV101 41 1174569690
INV101 67 1183721606
INV101 61 1183955448
INV101 71 1165637419
INV101 71 1168207696
INV101 71 1182625271
INV101 75 1163687121
INV101 41 1173501709
INV101 26 1181951868
INV101 53 1170041755
INV101 84 1181215442
INV102 74 1182456330
INV102 41 1180714263
INV102 66 1182246249
INV102 11 1133060275
INV102 49 1168521872
INV102 30 1137158099
INV102 5 1073216512
INV102 7 1125700450
INV102 10 1171368215
INV102 13 1116949082
INV102 39 1178586861
INV103 72 1180300921
INV103 57 1180020732
INV103 52 1112683271
INV103 9 1098315678
INV103 36 1180882190
INV103 84 1169985231
INV103 98 1171209577
INV103 74 1182282736
INV103 76 1183432832
INV103 66 1177544287
INV103 36 1173038194
INV104 63 1183268016
INV104 63 1167297517
INV104 57 1151507332
INV104 22 1171547234
INV104 26 1177143463
INV104 26 1139929052
INV104 22 1084854477
INV104 6 1091477445
INV104 8 1085017551
INV104 16 1158537880
INV104 32 1126036225
INV105 46 1172729285
INV105 16 1168305744
INV105 27 1076945583
INV105 10 1168343815
INV105 66 1175042348
INV105 87 1182131347
INV105 61 1128862030
INV105 70 1181778157
INV105 98 1147402933
INV105 52 1179142037
INV105 44 1171761664
INV106 67 1174257075
INV106 47 1163489626
INV106 54 1180334176
INV106 116 1175360765
INV106 55 1182105592
INV106 110 1176156631
INV106 72 1173511525
INV106 73 1172679097
INV106 40 1114811988
INV106 10 1098002852
INV106 52 1174697800
INV107 775 1174689749
INV107 58 1166794818
INV107 40 1164346843
INV107 46 1177065364
INV107 35 1181965147
INV107 34 1069160500
INV107 11 1160223324
INV107 13 1134890516
INV107 22 1172221719
INV107 54 1173700345
INV107 9 1082368318
INV108 61 1157120031
INV108 11 1112847074
INV108 23 1180169940
INV108 163134 482936247
INV109 31 1173292515
INV11 75 1121226569
INV110 42300 972990845
INV111 416786 268623822
INV112 442164 322312362
INV113 451135 362411161
INV114 420793 403994918
INV115 211478 737487094
INV116 335563 911143076
INV117 175987 1007044948
INV118 190032 1023686434
INV119 314674 948962787
INV12 11 1128947860
INV120 532132 812156511
INV121 150793 946789418
INV122 559947 798666922
INV123 333510 935192861
INV124 78775 1084222756
INV125 189063 1020829929
INV126 576789 778256940
INV127 300528 596144943
INV128 286535 109978900
INV129 309498 165661773
INV13 13 1147046285
INV130 428495 366187371
INV131 192064 817718172
INV132 15 1049417950
INV133 5 1069690714
INV134 24 1162836797
INV135 59 1158687670
INV136 846 1177944383
INV137 73 1164213597
INV138 11 1075757141
INV139 915 1173638389
INV14 13 1041715951
INV140 74 1178807631
INV141 82 1182787957
INV142 44 1172446807
INV143 54 1173395201
INV144 77 1175033503
INV145 53 1110435514
INV146 39 1177658136
INV147 46 1156001825
INV148 31 1179378047
INV149 23 1103621514
INV15 120 1124481273
INV150 55 1171906377
INV151 61 1176595073
INV152 22 1065753823
INV153 8 1160095586
INV154 82 1175596191
INV155 61 1160003533
INV156 49 1177578721
INV157 94 1182399343
INV158 107 1164654370
INV159 348 1178754731
INV16 72 1148335729
INV160 81 1173603914
INV161 62 1163741821
INV162 68 1176341161
INV163 23 1117715873
INV164 17 1165496987
INV165 31 1177864835
INV166 63 1173828113
INV167 42 1098488573
INV168 197 1182084174
INV169 43 1173758629
INV17 26 1110333705
INV170 30 1163071443
INV171 33 1150779494
INV172 21 1130641041
INV173 34 1165811549
INV174 69 1167363915
INV175 107 1139707051
INV176 46 1144147418
INV177 64 1181555988
INV178 26 1149655799
INV179 25 1129595560
INV18 11 1152075317
INV180 4 1063536830
INV181 36 1180705104
INV182 26 1177137263
INV183 26 1137588813
INV184 23 1162215868
INV185 38 1009439894
INV186 18 1078663242
INV187 7 1139607402
INV188 63 1109671322
INV189 72 1118897610
INV19 25 1142731532
INV190 36 1075862039
INV191 83 1177178814
INV192 90 1183295929
INV193 49 1163680138
INV194 6 1067536953
INV195 45 1146467224
INV196 19 1046867413
INV197 9 1164226515
INV198 27 1135775304
INV199 133 1102741218
INV2 47329 1061215166
INV20 83 1119700353
INV200 38 1100396957
INV201 13 1179677959
INV202 45 1183185772
INV203 57 1153107140
INV204 29 1135569658
INV205 72 1177627269
INV206 51 1169733098
INV207 35 1148265513
INV208 21 978254821
INV209 37 1153788721
INV21 269 1145330434
INV210 25 1171345473
INV211 25 1138659415
INV212 34 1171237378
INV213 54 1180751072
INV214 13 989789286
INV215 26 1179421211
INV216 41 1084185462
INV217 14 1149630139
INV218 30 1172150422
INV219 12 988256607
INV22 86 1175738999
INV220 46 1181236856
INV221 30 1071303334
INV222 10 1116962374
INV223 39 1105305998
INV224 10 1158047402
INV225 58 1167006603
INV226 73 1181270472
INV227 73 1158289704
INV228 43 1174552499
INV229 96 1174494335
INV23 147 1181970090
INV230 39 1175669524
INV231 41 1174392858
INV232 34 1017303632
INV233 20 1091394276
INV234 46 1071904885
INV235 14 1173538008
INV236 53 1173770120
INV237 22 1174925624
INV238 52 1165222203
INV239 9 1135243928
INV24 57 1181883937
INV240 37 1091829023
INV241 61 1183021647
INV242 40 1163223276
INV243 31 1154223394
INV244 45 1052580145
INV245 6 1093677472
INV246 75 1080810493
INV247 6 1184020055
INV248 23 1164597292
INV249 22 1124986753
INV25 53 1161508282
INV250 48 1121283596
INV251 43 1180336726
INV252 36 1148733597
INV253 29 1162221689
INV254 53 1178763719
INV255 185 1134741007
INV256 14 1067550412
INV257 22 1169773962
INV258 42 1118586349
INV259 9 1182202232
INV26 54 1165147075
INV260 63 1164008297
INV261 10 1160133805
INV262 10 1097001354
INV263 46 1148288042
INV264 27 1163598379
INV265 60 1178007008
INV266 32 1154901090
INV267 13 1098887600
INV268 21 1149605523
INV269 33 1134762344
INV27 54 1165175634
INV270 53 1178457892
INV271 8 1046788973
INV272 47 1183581792
INV273 23 1141449862
INV274 375 1180236783
INV275 96 1139172162
INV276 19 1168497183
INV277 38 1138754106
INV278 17 1166894898
INV279 25 1094539453
INV28 53 1161536841
INV280 25 1071893119
INV281 26 1091050727
INV282 24 1061687259
INV283 10 1056135378
INV284 16 1070828630
INV285 12 1117452242
INV286 14 1123071741
INV287 19 1085845070
INV288 60 1126302065
INV289 11 1142405959
INV29 55 1176883823
INV290 29 1173978223
INV291 61 1171216006
INV292 27 1176340908
INV293 99 1091785749
INV294 10 1128248621
INV295 28 1151851000
INV296 38 1156027306
INV297 50 1179318313
INV298 46 1176220893
INV299 86 1126855865
INV3 177 1180760700
INV30 57 1177011707
INV300 11 1150190119
INV301 18 1175856240
INV302 34 1180837817
INV303 13 1046470165
INV304 16 1179517444
INV305 37 1166090880
INV306 23 1158756635
INV307 60 1148464830
INV308 56 1179257620
INV309 38 1182747184
INV31 43 1144408048
INV310 31 1172359644
INV311 15 1123674596
INV312 29 1165109564
INV313 55 1179922467
INV314 32 1138787479
INV315 10 431161191
INV316 1 2140038457
INV317 1 1533311695
INV318 1 991394496
INV319 1 709211797
INV32 66 1057886773
INV320 2 1097626663
INV321 3 1157353054
INV322 5 1139385694
INV323 25 1133784150
INV324 63 1181878340
INV325 101 1158086146
INV326 38 1181278882
INV327 286 1183080436
INV328 45 1154854736
INV329 61 1174533348
INV33 4 1099789685
INV330 32 1008528964
INV331 27 1174263346
INV332 64 1149369266
INV333 26 1183364031
INV334 67 1168339909
INV335 66 1147884150
INV336 44 965200748
INV337 8 1166380755
INV338 39 1173103949
INV339 62 1126817827
INV34 11 1166366342
INV340 64 1170795920
INV341 47 1172322211
INV342 10 1113379081
INV343 14 1164469949
INV344 61 1167552745
INV345 62 1125544552
INV346 54 1169401059
INV347 31 1176053521
INV348 43 1171176178
INV349 14 1116220489
INV35 45 1172392986
INV350 17 1150285064
INV351 45 1165961048
INV352 56 1112251606
INV353 15 1164046658
INV354 98 1179269248
INV355 40 1157032737
INV356 60 1179722234
INV357 67 1152073239
INV358 80 1180095790
INV359 48 1177743598
INV36 155 1116692585
INV360 40 1169609794
INV361 49 1167566562
INV362 53 1180763297
INV363 64 1167962091
INV364 52 1179788115
INV365 41 1077008198
INV366 8 1143611054
INV367 32 1178180889
INV368 55 1169726953
INV369 30 1143514541
INV37 24 1170570773
INV370 42 1181985768
INV371 49 1170651243
INV372 60 1177770436
INV373 58 1163899303
INV374 48 1179283094
INV375 51 1009239312
INV376 45 1170597051
INV377 33 1149912987
INV378 213 1131427468
INV379 63 1171437391
INV38 71 1164866290
INV380 76 1168488225
INV381 62 1166044751
INV382 54 1175149356
INV383 44 1155919506
INV384 237 1056358889
INV385 17 1176712065
INV386 30 1120655481
INV387 29 1165843079
INV388 39 1171071737
INV389 56 1177442728
INV39 45 1011295912
INV390 34 1176994701
INV391 49 1167953952
INV392 73 1168533590
INV393 58 1162130134
INV394 35 1173169764
INV395 68 1169176711
INV396 55 1177852925
INV397 47 1183600727
INV398 48 1181899572
INV399 42 1167995858
INV4 26 1178079121
INV40 4 998366792
INV400 337 1170755978
INV401 38 1163700627
INV402 51 1176507144
INV403 23 1109670578
INV404 10 1151709943
INV405 6 1065246632
INV406 292 1180288671
INV407 59 1165848044
INV408 41 1163567748
INV409 12 1044631257
INV41 5 1050770171
INV410 68 1177050385
INV411 65 1172210463
INV412 49 1161182414
INV413 53 1162135205
INV414 61 1169504490
INV415 53 1178451492
INV416 54 1167857969
INV417 41 1157720543
INV418 15 1130065300
INV419 21 1172240161
INV42 6 993715375
INV420 23 1179640685
INV421 58 1179007315
INV422 65 1168494135
INV423 15 1170602412
INV424 68 1140944349
INV425 20 1182068121
INV426 51 1161151176
INV427 289 1181800355
INV428 58 1183778194
INV429 56 1152524873
INV43 5 1151519287
INV430 37 1181059764
INV431 33 1183150543
INV432 17 1162895880
INV433 8 1168073996
INV434 16 953821265
INV435 23 1165093501
INV436 28 1178140243
INV437 26 1153570909
INV438 57 1183229295
INV439 98 1168775988
INV44 6 1094883419
INV440 30 1175624374
INV441 48 1183765169
INV442 33 1182834679
INV443 62 1166367683
INV444 39 1159631380
INV445 47 1173723338
INV446 29 1179286913
INV447 54 1120407820
INV448 49 1182565343
INV449 44 1173820162
INV45 8 1130260688
INV450 8 1099778931
INV451 9 1112149363
INV452 6 1182219113
INV453 53 1167128077
INV454 57 1099506648
INV455 48 1183468124
INV456 28 1157438427
INV457 264 1160173680
INV458 39 1150347320
INV459 32 1182321740
INV46 9 1130297891
INV460 60 1180145995
INV461 60 1009480385
INV462 6 1089485995
INV463 7 1094680253
INV464 8 1121227790
INV465 40 1040605372
INV466 24 1175286942
INV467 40 1169498334
INV468 69 1169527918
INV469 38 1167718847
INV47 11 1061363842
INV470 46 1106067541
INV471 76 1181623637
INV472 62 1166674309
INV473 48 1128684741
INV474 7 1073869934
INV475 9 1134446170
INV476 29 1155126807
INV477 36 1063228700
INV478 41 1147739941
INV479 35 1174169233
INV48 5 1140274668
INV480 71 1171166426
INV481 63 1163209472
INV482 36 1170458138
INV483 68 1145964553
INV484 52 1183966324
INV485 68 1156021793
INV486 41 1172670489
INV487 21 1170398795
INV488 70 1179432986
INV489 20 1182172308
INV49 6 1125723435
INV490 17 1150135378
INV491 34 1035588533
INV492 9 1164322602
INV493 11 696616259
INV494 4 1098480882
INV495 17 1128239493
INV496 46 1163147483
INV497 31 1166555587
INV498 18 1170697502
INV499 54 1183402121
INV5 79 1180204163
INV50 6 1010603762
INV500 36 1116252282
INV501 15 1175006159
INV502 53 1134197867
INV503 39 1160762091
INV504 6 784756776
INV505 13 1180329439
INV506 23 1176174170
INV507 16 1154965186
INV508 15 1140373678
INV509 19 1165846000
INV51 4 1036851011
INV510 25 1165673556
INV511 35 1091962304
INV512 45 1146902933
INV513 78 1166964687
INV514 86 1180374172
INV515 62 1158067952
INV516 20 1152935285
INV517 28 1153368036
INV518 23 1115796990
INV519 13 1159346242
INV52 5 1047077346
INV520 43 1181378857
INV521 37 1169051928
INV522 35 1181587883
INV523 19 1105257605
INV524 41 1175491415
INV525 246 1134291414
INV526 74 1162039097
INV527 42 1171899175
INV528 64 1182150917
INV529 61 1182594997
INV53 5 904855149
INV530 39 1172872119
INV531 49 1146195324
INV532 11 1057543841
INV533 7 1014602742
INV534 7 1107402104
INV535 19 1154917770
INV536 95 1173818277
INV537 7 1115785790
INV538 23 1036981527
INV539 8 1167420667
INV54 4 1094673453
INV540 167 1122798086
INV541 31 1170423181
INV542 61 1072140099
INV543 12 1138976695
INV544 52 1179942942
INV545 40 1164292766
INV546 19 1136158039
INV547 20 1144004416
INV548 54 1165837308
INV549 35 1078430477
INV55 5 1081852177
INV550 10 1178565949
INV551 103 1177126579
INV552 70 1163288709
INV553 37 1094738481
INV554 7 1063903586
INV555 5 1033425372
INV556 5 1133793345
INV557 6 1097022162
INV558 10 1144083606
INV559 15 1178286721
INV56 203688 848038803
INV560 56 1151206074
INV561 40 1178349688
INV562 212 1125947535
INV563 64 1165292200
INV564 48 1173158005
INV565 98 1180185400
INV566 27 1016054183
INV567 7 1084999665
INV568 22 1159672490
INV569 79 1180045721
INV57 283233 646074924
INV570 34 1180395502
INV571 24 1176439710
INV572 31 1175918517
INV573 60 1173881038
INV574 33 1183137119
INV575 40 1101227863
INV576 13 1172407254
INV577 10 1133270109
INV578 17 1160986959
INV579 63 1172188697
INV58 99 1182304744
INV580 54 1170794397
INV581 48 1051005091
INV582 6 1070516134
INV583 8 1118290074
INV584 45 1146385407
INV585 46 1174606946
INV586 39 1180186297
INV587 14 1154040621
INV588 42 1175882988
INV589 13 1082868413
INV59 76 1173772030
INV590 9 1097592820
INV591 12 1151483778
INV592 20 1178884046
INV593 54 1183961763
INV594 24 1154215854
INV595 36 1160641988
INV596 60 1177039901
INV597 38 947745255
INV598 38 1164056076
INV599 19 968254082
INV6 175 1135542232
INV60 53 1093154771
INV600 5 1135738023
INV601 46 1175547441
INV602 32 956576233
INV603 7 1137083933
INV604 201 1166190476
INV605 42 1183407016
INV606 17 1183129312
INV607 26 1163552733
INV608 20 1135116210
INV609 26 1157264987
INV61 58 1157640454
INV610 36 1165361880
INV611 25 1068168358
INV612 8 1153759493
INV613 13 1168468854
INV614 41 1165774021
INV615 8 1116094366
INV616 27 1179116268
INV617 54 1175536841
INV618 44 890161313
INV619 30 1158313566
INV62 102 1182392531
INV620 9 1064619624
INV621 43 1157155112
INV622 59 1183785476
INV623 46 1178984177
INV624 50 1170246046
INV625 40 1175116562
INV626 57 1150518809
INV627 34 1182961037
INV628 67 1171683919
INV629 32 1036846468
INV63 40 1172719207
INV630 41 1175776049
INV631 59 1158249913
INV632 57 1181123187
INV633 54 1165591773
INV634 24 1157528745
INV635 16 1154368054
INV636 51 1166471254
INV637 27 1124653331
INV638 14 1159484511
INV639 22 1182454075
INV64 75 1176028078
INV640 17 1003622594
INV641 6 1027416730
INV642 21 1161892934
INV643 50 831753780
INV644 4 1089471972
INV645 9 1101980534
INV646 44 1175702680
INV647 41 1131505858
INV648 10 1066812585
INV649 4 980796239
INV65 250377 717596964
INV650 20 1183594436
INV651 43 1163249106
INV652 47 1144061752
INV653 10 1165110718
INV654 62 1179093290
INV655 52 1180864361
INV656 47 1159707827
INV657 12 1023645300
INV658 3 1157463834
INV659 3 1060904444
INV66 28975 1130990238
INV660 4 1181112588
INV661 15 1171997463
INV662 28 938338623
INV663 5 1137688336
INV664 16 1154482827
INV665 50 1180339018
INV666 31 1179713034
INV667 31 1098347645
INV668 8 1160538827
INV669 18 1021456030
INV67 134 1182135009
INV670 2 1006091031
INV671 2 951616379
INV672 2 871667885
INV673 2 818376178
INV674 3 1052261518
INV675 3 939543120
INV676 32 1090180866
INV677 6 1170627702
INV678 32 1053262233
INV679 8 1121167788
INV68 63 1164365485
INV680 9 1108544100
INV681 11 1152684900
INV682 14 1154185609
INV683 38 1134271676
INV684 19 1177658696
INV685 44 1177518978
INV686 22 1079647998
INV687 11 1179569133
INV688 5 887314561
INV689 1 690419613
INV69 76 1164309138
INV690 1 688810701
INV691 1 639929110
INV692 1 625027500
INV693 1 623195831
INV694 1 617718696
INV695 2 1167479169
INV696 2 1124973432
INV697 2 972905134
INV698 6 1143958739
INV699 41 1179501029
INV7 166505 849272741
INV70 166 1169603568
INV700 39 1145476693
INV701 14 1142072413
INV702 21 1176695123
INV703 31 1172264547
INV704 62 1137054351
INV705 27 1175819084
INV706 23 891961094
INV707 9 1167542534
INV708 67 1134243551
INV709 26 1029705715
INV71 65 1143339972
INV710 3 1143035150
INV711 43 1165738581
INV712 12 1137462971
INV713 5 1072259877
INV714 7 1180876279
INV715 35 1175805876
INV716 18 1093802415
INV717 22 1176383333
INV718 57 1183010513
INV719 53 1179327736
INV72 86 1159007076
INV720 21 1167194720
INV721 40 1176398187
INV722 42 1147439138
INV723 27 1168321087
INV724 23 1166281917
INV725 33 1151216138
INV726 18 1000323493
INV727 25 1183567352
INV728 37 1092604927
INV729 195 1163550044
INV73 81 1177581121
INV730 33 950798212
INV731 30 1152607316
INV732 37 1165714265
INV733 33 1068556053
INV734 11 1115976464
INV735 27 1161045343
INV736 35 1171844836
INV737 33 1159525911
INV738 41 1180390883
INV739 11 1024131553
INV74 74 1176312154
INV740 9 1085975686
INV741 42 1147992208
INV742 37 1181637273
INV743 38 1081813347
INV744 3 1174046842
INV745 20 1178261379
INV746 46 1178413119
INV747 13 1142733896
INV748 10 1130174875
INV749 22 1175825264
INV75 58 1180815623
INV750 19 1163517885
INV751 18 1152640158
INV752 15 1147311777
INV753 11 1091619980
INV754 38 1170155090
INV755 29 1173715878
INV756 35 835977582
INV757 2 940631047
INV758 2 928744483
INV759 2 883129211
INV76 89 1173815142
INV760 3 1143834446
INV761 4 1134397883
INV762 250 1171544750
INV763 44 1136955202
INV764 10 1154316587
INV765 49 1174737284
INV766 29 1166236126
INV767 12 1175327206
INV768 45 1153063095
INV769 36 1105816193
INV77 431116 356680313
INV770 51 1142429844
INV771 33 1069665695
INV772 39 1139985500
INV773 32 1175690890
INV774 20 1132543617
INV775 24 1176271695
INV776 63 1133933129
INV777 142 1139463992
INV778 36 1181524309
INV779 24 1115387771
INV78 456573 339953219
INV780 49 1150209817
INV781 20 1083179547
INV782 8 1098795584
INV783 10 1147577596
INV784 12 1181888711
INV785 27 1175290982
INV786 40 1060130206
INV787 8 1129793124
INV788 40 1160847583
INV789 31 1180662633
INV79 462402 341199296
INV790 30 1171761940
INV791 25 1081426888
INV792 18 1003956340
INV793 5 1028031751
INV794 8 1084093438
INV795 9 1085930053
INV796 12 1156139919
INV797 16 1152066914
INV798 34 1175667989
INV799 70 1176610322
INV8 116 1053214729
INV80 439147 288345310
INV800 24 1179259380
INV801 11 1105396847
INV802 12 1115650974
INV803 13 1176755746
INV804 35 1182242624
INV805 13 962698360
INV806 4 998118856
INV807 11 1172986735
INV808 34 1119944490
INV809 51 1169563167
INV81 415888 246928030
INV810 13 1118920573
INV811 72 1179683902
INV812 79 1118509722
INV813 7 1078681531
INV814 11 1179163002
INV815 22 789281094
INV816 4 1079695977
INV817 9 1111645608
INV818 16 1182708412
INV819 31 1103328307
INV82 412374 267268642
INV820 25 853793460
INV821 7 1129785984
INV822 19 1105886509
INV823 9 1143534659
INV824 13 1174582815
INV825 69 1175357321
INV826 80 1153031168
INV827 41 1164065325
INV828 61 1162032954
INV829 40 1123882437
INV83 446673 344283316
INV830 9 1130047032
INV831 11 1116235507
INV832 13 1126566723
INV833 28 1172489440
INV834 51 1136459610
INV835 12 1062372964
INV836 10 1112670569
INV837 68 1181896580
INV838 71 1177368065
INV839 65 1111204596
INV84 445501 595740707
INV840 15 1173116435
INV841 37 1142589085
INV842 12 1124247542
INV843 19 1161505884
INV844 24 1171403553
INV845 41 1165677686
INV846 20 1180506747
INV847 15 1170391368
INV848 42 1165980829
INV849 40 1171861906
INV85 279870 885835726
INV850 36 1077524818
INV851 9 1047907154
INV852 8 1141384454
INV853 15 1168272058
INV854 61 1178023607
INV855 65 1170721200
INV856 14 1053590254
INV857 10 1057950276
INV858 8 1127887377
INV859 4 1020160878
INV86 305332 837984195
INV860 7 1147749005
INV861 33 1176769105
INV862 20 1168205515
INV863 12 1141663061
INV864 39 1171208474
INV865 9 974544864
INV866 10 1175733994
INV867 39 1166578258
INV868 29 1161961409
INV869 21 1037891489
INV87 195120 954133301
INV870 25 1178490259
INV871 53 1169873765
INV872 86 1176021019
INV873 75 1177037179
INV874 32 1151881647
INV875 8 1135911959
INV876 8 919810433
INV877 3 1139338401
INV878 3 972340244
INV879 4 1157140290
INV88 3638 1130213555
INV880 5 1126736368
INV881 31 1182264396
INV882 66 1178364544
INV883 35 1034534722
INV884 44 1177143306
INV885 43 1083170751
INV886 9 1127837545
INV887 49 1177583056
INV888 70 1183935958
INV889 70 1175817111
INV89 997 1180528551
INV890 48 1144611323
INV891 20 1130825940
INV892 84 1178249363
INV893 74 1171197019
INV894 50 1179606929
INV895 78 1175655092
INV896 75 1173593307
INV897 30 1132766399
INV898 13 1149268122
INV899 55 1173118698
INV9 147 1089529911
INV90 10611 1072551043
INV900 57 1183964102
INV901 72 1163162176
INV902 69 1170172550
INV903 55 1171372002
INV904 69 1174685523
INV905 49 1059075259
INV906 11 1138880319
INV907 21 1180633677
INV908 52 1182842349
INV909 20 1136109675
INV91 135 1091976539
INV910 59 1166902771
INV911 67 1180049046
INV912 60 1152975227
INV913 26 1174031121
INV914 49 1182264063
INV915 37 1167508597
INV916 82 1173831360
INV917 70 1181974399
INV918 57 1148872951
INV919 40 1169598662
INV92 807 1128444034
INV920 22 1122949879
INV921 11 1173320112
INV922 82 1180802772
INV923 83 1179519663
INV924 70 1181909064
INV925 51 1150708751
INV926 7 1146761823
INV927 8 1055443050
INV928 53 1177806892
INV929 86 1172323872
INV93 62020 1074818142
INV930 84 1180311193
INV931 73 1164334570
INV932 72 1183223171
INV933 67 1162390553
INV934 55 1182871381
INV935 34 1184074510
INV936 27 1157545289
INV937 29 1161972265
INV938 58 1177882987
INV939 65 1180837664
INV94 63 1182498503
INV940 80 1180893864
INV941 27 1164634991
INV942 25 1163917876
INV943 21 1135242236
INV944 86 1179798276
INV945 67 1176878455
INV946 51 1167587975
INV947 20 1107295341
INV948 48 1166998486
INV949 37 1141131615
INV95 87 1161713051
INV950 39 1178888356
INV951 65 1179881145
INV952 31 1149916497
INV953 79 1182580014
INV954 84 1169638868
INV955 48 1171495920
INV956 72 1172468481
INV957 65 1172923430
INV958 87 1174809060
INV959 66 1138385327
INV96 58 1176509978
INV960 55 1157177408
INV961 41 1183767190
INV962 54 1145403994
INV963 13 1177483908
INV964 17 1163670499
INV965 18 1087617850
INV966 10 1102334196
INV967 32 1165661141
INV968 78 1176142905
INV969 69 1174487870
INV97 97 1176767964
INV970 42 1172705966
INV971 55 1183806990
INV972 43 1171825405
INV973 29 1126047347
INV974 24 1165054152
INV975 55 1178862848
INV976 47 1148163762
INV977 5 1067443809
INV978 14 1169822539
INV979 66 1172480678
INV98 53 1183767471
INV980 66 1177353082
INV981 69 1162958016
INV982 31 1164230050
INV983 32 1148823264
INV984 20 1152598456
INV985 7 1043196064
INV986 9 1017702910
INV987 5 1022661575
INV988 6 1037507473
INV989 7 1047450933
INV99 65 1176381598
INV990 9 1131078777
INV991 38 1183586240
INV992 22 1106444411
INV993 44 1175827194
INV994 49 1180628303
INV995 42 1183827936
INV996 12 1170125249
INV997 12 1145634183
INV998 17 1176013975
INV999 19 1132457585
MAM1 54649 917178765
MAM10 17 1127029450
MAM100 18 998024221
MAM101 9 1129296049
MAM102 53 1144597149
MAM103 9 1076958295
MAM104 10 1091212439
MAM105 10 1183156498
MAM106 16 1135846769
MAM107 8 1092852495
MAM108 17 1061340501
MAM109 7 1070781583
MAM11 18 1142664549
MAM110 12 1145013723
MAM111 8 1169519331
MAM112 12 1133392046
MAM113 14 1122198751
MAM114 15 1135810435
MAM115 14 1093872974
MAM116 11 1141987079
MAM117 18 1168610859
MAM118 5 1017575367
MAM119 8 1092520245
MAM12 15 1132274725
MAM120 21 1083014647
MAM121 13 1112078254
MAM122 17 1118758367
MAM123 13 1165846276
MAM124 18 1100393997
MAM125 8 1179792582
MAM126 14 1041093991
MAM127 5 1164514221
MAM128 10 1172455048
MAM129 7 1165637199
MAM13 9 1181471817
MAM130 9 1082208304
MAM131 7 1132943029
MAM132 9 1122466917
MAM133 6 999063376
MAM134 5 1043899296
MAM135 9 1183016709
MAM136 14 1158872058
MAM137 14 1170139353
MAM138 11 1110325951
MAM139 11 1159492295
MAM14 14 1173406720
MAM140 11 1173441240
MAM141 14 1120745545
MAM142 9 1088893088
MAM143 12 1099118976
MAM144 17 1182972727
MAM145 12 1124668268
MAM146 16 1139882797
MAM147 9 1180843934
MAM148 16 1130346730
MAM149 7 1147471451
MAM15 10 1131536607
MAM150 14 1157587755
MAM151 5 1073397237
MAM152 10 1173167440
MAM153 12 1165618356
MAM154 18 986700581
MAM155 7 1128061078
MAM156 12 1157534009
MAM157 11 1137571448
MAM158 9 1104150082
MAM159 12 1128267746
MAM16 14 1173052009
MAM160 18 1031989209
MAM161 5 1040560864
MAM162 9 1110923230
MAM163 11 1042773086
MAM164 10 1163642923
MAM165 15283 724754917
MAM17 12 1057388218
MAM18 10 1098097203
MAM19 15 1026611779
MAM2 7 1177030125
MAM20 6 1069522997
MAM21 12 1147180873
MAM22 13 1089172779
MAM23 8 1147102555
MAM24 17 1161495983
MAM25 7 1160364752
MAM26 14 1119860958
MAM27 12 1168070061
MAM28 11 1147190445
MAM29 16 1179712380
MAM3 45056 812377816
MAM30 10 1156184385
MAM31 16 1138379370
MAM32 9 1133234150
MAM33 12 1136792441
MAM34 14 1083174451
MAM35 10 1114325055
MAM36 16 1100855100
MAM37 8 1087010659
MAM38 12 1132313879
MAM39 86259 1052143995
MAM4 5 977148124
MAM40 67632 1075398586
MAM41 20 1168721798
MAM42 260323 628322297
MAM43 1 716413629
MAM44 1 662751787
MAM45 2 1076242322
MAM46 6 1060323989
MAM47 7 1157094405
MAM48 374 1047383769
MAM49 11 1148682982
MAM5 13 1070912825
MAM50 270 1107760733
MAM51 16 1096674869
MAM52 11 1153008662
MAM53 15 1183890503
MAM54 3346 1174847022
MAM55 209458 659291453
MAM56 14 1092077466
MAM57 14 1163101092
MAM58 283 1113603904
MAM59 9 1139689185
MAM6 13 1061705218
MAM60 400 1104705819
MAM61 8 1083688240
MAM62 36 1141428289
MAM63 10 1174298463
MAM64 17 1141584519
MAM65 9 1177791867
MAM66 12 1142868678
MAM67 278 1016632173
MAM68 8 1175859851
MAM69 13 1079428393
MAM7 15 1160135387
MAM70 8 1131775367
MAM71 14 1079277413
MAM72 11 1080315572
MAM73 17 1101712135
MAM74 13 1051005117
MAM75 10 1174291860
MAM76 10 1119665667
MAM77 9 1183872739
MAM78 17 1024269365
MAM79 9 1137930415
MAM8 20 1124934750
MAM80 14 1061883364
MAM81 8 1162431176
MAM82 14 1127176217
MAM83 7 1104289556
MAM84 10 1116587684
MAM85 15 1090723901
MAM86 16 1130864720
MAM87 13 1059549871
MAM88 10 1183235581
MAM89 15 1154898355
MAM9 21 1147650305
MAM90 12 1149723292
MAM91 165 1085909386
MAM92 13 1183728650
MAM93 22 1141158435
MAM94 8 1144438750
MAM95 12 1181431425
MAM96 12 1133730981
MAM97 10 1140589415
MAM98 9 1113504619
MAM99 12 1141683482
PAT1 1093034 539685021
PAT10 688431 489282351
PAT11 677210 371938852
PAT12 520550 625173756
PAT13 707192 313512775
PAT14 603518 512090676
PAT15 1067063 29472194
PAT16 1081381 20546239
PAT17 1015188 597244424
PAT18 1080061 409395868
PAT19 1268035 483794169
PAT2 771018 511595731
PAT20 957939 647785084
PAT21 700608 783002133
PAT22 957476 615694519
PAT23 1205746 433132753
PAT24 1105895 360298443
PAT25 872586 449018987
PAT26 1586661 64029505
PAT27 1019180 511837383
PAT28 1070484 563952971
PAT29 886304 639311305
PAT3 745621 413109287
PAT30 761696 641000999
PAT31 633845 417084151
PAT32 497127 560581485
PAT33 727524 277686155
PAT34 285754 357061356
PAT35 588065 306799680
PAT36 961837 373084730
PAT37 537111 782993806
PAT38 969618 455188716
PAT39 1548538 54896125
PAT4 842828 549260886
PAT40 794851 680460169
PAT41 634643 560451533
PAT42 298174 613720394
PAT43 440312 290616054
PAT44 889649 200469917
PAT45 1073928 350037548
PAT46 722305 158194292
PAT47 562161 295357897
PAT48 436641 272412297
PAT49 683693 337144111
PAT5 692703 426144298
PAT50 548231 230169843
PAT51 636335 205213070
PAT52 457420 602422278
PAT53 384811 506982052
PAT54 762397 200710246
PAT55 602886 167459732
PAT56 253405 374210339
PAT57 862313 110750583
PAT58 961337 332036811
PAT59 776383 723417163
PAT6 748959 287586253
PAT60 566980 857437963
PAT61 661773 800495331
PAT62 746865 713761456
PAT63 990079 532289556
PAT64 707389 772084652
PAT65 730648 766263060
PAT66 756664 723875246
PAT67 459726 836540752
PAT68 704210 316880626
PAT69 847025 63837655
PAT7 704537 359977380
PAT70 853182 51598492
PAT71 873103 312174230
PAT72 743107 740743486
PAT73 755340 755945115
PAT74 1137682 489266844
PAT75 729207 240496158
PAT76 584438 410185029
PAT77 604462 444606168
PAT78 695792 290981153
PAT79 789857 552097392
PAT8 717585 514538735
PAT80 353969 266036254
PAT9 936372 600411819
PHG1 18898 659347405
PHG2 16356 686532222
PHG3 14035 271087027
PLN1 182369 828375546
PLN10 121 1176725979
PLN100 43 1182331514
PLN100 2 1161694293
PLN100 2 1153142705
PLN100 1 669220190
PLN100 1 629226312
PLN100 1 613110551
PLN100 2 1144904879
PLN100 2 1160236768
PLN100 1 658438119
PLN100 1 628047470
PLN100 1 612916554
PLN101 43 1175719222
PLN101 2 1143852611
PLN101 2 1150763450
PLN101 1 657631428
PLN101 1 629616096
PLN101 1 610488678
PLN101 2 1145704528
PLN101 2 1148031132
PLN101 1 655385637
PLN101 1 626286153
PLN101 1 610690180
PLN102 43 1183406182
PLN102 2 1141737084
PLN102 2 1145450335
PLN102 1 659936173
PLN102 1 627661034
PLN102 1 608478632
PLN102 2 1164887918
PLN102 2 1157801119
PLN102 1 654540277
PLN102 1 624453744
PLN102 1 610565479
PLN103 42 1163229317
PLN103 2 1154225896
PLN103 2 1144646810
PLN103 1 661109612
PLN103 1 624188817
PLN103 1 609603980
PLN103 2 1153106963
PLN103 2 1149274143
PLN103 1 657668641
PLN103 1 627263816
PLN103 1 611107145
PLN104 44 1182265834
PLN104 2 1143888586
PLN104 2 1151475536
PLN104 1 659552134
PLN104 1 627284235
PLN104 1 612025601
PLN104 2 1148289352
PLN104 2 1155467049
PLN104 1 660627594
PLN104 1 636764043
PLN104 1 612684114
PLN105 82 1008208987
PLN105 2 1172404752
PLN105 2 1143811555
PLN105 1 660087335
PLN105 1 626870575
PLN105 1 607666773
PLN105 2 1160190638
PLN105 2 1151319163
PLN105 1 663157241
PLN105 1 626857742
PLN105 1 607587567
PLN106 2 747319580
PLN106 2 1166417974
PLN106 2 1149892400
PLN106 1 660726353
PLN106 1 625613366
PLN106 1 606853752
PLN106 2 1145435293
PLN106 2 1148608716
PLN106 1 659649991
PLN106 1 630477981
PLN106 1 612914000
PLN107 2 884812093
PLN107 2 1159094545
PLN107 2 1155390937
PLN107 1 657190419
PLN107 1 626766831
PLN107 1 610506001
PLN107 2 1139699259
PLN107 2 1151798322
PLN107 1 659109138
PLN107 1 625619081
PLN107 1 605020174
PLN108 2 918639035
PLN108 2 1144201423
PLN108 2 1150772597
PLN108 1 660123737
PLN108 1 626033862
PLN108 1 611584699
PLN108 2 1146634294
PLN108 1 629468067
PLN108 2 1181536715
PLN108 1 634780758
PLN108 1 613857241
PLN109 7 1170902936
PLN109 2 1153523653
PLN109 2 1157943603
PLN109 1 655608708
PLN109 1 630476109
PLN109 1 611734907
PLN109 2 1148834704
PLN109 2 1153026048
PLN109 1 660958633
PLN109 1 628850999
PLN109 1 613418293
PLN11 81 1074115299
PLN110 28 1037362098
PLN110 2 1149130062
PLN110 2 1149230152
PLN110 1 662192201
PLN110 1 624651312
PLN110 1 607896916
PLN110 2 1144733231
PLN110 2 1148913967
PLN110 1 659736604
PLN110 1 626336238
PLN110 1 607408596
PLN111 2 746994619
PLN111 2 1149881386
PLN111 2 1156807113
PLN111 1 662539114
PLN111 1 634696490
PLN111 1 614659814
PLN111 2 1155079160
PLN111 2 1150818685
PLN111 1 657222892
PLN111 1 629605540
PLN111 1 613053250
PLN112 2 884447165
PLN112 2 1144594366
PLN112 2 1153001227
PLN112 1 663034619
PLN112 1 623546353
PLN112 1 613383894
PLN112 2 1145099380
PLN112 21 1178182689
PLN112 43 1173368751
PLN112 16 1115226327
PLN112 5 955353777
PLN113 2 918277773
PLN113 3 875632936
PLN113 2 877648901
PLN113 3 1033679662
PLN113 34 1141347588
PLN113 12 848648943
PLN113 1 655484837
PLN113 1 626855960
PLN113 1 604911185
PLN113 2 1146256337
PLN113 2 1152814527
PLN114 31 1165164536
PLN114 1 631897805
PLN114 1 637173558
PLN114 1 641960388
PLN114 2 1176182574
PLN114 2 1155488842
PLN114 1 660305412
PLN114 1 629753639
PLN114 1 609200707
PLN114 2 1175561398
PLN114 2 1154972860
PLN115 41 1161230213
PLN115 1 659208678
PLN115 1 627226266
PLN115 1 603942392
PLN115 2 1145038912
PLN115 2 1141862336
PLN115 1 661554418
PLN115 1 627699516
PLN115 1 609498991
PLN115 2 1148139209
PLN115 51 1161837995
PLN116 39 1104197109
PLN116 39 664623668
PLN116 2 961863683
PLN116 1 639092456
PLN116 2 1152889042
PLN116 1 616552515
PLN116 1 734473537
PLN116 2 1100022842
PLN116 2 990953513
PLN116 2 1156725275
PLN116 2 921884013
PLN117 14 1122538268
PLN117 2 954999066
PLN117 1 602817757
PLN117 2 1122645515
PLN117 35 1172890850
PLN117 34 1181509311
PLN117 92 1151713734
PLN117 41 751503334
PLN117 1 646201372
PLN117 1 587623253
PLN117 1 663525381
PLN118 23 1160343908
PLN118 2 1170194602
PLN118 2 684606446
PLN118 1 525133463
PLN118 1 663523538
PLN118 1 635405230
PLN118 1 611936476
PLN118 2 1150154113
PLN118 2 1161072711
PLN118 1 660736956
PLN118 1 627598042
PLN119 60 1155357749
PLN119 1 612187513
PLN119 2 1155070448
PLN119 2 1145745297
PLN119 1 673406957
PLN119 1 630137118
PLN119 1 612939186
PLN119 2 1151335502
PLN119 2 1155631783
PLN119 1 657661460
PLN119 1 626889213
PLN12 23 1134451674
PLN120 31 1173596134
PLN120 1 610003100
PLN120 2 1148528258
PLN120 2 1146029239
PLN120 1 662475302
PLN120 1 630354994
PLN120 1 612387238
PLN120 2 1155754903
PLN120 2 1149070389
PLN120 1 653250953
PLN120 1 631324550
PLN121 30 1150335358
PLN121 1 609093722
PLN121 2 1149523883
PLN121 2 1145083390
PLN121 1 655260812
PLN121 1 634191159
PLN121 1 614681618
PLN121 2 1172767975
PLN121 2 1152836532
PLN121 1 658721539
PLN121 1 626163282
PLN122 16 1148466888
PLN122 1 609194012
PLN122 2 1153379980
PLN122 2 1162676726
PLN122 1 656359106
PLN122 1 622273932
PLN122 1 610730036
PLN122 2 1152019255
PLN122 2 1150333174
PLN122 1 657708949
PLN122 1 625240013
PLN123 48 1182920700
PLN123 1 610861510
PLN123 2 1136292166
PLN123 2 1152354408
PLN123 1 657289215
PLN123 1 624169276
PLN123 1 611474174
PLN123 2 1152158626
PLN123 2 1154678582
PLN123 1 664634244
PLN123 1 643202471
PLN124 49 1135581028
PLN124 1 617103718
PLN124 2 1161114768
PLN124 2 1163751838
PLN124 1 660262686
PLN124 1 634680428
PLN124 1 612896067
PLN124 2 1153985512
PLN124 2 1159127655
PLN124 1 658111403
PLN124 1 631828453
PLN125 38 1163679393
PLN125 1 612358733
PLN125 2 1172628206
PLN125 2 1161043722
PLN125 1 661402595
PLN125 1 635870417
PLN125 1 617906818
PLN125 2 1154505804
PLN125 2 1161723662
PLN125 1 666500271
PLN125 1 632086707
PLN126 149 1055178691
PLN126 1 607961820
PLN126 2 1173780312
PLN126 21 1134943785
PLN126 29 1167338095
PLN126 33 1171528235
PLN126 12 1152489829
PLN126 92 1120024293
PLN126 30 1144069965
PLN126 31 1131160060
PLN126 37 1171331343
PLN127 68 1041375145
PLN127 18 1137163367
PLN127 18 1108681313
PLN127 11 1140492879
PLN127 14 1175056220
PLN127 51 1162077512
PLN127 14 989011425
PLN127 4 968685916
PLN127 4 989422041
PLN127 4 1035905487
PLN127 4 964344820
PLN128 91 1074993814
PLN128 4 1168659054
PLN128 5 1115864637
PLN128 18 1160077621
PLN128 33 1000994116
PLN128 1 2143528264
PLN128 1 2138631366
PLN128 1 2132989935
PLN128 1 2142145023
PLN128 1 2142779784
PLN128 1 124381055
PLN129 30 1068786308
PLN129 1 2112395848
PLN129 1 2144481838
PLN129 1 2133121580
PLN129 1 2141806609
PLN129 1 1870266305
PLN129 1 2134931027
PLN129 1 2108664250
PLN129 1 2146278775
PLN129 1 2117022170
PLN129 1 1576301307
PLN13 23 1086303057
PLN130 7 1072041106
PLN130 1 2067099338
PLN130 1 2134690998
PLN130 1 2136662657
PLN130 1 2140543523
PLN130 1 1531582847
PLN130 1 2146571508
PLN130 1 2138192289
PLN130 1 2101175359
PLN130 1 2146227213
PLN130 1 621086779
PLN131 20 1161844167
PLN131 1 2138605540
PLN131 1 2083688238
PLN131 1 2144314009
PLN131 1 2139184679
PLN131 1 172723629
PLN131 1 2132146989
PLN131 1 2133919239
PLN131 1 2133305249
PLN131 1 2100933269
PLN131 1 143347570
PLN132 124 1118652818
PLN132 1 2134142781
PLN132 1 2145201137
PLN132 1 2137733646
PLN132 1 1914313492
PLN132 1 2145479601
PLN132 1 2114166385
PLN132 1 2146417222
PLN132 1 1555468501
PLN132 1 2141253099
PLN132 1 2119186544
PLN133 37 1183647788
PLN133 1 2142175433
PLN133 1 1498831827
PLN133 9 1052661862
PLN133 13 1137925323
PLN133 34 858656987
PLN133 2 1034251136
PLN133 2 1041322427
PLN133 2 959575375
PLN133 2 1005137949
PLN133 2 1136683915
PLN134 134 1150551628
PLN134 2 1019386330
PLN134 3 1015418383
PLN134 2 1022027198
PLN134 2 1025363455
PLN134 2 931056427
PLN134 2 969293345
PLN134 2 1064158730
PLN134 2 968690797
PLN134 3 980008249
PLN134 2 1043031688
PLN135 20 1164850723
PLN135 2 1031876872
PLN135 2 943080858
PLN135 2 1000998827
PLN135 2 1157028134
PLN135 2 1004786053
PLN135 3 985677594
PLN135 2 1014843260
PLN135 2 1068644986
PLN135 2 948335936
PLN135 2 879747037
PLN136 21 1084415550
PLN136 2 1127570290
PLN136 2 990438732
PLN136 3 875786730
PLN136 2 991559490
PLN136 2 942009307
PLN136 2 906129229
PLN136 2 936264359
PLN136 2 928886758
PLN136 2 935093463
PLN136 2 930365420
PLN137 58 1157319736
PLN137 2 990803747
PLN137 2 885021138
PLN137 2 908456347
PLN137 2 930959077
PLN137 2 1041934893
PLN137 2 942999660
PLN137 3 908571112
PLN137 2 994915609
PLN137 2 1008745383
PLN137 2 850230395
PLN138 75 1165459334
PLN138 2 915695621
PLN138 2 1025227490
PLN138 2 862764790
PLN138 2 884517818
PLN138 2 958486939
PLN138 2 882430803
PLN138 2 805094337
PLN138 2 912116412
PLN138 2 1080442405
PLN138 2 903251998
PLN139 7 1023134224
PLN139 3 846587112
PLN139 2 997148082
PLN139 2 1024702898
PLN139 3 1046276430
PLN139 2 960152348
PLN139 2 997566044
PLN139 2 926826996
PLN139 2 970728340
PLN139 2 1076556621
PLN139 2 961846356
PLN14 85750 1022222900
PLN140 3 987843021
PLN140 3 1105984004
PLN140 2 1091311779
PLN140 2 928973494
PLN140 4 966977223
PLN140 2 1034513146
PLN140 2 973973117
PLN140 2 836784321
PLN140 2 990350501
PLN140 2 1034765442
PLN140 2 918838269
PLN141 13 1147553433
PLN141 2 998373654
PLN141 2 1023553300
PLN141 2 914623388
PLN141 2 836746646
PLN141 2 993956991
PLN141 2 952571408
PLN141 2 873792954
PLN141 3 942162386
PLN141 2 990124494
PLN141 2 909364021
PLN142 30 1169021303
PLN142 2 882617017
PLN142 2 897026796
PLN142 2 1002960583
PLN142 2 873235512
PLN142 2 976812402
PLN142 2 1096125550
PLN142 2 964192102
PLN142 2 869744809
PLN142 2 940385236
PLN142 2 956987604
PLN143 43 1175210350
PLN143 2 893651928
PLN143 11 1138345400
PLN143 17 1160613983
PLN143 17 1152282495
PLN143 17 1161769737
PLN143 17 1137473602
PLN143 16 1149378136
PLN143 17 1140788494
PLN143 17 1173897061
PLN143 17 1169465378
PLN144 27 1138426334
PLN144 9 1142566106
PLN144 1 827770304
PLN144 1 819590567
PLN144 1 657919172
PLN144 1 735222392
PLN144 1 640551262
PLN144 2 850883630
PLN144 1 641523445
PLN144 1 830702509
PLN144 1 817725293
PLN145 25 1148725445
PLN145 1 657518596
PLN145 1 728079018
PLN145 1 637620844
PLN145 2 841520699
PLN145 2 787615973
PLN145 2 1005487930
PLN145 2 870370402
PLN145 2 954925343
PLN145 2 877145967
PLN145 2 915888348
PLN146 26 1166741474
PLN146 2 951785915
PLN146 2 976596859
PLN146 2 981034558
PLN146 2 853229614
PLN146 2 968208187
PLN146 2 1065368112
PLN146 2 928206292
PLN146 3 960272742
PLN146 2 1022027198
PLN146 2 1025363455
PLN147 51 1170654916
PLN147 2 931056427
PLN147 2 969293345
PLN147 2 1064158730
PLN147 2 968690797
PLN147 3 980008249
PLN147 2 991559490
PLN147 2 942009307
PLN147 2 906129229
PLN147 2 936264359
PLN147 2 928886758
PLN148 35 1180644427
PLN148 2 935093463
PLN148 2 930365420
PLN148 2 990803747
PLN148 2 885021138
PLN148 2 908456347
PLN148 2 930959077
PLN148 2 1041934893
PLN148 2 942999660
PLN148 3 908571112
PLN148 2 934307380
PLN149 35 1178309823
PLN149 2 919820886
PLN149 2 904199719
PLN149 2 879641827
PLN149 2 1019726094
PLN149 2 948044567
PLN149 2 935988512
PLN149 2 1001554393
PLN149 2 1004892626
PLN149 2 870794531
PLN149 2 886494923
PLN15 232746 566509409
PLN150 34 1165044314
PLN150 2 1089597455
PLN150 2 891403268
PLN150 3 916201336
PLN150 2 994915609
PLN150 2 1008745383
PLN150 2 850230395
PLN150 2 915695621
PLN150 2 1025227490
PLN150 2 862764790
PLN150 2 884517818
PLN151 34 1166648442
PLN151 2 958486939
PLN151 2 882430803
PLN151 2 805094337
PLN151 2 912116412
PLN151 2 1080442405
PLN151 2 903251998
PLN151 3 846587112
PLN151 2 1034251136
PLN151 2 1041322427
PLN151 2 959575375
PLN152 34 1154235685
PLN152 2 1005137949
PLN152 2 1136683915
PLN152 2 1019386330
PLN152 3 1015418383
PLN152 2 997148082
PLN152 2 1024702898
PLN152 3 1046276430
PLN152 2 960152348
PLN152 2 997566044
PLN152 2 926826996
PLN153 35 1181945520
PLN153 2 970728340
PLN153 2 1076556621
PLN153 2 961846356
PLN153 3 1105984004
PLN153 2 1091311779
PLN153 2 928973494
PLN153 4 994697394
PLN153 2 1128818178
PLN153 2 1018548947
PLN153 2 883277256
PLN154 33 1182117489
PLN154 2 1015247550
PLN154 2 1033440010
PLN154 2 938819340
PLN154 3 859495519
PLN154 2 1034513146
PLN154 2 973973117
PLN154 2 836784321
PLN154 2 990350501
PLN154 2 1034765442
PLN154 2 973886503
PLN155 16 963201441
PLN155 2 992822994
PLN155 2 897431557
PLN155 2 808457311
PLN155 2 953662853
PLN155 2 1058778957
PLN155 2 930200695
PLN155 3 895052557
PLN155 2 1043031688
PLN155 2 1031876872
PLN155 2 943080858
PLN156 1 660154351
PLN156 2 1000998827
PLN156 2 1157028134
PLN156 2 1004786053
PLN156 3 985677594
PLN156 2 787615973
PLN156 2 1005487930
PLN156 2 870370402
PLN156 2 954925343
PLN156 2 877145967
PLN156 2 915888348
PLN157 1 785289892
PLN157 2 951785915
PLN157 2 976596859
PLN157 2 981034558
PLN157 2 853229614
PLN157 2 968208187
PLN157 2 1065368112
PLN157 2 928206292
PLN157 3 960272742
PLN157 4 1031468481
PLN157 29 1161715798
PLN158 1 752191036
PLN158 18 1164014015
PLN158 86 1098733546
PLN158 12 1140796870
PLN158 53 1160691643
PLN158 29 1105078032
PLN158 50 1145575965
PLN158 43 1177757480
PLN158 43 1150824379
PLN158 34 1155874556
PLN158 50 1155922795
PLN159 2 1138634422
PLN159 47 1132536680
PLN159 23 1141693484
PLN159 26 1169836001
PLN159 5 177893042
PLN159 1 1999785258
PLN159 1 1545728702
PLN159 1 1499997841
PLN159 1 1493209057
PLN159 1 1187610474
PLN159 1 943684407
PLN16 1149 781282806
PLN160 1 581969875
PLN160 8 1161825966
PLN160 39 1170204862
PLN160 39 1150468932
PLN160 50 1175229069
PLN160 53 1182975790
PLN160 11 787764687
PLN160 1 656850665
PLN160 1 633960920
PLN160 1 609171657
PLN160 2 1143703028
PLN161 1 742820188
PLN161 2 979242293
PLN161 3 990086045
PLN161 4 1070469512
PLN161 30 961812843
PLN161 2 1109448078
PLN161 1 767071137
PLN161 1 671256291
PLN161 1 670741101
PLN161 1 671191297
PLN161 1 771176557
PLN162 1 722258891
PLN162 1 643128204
PLN162 1 694350238
PLN162 1 641290954
PLN162 2 1174904300
PLN162 1 745638687
PLN162 8 1174732410
PLN162 35 1182932636
PLN162 18 1181205473
PLN162 41 1176106470
PLN162 8 972308232
PLN163 1 529961705
PLN163 5 998918288
PLN163 4 1175221657
PLN163 19 1182622585
PLN163 57 1044582350
PLN163 4 954531898
PLN163 5 1025819629
PLN163 6 984147449
PLN163 5 1137917005
PLN163 5 1007898041
PLN163 6 1070397818
PLN164 1 696896727
PLN164 5 1111212694
PLN164 6 1089162517
PLN164 3 421610440
PLN164 1 956684326
PLN164 1 561974515
PLN164 1 718270646
PLN164 1 682093502
PLN164 1 700447244
PLN164 1 683485999
PLN164 1 723946829
PLN165 1 768317091
PLN165 1 751391258
PLN165 1 651249186
PLN165 2 1175723351
PLN165 2 1136845382
PLN165 44 1170528899
PLN165 54 1049025390
PLN165 68 1088778107
PLN165 73 1119209590
PLN165 22 1127767597
PLN165 46 1093558514
PLN166 1 635914663
PLN166 68 1114528363
PLN166 41 1064490534
PLN166 10 1140443142
PLN166 29 1112900486
PLN166 70 1142119072
PLN166 99 1179912936
PLN166 96 1181404594
PLN166 67 1084884007
PLN166 2 933307241
PLN166 7 1182242757
PLN167 1 873778448
PLN167 22 1177390369
PLN167 8 1153933128
PLN167 37 1144473388
PLN167 49 1180784520
PLN167 55 1171927849
PLN167 47 1114711079
PLN167 13 1109766498
PLN167 8 1107099447
PLN167 16 1149081006
PLN167 29 1127504010
PLN168 1 759363255
PLN168 13 1018612861
PLN168 16 1052342486
PLN168 5 693259785
PLN168 2 1045973173
PLN168 2 1158403266
PLN168 80 1164277484
PLN168 199 1115126474
PLN168 18 1171120860
PLN168 21 1146591206
PLN168 31 1102785788
PLN169 1 661150927
PLN169 8 1076126098
PLN169 8 864666226
PLN169 3 1111279011
PLN169 34 1158611344
PLN169 47 1164946828
PLN169 32 1163219703
PLN169 48 929772883
PLN169 4 1128758998
PLN169 6 1144601540
PLN169 3 940719410
PLN17 1327 988962589
PLN170 1 822617018
PLN170 5 1181840911
PLN170 4 1038695499
PLN170 4 1011553213
PLN170 102 1156287238
PLN170 31 1179681258
PLN170 42 689746606
PLN170 1 1074544454
PLN170 1 1022901297
PLN170 1 981102465
PLN170 1 976125608
PLN171 1 788135348
PLN171 1 917323440
PLN171 1 850457102
PLN171 1 839193984
PLN171 1 817723161
PLN171 1 817139115
PLN171 1 814406492
PLN171 1 772677518
PLN171 1 772908146
PLN171 1 765793897
PLN171 1 761983751
PLN172 1 505466611
PLN172 1 764473882
PLN172 4 1011158055
PLN172 4 1008776197
PLN172 6 815519305
PLN172 2 991469964
PLN172 2 816205905
PLN172 3 1056510218
PLN172 3 989952844
PLN172 3 956055548
PLN172 3 919956468
PLN173 1 723777933
PLN173 7 1163446212
PLN173 28 1167164746
PLN173 16 1110397238
PLN173 39 1181990064
PLN173 67 1182319274
PLN173 74 1160385311
PLN173 73 1003005145
PLN173 6 1144285054
PLN173 5 693883568
PLN173 2 1069887694
PLN174 5 1107711193
PLN174 2 1168781261
PLN174 16 1182073380
PLN174 45 1176527092
PLN174 34 1121126959
PLN174 9 1099497021
PLN174 23 1182637469
PLN174 14 985562895
PLN174 4 1148967398
PLN174 7 1119025184
PLN174 5 1091663592
PLN175 9 1071213085
PLN175 6 1099009318
PLN175 27 1135567827
PLN175 13 1133007134
PLN175 15 1135637088
PLN175 41 1163273408
PLN175 22 1080875863
PLN175 22 1103049530
PLN175 1 949323565
PLN175 1 915317115
PLN175 1 901665926
PLN176 8 1159618597
PLN176 1 822089110
PLN176 1 755633405
PLN176 1 854068172
PLN176 2 1141141404
PLN176 2 1041566903
PLN176 2 1001403931
PLN176 2 875973322
PLN176 43 1173385605
PLN176 30 1092520979
PLN176 19 1076669045
PLN177 10 1173442874
PLN177 25 1151243202
PLN177 41 1092457164
PLN177 8 1107304518
PLN177 14 1177666894
PLN177 69 1014292140
PLN177 1 572725250
PLN177 1 685330109
PLN177 1 696943691
PLN177 1 629773018
PLN177 1 636614816
PLN178 8 1171373280
PLN178 1 579256678
PLN178 4 1005532762
PLN178 4 1052014573
PLN178 8 1098262961
PLN178 26 1152835142
PLN178 53 1178352975
PLN178 46 1144195760
PLN178 10 1088275942
PLN178 2 808999894
PLN178 28 1110443664
PLN179 10 1161735710
PLN179 24 1082876757
PLN179 1 636807515
PLN179 2 1164863489
PLN179 2 1091053465
PLN179 2 1110446937
PLN179 1 650429017
PLN179 1 615497416
PLN179 1 605521199
PLN179 2 1151975812
PLN179 2 1040516887
PLN18 446 1087262647
PLN180 8 1129219417
PLN180 1 638826493
PLN180 1 605724068
PLN180 2 1161881882
PLN180 2 1174936293
PLN180 2 1161162149
PLN180 1 618366599
PLN180 1 606666664
PLN180 2 1134915552
PLN180 2 1149087886
PLN180 1 652904783
PLN181 8 1069494202
PLN181 1 620394872
PLN181 1 604515745
PLN181 2 1143962729
PLN181 2 1109768142
PLN181 1 623097078
PLN181 2 1164411152
PLN181 2 1089609646
PLN181 2 1104012305
PLN181 1 653771317
PLN181 1 619592024
PLN182 9 1074448447
PLN182 1 602189318
PLN182 2 1138238587
PLN182 2 1141977764
PLN182 1 662784976
PLN182 1 616351571
PLN182 1 604894944
PLN182 2 1131415633
PLN182 2 1143337624
PLN182 1 655822004
PLN182 1 616990145
PLN183 120 1182682135
PLN183 1 608259649
PLN183 2 1145732503
PLN183 43 1149278425
PLN183 31 1159664024
PLN183 22 1179063734
PLN183 32 1053349457
PLN183 5 1058925349
PLN183 58 1171284441
PLN183 40 350193506
PLN183 1 1034507165
PLN184 304 1178993407
PLN184 1 739697766
PLN184 1 726504577
PLN184 1 697169871
PLN184 1 657249472
PLN184 4 1183264416
PLN184 59 1158848735
PLN184 2 740850932
PLN184 1 613116700
PLN184 2 1110847379
PLN184 1 588160925
PLN185 87 1119865306
PLN185 2 1151556468
PLN185 2 1144988165
PLN185 2 920960533
PLN185 2 964492557
PLN185 2 1026741635
PLN185 2 924313884
PLN185 2 1063012415
PLN185 2 1039365721
PLN185 2 984082969
PLN185 2 1129535037
PLN186 17 1172352472
PLN186 1 606904469
PLN186 1 704570097
PLN186 2 1075296834
PLN186 2 959428510
PLN186 2 1120194583
PLN186 2 907700912
PLN186 2 932374047
PLN186 1 584039244
PLN186 2 1095368857
PLN186 2 1067733679
PLN187 34 1172788025
PLN187 2 1002164729
PLN187 2 1135772918
PLN187 1 615082505
PLN187 1 702454015
PLN187 100106 917060652
PLN187 169964 682034018
PLN188 20 1135334274
PLN189 8 1125895389
PLN19 427 1135560877
PLN190 81 1182409497
PLN191 101 1180182470
PLN192 64 1171807776
PLN193 45 1170100474
PLN194 45 1168710177
PLN195 46 1177197899
PLN196 46 1178718944
PLN197 43 1179244142
PLN198 86 1154304978
PLN199 31 1166191555
PLN2 215256 731597975
PLN20 114 1118994310
PLN200 52 1151546761
PLN201 237254 751755908
PLN202 509375 411687646
PLN203 233960 710006777
PLN204 182277 355325139
PLN205 10166 1087116362
PLN206 17 1127522877
PLN207 513 1081243566
PLN208 4 638455445
PLN209 1 612216829
PLN21 114 1149208425
PLN210 2 1145038356
PLN211 2 1052833268
PLN212 869 1141292333
PLN213 456840 457872076
PLN214 466095 397289620
PLN215 445882 415414704
PLN216 408094 446013967
PLN217 383699 477174351
PLN218 339946 528656374
PLN219 259010 622054429
PLN22 162 1078695112
PLN220 49593 1024902656
PLN221 4968 1091848545
PLN222 1304 747796448
PLN223 1 522466905
PLN224 1 675310294
PLN225 1 628753756
PLN226 1 624247919
PLN227 2 1172266179
PLN228 8564 784313867
PLN229 1 727344967
PLN23 10 1072770395
PLN230 1 946003158
PLN231 1 965754312
PLN232 1 906459801
PLN233 1 876148008
PLN234 1 885153844
PLN235 1 899925126
PLN236 4163 1100106582
PLN237 544 1118705916
PLN238 362 1080454048
PLN239 44 568723033
PLN24 8 1134128946
PLN240 1 696809892
PLN241 1 655542733
PLN242 1 648987779
PLN243 1 622068216
PLN244 1 583456046
PLN245 132 1176770373
PLN246 1 675310294
PLN247 1 628753756
PLN248 1 624247919
PLN249 2 1172266179
PLN25 78 1117210407
PLN250 345 729691402
PLN251 1 521073757
PLN252 1 672273650
PLN253 1 634137895
PLN254 1 624121443
PLN255 2 1171800569
PLN256 2 1153005584
PLN257 1 661076038
PLN258 1 626572591
PLN259 1 612852138
PLN26 20 1139906759
PLN260 2 1169525711
PLN261 2 1136827172
PLN262 1 653624577
PLN263 1 616219606
PLN264 1 610044819
PLN265 2 1134152592
PLN266 2 1156707404
PLN267 1 685423969
PLN268 1 640667275
PLN269 1 639123876
PLN27 198 1029168242
PLN270 1 612949391
PLN271 1 577192767
PLN272 2 1141642242
PLN273 1 648922534
PLN274 1 604770208
PLN275 2 1173859433
PLN276 2 1159392798
PLN277 2 1164574848
PLN278 1 615767531
PLN279 1 605571303
PLN28 129 1027400970
PLN280 2 1142007082
PLN281 4 1166534982
PLN282 1 710194481
PLN283 1 661081403
PLN284 1 659460550
PLN285 1 630572514
PLN286 1 598618390
PLN287 1 658974642
PLN288 1 559656399
PLN289 1 717517502
PLN29 230 970536985
PLN290 1 672450454
PLN291 1 665297378
PLN292 1 636785599
PLN293 1 599706080
PLN294 1 675658265
PLN295 1 523168208
PLN296 1 671211297
PLN297 1 630677708
PLN298 1 623428415
PLN299 2 1162824663
PLN3 139579 751171144
PLN30 32 1032549426
PLN300 2 1124081839
PLN301 1 640830439
PLN302 1 597781253
PLN303 2 1170541913
PLN304 2 1151597807
PLN305 1 537457279
PLN306 1 685947972
PLN307 1 649921694
PLN308 1 641099225
PLN309 1 611845738
PLN31 76 928976765
PLN310 1 581041262
PLN311 2 1176958498
PLN312 1 667717957
PLN313 1 631819663
PLN314 1 624692602
PLN315 2 1159089013
PLN316 2 1154165677
PLN317 1 670202054
PLN318 1 631946783
PLN319 1 626743494
PLN32 4 1108823292
PLN320 2 1167772850
PLN321 2 1151941538
PLN322 1 671530377
PLN323 1 631910401
PLN324 1 622474059
PLN325 2 1160377439
PLN326 2 1159528938
PLN327 1 684336246
PLN328 1 636053469
PLN329 1 629969872
PLN33 5 1159558460
PLN330 2 1172688001
PLN331 2 1160045407
PLN332 1 665715246
PLN333 1 624683667
PLN334 1 621078253
PLN335 2 1159864294
PLN336 2 1170185454
PLN337 1 697540743
PLN338 1 655862368
PLN339 1 646765634
PLN34 75 1132167485
PLN340 1 618540729
PLN341 1 587963859
PLN342 455 1147653963
PLN343 31 909553549
PLN344 1 705338699
PLN345 1 493450010
PLN346 1 804285258
PLN347 1 810734643
PLN348 1 673981989
PLN349 1 754496630
PLN35 73 1176935891
PLN350 1 855759449
PLN351 1 614042580
PLN352 1 743847818
PLN353 1 673340788
PLN354 1 515668560
PLN355 1 713320806
PLN356 1 703598484
PLN357 1 570159854
PLN358 1 625793224
PLN359 1 721110502
PLN36 167 1039907946
PLN360 1 459355444
PLN361 1 745201001
PLN362 1 749284433
PLN363 1 643344672
PLN364 1 595297365
PLN365 1 688905267
PLN366 1 491807393
PLN367 1 769338634
PLN368 1 671568023
PLN369 1 635285330
PLN37 8 1067069293
PLN370 1 745618965
PLN371 1 839470345
PLN372 1 646400022
PLN373 1 747589525
PLN374 2 1171764895
PLN375 1 703962928
PLN376 1 702438406
PLN377 2 1178978634
PLN378 2 1173154747
PLN379 1 734536914
PLN38 106 1131642630
PLN380 1 738743901
PLN381 1 636778132
PLN382 1 602900890
PLN383 1 697493198
PLN384 1 490518203
PLN385 1 784661008
PLN386 1 810500911
PLN387 1 655314739
PLN388 1 752710991
PLN389 1 890847171
PLN39 31 1147557767
PLN390 1 621781073
PLN391 1 743084022
PLN392 1 676741658
PLN393 1 509452426
PLN394 1 710124532
PLN395 2 1058788934
PLN396 1 620140791
PLN397 1 716573881
PLN398 1 476726550
PLN399 1 756324664
PLN4 30383 957547964
PLN40 307 1036243037
PLN400 1 977471539
PLN401 2 1144819353
PLN402 1 646234737
PLN403 1 605172934
PLN404 2 1165717241
PLN405 2 1153140076
PLN406 1 590561804
PLN407 2 1176631761
PLN408 1 782694893
PLN409 1 796420183
PLN41 481 1074884690
PLN410 1 650274702
PLN411 1 739889549
PLN412 1 848590828
PLN413 1 610626473
PLN414 1 738023571
PLN415 2 1173882462
PLN416 1 701434008
PLN417 1 690770133
PLN418 1 567265955
PLN419 1 612987783
PLN42 228 1075729921
PLN420 1 704156067
PLN421 1 475327881
PLN422 1 732118298
PLN423 1 733931846
PLN424 1 636796232
PLN425 1 599764323
PLN426 1 691313424
PLN427 1 493357854
PLN428 1 782685093
PLN429 1 786410271
PLN43 416 1181505501
PLN430 1 648139033
PLN431 1 744407562
PLN432 1 835583350
PLN433 1 623221719
PLN434 1 741299132
PLN435 1 669032550
PLN436 1 517040482
PLN437 1 711661679
PLN438 1 708205786
PLN439 2 1156892395
PLN44 203 1099630913
PLN440 2 1178356817
PLN441 1 737453356
PLN442 1 736349413
PLN443 1 639162162
PLN444 1 586755746
PLN445 1 704478343
PLN446 1 492109999
PLN447 1 791475352
PLN448 1 785940626
PLN449 1 661246824
PLN45 361 1062439255
PLN450 1 756990402
PLN451 1 858776195
PLN452 1 621195942
PLN453 1 754256086
PLN454 1 670301833
PLN455 1 509263899
PLN456 1 708234589
PLN457 1 725120110
PLN458 1 575129590
PLN459 1 620883766
PLN46 69 1113727739
PLN460 1 727285804
PLN461 1 479660269
PLN462 1 745978486
PLN463 1 750160716
PLN464 1 642428577
PLN465 1 591313643
PLN466 1 705330581
PLN467 1 495656580
PLN468 1 803232604
PLN469 1 790745243
PLN47 512 1105465963
PLN470 1 657494025
PLN471 1 759305888
PLN472 1 856542542
PLN473 1 628321883
PLN474 1 754364263
PLN475 1 697113365
PLN476 1 504254270
PLN477 1 715354979
PLN478 1 713929667
PLN479 1 572943128
PLN48 146 1102088900
PLN480 1 626959190
PLN481 1 715714221
PLN482 1 483823121
PLN483 1 742917797
PLN484 1 748536659
PLN485 1 643784981
PLN486 1 600654286
PLN487 2 1171400808
PLN488 1 794150360
PLN489 1 799857935
PLN49 196 1042792452
PLN490 1 655329108
PLN491 1 749763888
PLN492 1 838116175
PLN493 1 610468321
PLN494 1 736551279
PLN495 2 1171154657
PLN496 2 1170482349
PLN497 1 566465558
PLN498 1 614421429
PLN499 2 1179310235
PLN5 4401 1036101149
PLN50 9 1125786477
PLN500 1 735408736
PLN501 1 969998116
PLN502 11 635028102
PLN503 1 595339094
PLN504 1 698605642
PLN505 1 499102108
PLN506 1 791748890
PLN507 1 797311483
PLN508 1 656817438
PLN509 1 753360318
PLN51 10 1132483282
PLN510 1 845838138
PLN511 1 619661694
PLN512 1 752772853
PLN513 1 689709469
PLN514 1 509595892
PLN515 1 712797596
PLN516 1 710493282
PLN517 1 570643040
PLN518 1 619886155
PLN519 1 705533140
PLN52 10 1166678141
PLN520 1 484551304
PLN521 1 740148362
PLN522 1 757233630
PLN523 1 642499559
PLN524 1 594006513
PLN525 1 693261537
PLN526 1 492948387
PLN527 1 781462734
PLN528 1 802944975
PLN529 1 650275864
PLN53 10 1167983468
PLN530 1 756841830
PLN531 1 850623622
PLN532 1 614136911
PLN533 1 723255126
PLN534 2 1177410070
PLN535 1 712168462
PLN536 1 712339524
PLN537 1 564869106
PLN538 1 619418949
PLN539 1 715454519
PLN54 6 1041755176
PLN540 1 478264344
PLN541 1 734693445
PLN542 1 749685439
PLN543 1 633598967
PLN544 1 782818162
PLN545 1 1022071454
PLN546 1 971920087
PLN547 1 827198496
PLN548 1 867619200
PLN549 1 806566123
PLN55 6 1019781615
PLN550 1 1015700474
PLN551 1 742303966
PLN552 1 956173857
PLN553 1 916702776
PLN554 1 874517040
PLN555 1 816294110
PLN556 1 750216944
PLN557 196 1003376355
PLN558 2 1182091663
PLN559 1 621516506
PLN56 127 1089315331
PLN560 1 610333535
PLN561 2 1150013201
PLN562 120 946417647
PLN563 5 1140594043
PLN564 773 1136041142
PLN565 18 958385885
PLN566 3 1008669690
PLN567 27314 1072986454
PLN568 2028 954547119
PLN569 1 594102056
PLN57 226 1167288149
PLN570 1 689851870
PLN571 1 495453186
PLN572 1 780798557
PLN573 1 801256715
PLN574 1 651852609
PLN575 1 750843639
PLN576 1 830829764
PLN577 1 615552423
PLN578 1 744588157
PLN579 1 673617499
PLN58 24 1016258271
PLN580 1 509857067
PLN581 1 709773743
PLN582 1 713149757
PLN583 1 566080677
PLN584 1 618079260
PLN585 1 720988478
PLN586 1 473592718
PLN587 1 736706236
PLN588 1 750620385
PLN589 2578 1146365542
PLN59 4 1037436174
PLN590 19719 1013320098
PLN591 1 585266722
PLN592 1 681112512
PLN593 1 775448786
PLN594 1 790338525
PLN595 1 746673839
PLN596 1 836514780
PLN597 1 736872137
PLN598 1 676292951
PLN599 1 669155517
PLN6 84 1095629617
PLN60 47 1162999683
PLN600 1 701372996
PLN601 1 615672275
PLN602 1 698614761
PLN603 1 728031845
PLN604 134546 917931176
PLN605 273409 596364068
PLN606 305512 565789263
PLN607 244195 638988463
PLN608 208904 670827594
PLN609 168027 730241839
PLN61 266 1013815657
PLN610 174631 723980992
PLN611 153389 756383086
PLN612 173847 723745445
PLN613 163257 742124302
PLN614 123455 800367044
PLN615 194385 718502935
PLN616 170309 729764949
PLN617 72280 948966038
PLN618 2 567273866
PLN619 1 678170541
PLN62 36 1138919263
PLN620 1 639558213
PLN621 1 629672760
PLN622 2 1174163216
PLN623 2 1166970321
PLN624 1 684376481
PLN625 1 642597466
PLN626 1 631979072
PLN627 1 607115911
PLN628 1 582960187
PLN629 1 640026769
PLN63 8 1102481801
PLN630 1 608979116
PLN631 1 720972993
PLN632 1 501257520
PLN633 1 804602427
PLN634 1 808121247
PLN635 1 649118519
PLN636 1 758906661
PLN637 1 861141126
PLN638 1 642382296
PLN639 1 759893476
PLN64 4 1072033847
PLN640 1 689766370
PLN641 1 531462149
PLN642 1 714517032
PLN643 1 717288350
PLN644 1 586345039
PLN645 1 626266972
PLN646 1 738085275
PLN647 1 505809789
PLN648 1 759124079
PLN649 1 751612808
PLN65 4 968911036
PLN650 12 1160338339
PLN651 685 1037884752
PLN652 2 1145861525
PLN653 2 1112884977
PLN654 2 941790226
PLN655 2 872653306
PLN656 2 944711370
PLN657 2 896921305
PLN658 2 995026189
PLN659 2 869378871
PLN66 23 1166540265
PLN660 2 922541915
PLN661 2 917029648
PLN662 2 1113527553
PLN663 1 667652801
PLN664 2 1153333809
PLN665 2 976557482
PLN666 2 971318115
PLN667 2 905021021
PLN668 2 779060037
PLN669 2 1026993414
PLN67 259 1173013079
PLN670 2 1040398764
PLN671 2 906287378
PLN672 2 1107801300
PLN673 2 1085890887
PLN674 2 1048094875
PLN675 2 1011185181
PLN676 2 1092181461
PLN677 2 1026383973
PLN678 2 1018992133
PLN679 21 1150858229
PLN68 20 1010819222
PLN680 1 794474755
PLN681 1 760111594
PLN682 1 769810128
PLN683 1 715684684
PLN684 1 623890083
PLN685 1 755457679
PLN686 1 717109572
PLN687 1 817712742
PLN688 1 864624966
PLN689 1 701857263
PLN69 2 1182090258
PLN690 1 726425509
PLN691 1 738041677
PLN692 1 767912069
PLN693 2 1167186906
PLN694 2 1167934623
PLN695 2 1091547167
PLN696 3 1082389428
PLN697 4 1174948639
PLN698 3 1022191755
PLN699 320 1104176749
PLN7 175 1160007531
PLN70 2 1171115910
PLN700 142 1040534860
PLN701 403 1143989685
PLN702 25 965865578
PLN703 2 1083817966
PLN704 2 1135086767
PLN705 2 1031765593
PLN706 149 1154467731
PLN707 31 1157770692
PLN708 1045 845678948
PLN709 1 703076930
PLN71 2 1040680739
PLN710 1 495911329
PLN711 1 796169439
PLN712 1 779372321
PLN713 1 665561653
PLN714 1 757165295
PLN715 1 852704148
PLN716 1 623698249
PLN717 1 745048881
PLN718 1 677947850
PLN719 1 524289323
PLN72 46 1128549117
PLN720 1 726838826
PLN721 1 701430346
PLN722 1 584133940
PLN723 1 622677745
PLN724 1 745712656
PLN725 1 490622797
PLN726 1 748850018
PLN727 1 753856519
PLN728 700 674126380
PLN729 1 593930347
PLN73 25 1176429757
PLN730 1 702775664
PLN731 1 494594617
PLN732 1 792837209
PLN733 1 812232696
PLN734 1 661835603
PLN735 1 750337041
PLN736 1 854463248
PLN737 1 623248023
PLN738 1 749950614
PLN739 1 673746810
PLN74 57 1173826657
PLN740 1 520815567
PLN741 1 712547961
PLN742 1 703299309
PLN743 1 569771178
PLN744 1 620176429
PLN745 1 717542863
PLN746 1 493761083
PLN747 1 746502734
PLN748 1 752612656
PLN749 573 686952725
PLN75 37 1116966990
PLN750 2 990024350
PLN751 2 888868060
PLN752 2 933784370
PLN753 2 956308001
PLN754 1 589118817
PLN755 1 638425132
PLN756 1 716105986
PLN757 1 613160974
PLN758 2 1177939381
PLN759 2 1016319037
PLN76 87 1169259589
PLN760 2 936303591
PLN761 2 797242864
PLN762 242 1168816031
PLN763 442 902950534
PLN764 1 593930347
PLN765 1 702775664
PLN766 1 494594617
PLN767 1 792837209
PLN768 1 812232696
PLN769 1 661835603
PLN77 49 1164459601
PLN770 1 750337041
PLN771 1 854463248
PLN772 1 623248023
PLN773 1 749950614
PLN774 1 673746810
PLN775 1 520815567
PLN776 1 712547961
PLN777 1 703299309
PLN778 1 569771178
PLN779 1 620176429
PLN78 70 1095902581
PLN780 1 717542863
PLN781 1 493761083
PLN782 1 746502734
PLN783 1 752612656
PLN784 233 1180834457
PLN785 6503 509584943
PLN786 1 657893865
PLN787 2 1156686622
PLN788 2 1150914040
PLN789 69 1177968415
PLN79 26 1161773173
PLN790 59 1176019204
PLN791 43 1178202862
PLN792 63 1150528314
PLN793 42 1160008281
PLN794 42 1159676245
PLN795 34 1160973286
PLN796 40 1141073775
PLN797 22 1158196445
PLN798 39 1163413684
PLN799 1574 1071063404
PLN8 11 1122979570
PLN80 88 1138225224
PLN800 29 1141110474
PLN801 102 1109427475
PLN802 18 1136907998
PLN803 18 1120554374
PLN804 283 1028960077
PLN805 4 1080552710
PLN806 37 1137925102
PLN807 16 1169275918
PLN808 136 1137571571
PLN809 17 1105635108
PLN81 82 1097597467
PLN810 24 1171571936
PLN811 189 1083652115
PLN812 1 709345803
PLN813 1 499575344
PLN814 1 795989443
PLN815 1 809120074
PLN816 1 670531570
PLN817 1 759055895
PLN818 1 872909281
PLN819 1 637083831
PLN82 41 1171508271
PLN820 1 765902670
PLN821 1 688536368
PLN822 1 533804092
PLN823 1 714878730
PLN824 1 728610199
PLN825 1 586077705
PLN826 1 622419581
PLN827 1 733835468
PLN828 1 506756789
PLN829 1 759450946
PLN83 16 1136277802
PLN830 1 768174826
PLN831 3 659068422
PLN832 1 865431811
PLN833 1 841368522
PLN834 1 772393794
PLN835 1 766078222
PLN836 1 735900830
PLN837 1 693266847
PLN838 1 690056233
PLN839 1 654671025
PLN84 16 1131951762
PLN840 1 681539918
PLN841 1 650134427
PLN842 1 643737533
PLN843 2 1092839925
PLN844 2 1066926645
PLN845 2 971611548
PLN846 13 427663120
PLN847 1 1574527093
PLN848 1 1805244829
PLN849 1 1716769615
PLN85 16 1128011803
PLN850 1 1637815978
PLN851 1 1645877737
PLN852 1 1365994436
PLN853 1 1520236431
PLN854 21 825294730
PLN855 1 660114068
PLN856 1 623862790
PLN857 1 606413785
PLN858 2 1155915948
PLN859 2 1148187217
PLN86 16 1134775406
PLN860 1 662966845
PLN861 1 626943711
PLN862 1 613583204
PLN863 2 1152592070
PLN864 2 1147808788
PLN865 1 656479363
PLN866 1 621609376
PLN867 1 611088072
PLN868 2 1140013277
PLN869 2 1154214120
PLN87 16 1132578817
PLN870 1 661498744
PLN871 1 626053568
PLN872 1 608346219
PLN873 2 1151823422
PLN874 2 1162621306
PLN875 1 661546608
PLN876 1 633922074
PLN877 1 612932250
PLN878 2 1146351859
PLN879 2 1158675416
PLN88 16 1142305581
PLN880 1 664715623
PLN881 1 631770265
PLN882 1 613234972
PLN883 1 604325310
PLN884 1 582152544
PLN885 2 1158575799
PLN886 1 661621317
PLN887 1 626868012
PLN888 1 607094319
PLN889 2 1149874108
PLN89 16 1149281142
PLN890 2 1149787837
PLN891 1 656602423
PLN892 1 622110859
PLN893 1 612883152
PLN894 2 1142529769
PLN895 2 1154234909
PLN896 1 656789389
PLN897 1 625372561
PLN898 1 603451504
PLN899 2 1159731212
PLN9 4 948160392
PLN90 16 1160778218
PLN900 2 1150269419
PLN901 1 657552530
PLN902 1 618447767
PLN903 1 613586716
PLN904 2 1143934454
PLN905 2 1152640102
PLN906 1 676241010
PLN907 1 632313166
PLN908 1 603807353
PLN909 2 1155326502
PLN91 69 1087966874
PLN910 2 1150412865
PLN911 1 662000247
PLN912 1 633487160
PLN913 1 612164168
PLN914 2 1159122729
PLN915 2 1150238410
PLN916 1 660449817
PLN917 1 627269420
PLN918 1 602651360
PLN919 2 1162506895
PLN92 1 646201372
PLN920 2 1158496591
PLN921 1 664401522
PLN922 1 626503588
PLN923 1 611188438
PLN924 2 1171231026
PLN925 2 1156345588
PLN926 1 657436430
PLN927 1 621715108
PLN928 1 610707416
PLN929 2 1147845639
PLN93 1 587623253
PLN930 2 1151723189
PLN931 1 660500976
PLN932 1 634743673
PLN933 1 616002081
PLN934 2 1150169128
PLN935 2 1153490048
PLN936 1 669356984
PLN937 1 631173187
PLN938 1 607766370
PLN939 2 1145806163
PLN94 1 663525381
PLN940 2 1143277701
PLN941 1 664077638
PLN942 1 624178744
PLN943 1 609451706
PLN944 2 1144639091
PLN945 1 631526965
PLN946 1 660034972
PLN947 1 625104971
PLN948 1 608830648
PLN949 2 1146797356
PLN95 2 1170194602
PLN950 2 1146984767
PLN951 1 526310788
PLN952 1 664689228
PLN953 1 632403820
PLN954 1 613638454
PLN955 2 1172960765
PLN956 2 1147017396
PLN957 1 660476038
PLN958 1 624334204
PLN959 1 613769411
PLN96 52 1140868282
PLN960 2 1147499918
PLN961 2 1148490360
PLN962 1 663019822
PLN963 1 626669531
PLN964 1 612901747
PLN965 2 1150057662
PLN966 2 1157797487
PLN967 1 667210568
PLN968 1 635382001
PLN969 1 614569426
PLN97 53 1137938586
PLN970 2 1169192410
PLN971 2 1163716432
PLN972 1 626973123
PLN973 1 611284754
PLN974 2 1150481064
PLN975 1 659290088
PLN976 2 1150737255
PLN977 1 660553991
PLN978 1 632999331
PLN979 1 616334843
PLN98 23 1161219862
PLN980 2 1174596045
PLN981 2 1159220941
PLN982 1 659217363
PLN983 1 627225202
PLN984 1 611858135
PLN985 2 1164391514
PLN986 2 1152376894
PLN987 1 660591081
PLN988 1 627080904
PLN989 1 609113147
PLN99 49 1182120568
PLN990 2 1138662036
PLN991 2 1154130688
PLN992 1 659787933
PLN993 1 626680366
PLN994 1 612118009
PLN995 2 1146809099
PLN996 2 1153763781
PLN997 1 662624081
PLN998 1 626502968
PLN999 1 614857888
PRI1 51161 1002824769
PRI10 13 1100500214
PRI100 15 1181012644
PRI101 13 1040825256
PRI102 9 1070180120
PRI103 120 1141288485
PRI104 12 1138941381
PRI105 21 1179091292
PRI106 13 1107729811
PRI107 11 1140716802
PRI108 175 1113439382
PRI109 17 1146053835
PRI11 7 1032781085
PRI110 16 1112303007
PRI111 89 1149798270
PRI112 14 1095631751
PRI113 14 1109144986
PRI114 287 1130768822
PRI115 9 1109550286
PRI116 50 1056773376
PRI117 11 1058599569
PRI118 12 1147175924
PRI119 129 1045453423
PRI12 5 1067810412
PRI120 14 1045565768
PRI121 15 1112017113
PRI122 78 1007102649
PRI123 11 1122198877
PRI124 16 1180382249
PRI125 113 1148762732
PRI126 13 1108403327
PRI127 26 1141760953
PRI128 13 1092694835
PRI129 14 1140995957
PRI13 9 1180671468
PRI130 319 1020829798
PRI131 18 1131592109
PRI132 10 1101606557
PRI133 28 1007822526
PRI134 12 1135296282
PRI135 14 1158573682
PRI136 31 1042760633
PRI137 21 1149879308
PRI138 73 1157793061
PRI139 17 1073496211
PRI14 8 1107000153
PRI140 19 1184147845
PRI141 367 1164747047
PRI142 11 995319435
PRI143 15 1180327720
PRI144 73 978026046
PRI145 14 980737478
PRI146 15 1167618994
PRI147 151 1130654396
PRI148 10 1178420820
PRI149 46 1165457402
PRI15 11 1174619811
PRI150 16 1138886962
PRI151 18 1150234449
PRI152 326 1139459030
PRI153 11 1105326025
PRI154 18 1061935040
PRI155 27 1084071148
PRI156 13 1132102457
PRI157 75 1176492073
PRI158 18 1128354402
PRI159 14 1172029366
PRI16 6 1064076226
PRI160 27 1121725746
PRI161 13 1014482922
PRI162 9 1081708515
PRI163 294 1181073471
PRI164 92 1144808360
PRI165 24 1059032867
PRI166 17 1095246750
PRI167 264 1160885053
PRI168 63 1069216739
PRI169 13 1061440347
PRI17 11 1177365167
PRI170 16 1154534859
PRI171 74 1130528088
PRI172 12 1052421338
PRI173 14 1157378407
PRI174 240 1142043667
PRI175 353 1092575962
PRI176 17 1151712823
PRI177 20 1150571825
PRI178 10 1077063477
PRI179 24 1106755904
PRI18 11 1103395128
PRI180 13 1064310573
PRI181 17 1123386703
PRI182 57 1172654739
PRI183 16 1165794253
PRI184 569 1102965079
PRI185 18 1182712802
PRI186 52 1095510295
PRI187 10 1118000252
PRI188 168 1146745968
PRI189 9 1110809597
PRI19 8 1081303381
PRI190 43 1017369865
PRI191 21 985643222
PRI192 320 1077277149
PRI193 99 1167993912
PRI194 15 1078999347
PRI195 178 1175521079
PRI196 16 1117724155
PRI197 9 1092641025
PRI198 133 1132456182
PRI199 11 1090965131
PRI2 7910 1072145329
PRI20 6 1136611601
PRI200 11 1136520153
PRI201 25 1109223510
PRI202 31 1170866006
PRI203 22 1089981244
PRI204 11 1160827036
PRI205 97 1174530068
PRI206 357 1132322130
PRI207 16 1149860906
PRI208 19 1108664381
PRI209 270 1167059546
PRI21 225210 749803460
PRI210 8 960754211
PRI211 17 1142089276
PRI212 113 1123613306
PRI213 11 1179737992
PRI214 10 1154243139
PRI215 117 1174221652
PRI216 13 1063356666
PRI217 296 1133458643
PRI218 14 1161335653
PRI219 11 1114428479
PRI22 177388 651434890
PRI220 247 1172005160
PRI221 11 1062830725
PRI222 163 1059056445
PRI223 9 1102388911
PRI224 8 1105952181
PRI225 25 1058189466
PRI226 11 1135739344
PRI227 10 1046394222
PRI228 53 1067234263
PRI229 10 1147368977
PRI23 110372 845213566
PRI230 363 1165083272
PRI231 12 1077163217
PRI232 11 1162634480
PRI233 23 1161865142
PRI234 12 1126515186
PRI235 12 1163211790
PRI236 476 1131507684
PRI237 10 1120271414
PRI238 15 1154374540
PRI239 317 1011640206
PRI24 160758 712037189
PRI240 14 1151842759
PRI241 30 1092825541
PRI242 16 1082447657
PRI243 14 1158135268
PRI244 899 1183467936
PRI245 19 1122161472
PRI246 20 1183066230
PRI247 75 1153125911
PRI248 20 1161072802
PRI249 504 1131568942
PRI25 79142 974538523
PRI250 19 1168418729
PRI251 17 1087040239
PRI252 148 1105519326
PRI253 14 1164645498
PRI254 21 1181530736
PRI255 346 1159179407
PRI256 19 1163796128
PRI257 160 1102067593
PRI258 11 1063084062
PRI259 19 1064156912
PRI26 739 1177886289
PRI260 450 1025005459
PRI261 22 1126793321
PRI262 17 1179466154
PRI263 42 1161140959
PRI264 24 1120832764
PRI265 11 1155993068
PRI266 99 1145156564
PRI267 9 1102724860
PRI268 91 1183427497
PRI269 19 1154211600
PRI27 1225 1108508917
PRI270 9 1150032117
PRI271 222 1123372778
PRI272 13 1053726974
PRI273 8 1166119572
PRI274 109 1106272201
PRI275 11 1061690594
PRI276 23 1053944764
PRI277 10 1100191309
PRI278 9 1178425990
PRI279 14 1100560332
PRI28 13 1137980641
PRI280 15 1031336361
PRI281 8 1152223354
PRI282 165 1012912191
PRI283 12 1101224225
PRI284 15 1115849849
PRI285 89 1114474603
PRI286 8 1151170256
PRI287 65 1143039387
PRI288 15 1118101622
PRI289 13 1069221035
PRI29 11 1089653569
PRI290 142 1054214909
PRI291 9 1166723153
PRI292 18 1140507064
PRI293 72 963212938
PRI294 14 1148339428
PRI295 39 1041061246
PRI296 11 1095067328
PRI297 11 1094431541
PRI298 142 1014774443
PRI299 11 1090793443
PRI3 7901 1132972500
PRI30 238 1117857898
PRI300 9 1038388354
PRI301 98 1061078202
PRI302 10 1168112973
PRI303 12 1103167620
PRI304 269 1089423682
PRI305 16 1067149770
PRI306 51 1096741393
PRI307 14 1148619844
PRI308 16 1171061459
PRI309 293 1173859690
PRI31 18 1144634850
PRI310 14 1170966762
PRI311 16 1134764047
PRI312 29 1144492265
PRI313 9 1063878272
PRI314 162 1148544359
PRI315 11 1121324836
PRI316 9 1024863486
PRI317 98 1123634864
PRI318 13 1142109257
PRI319 16 1091383016
PRI32 15 1177028791
PRI320 338 1054776526
PRI321 25 1156859424
PRI322 42 1172162490
PRI323 20 1139949990
PRI324 18 1148357791
PRI325 270 1160151966
PRI326 9 1145469135
PRI327 12 1101301543
PRI328 46 1110431448
PRI329 14 1071322935
PRI33 19 1157503881
PRI330 141 1127225925
PRI331 13 1143046837
PRI332 11 1056487704
PRI333 57 1108247906
PRI334 8 1128609065
PRI335 12 985516952
PRI336 55 1107201184
PRI337 13 1122919431
PRI338 14 1146457938
PRI339 87 1030817204
PRI34 12 1136831832
PRI340 15 1183981661
PRI341 274 1177269657
PRI342 14 1129282143
PRI343 11 1153362077
PRI344 18 1157111224
PRI345 13 1182441061
PRI346 107 1108532920
PRI347 15 1145180719
PRI348 44 1099215470
PRI349 15 1130554745
PRI35 197 1025575505
PRI350 11 1053316046
PRI351 259 1127981555
PRI352 129 1123965493
PRI353 7 1093000977
PRI354 14 1087046044
PRI355 28 1038723961
PRI356 15 1023867813
PRI357 118 1085779101
PRI358 10 1183494445
PRI359 16 1055723815
PRI36 12 1138019906
PRI360 43 1095487107
PRI361 12 1142362092
PRI362 10 1127530151
PRI363 242 1070861830
PRI364 9 1145381908
PRI365 13 1053727156
PRI366 48 950507027
PRI367 8 980986954
PRI368 14 1127513488
PRI369 169 1038664996
PRI37 14 1138707002
PRI370 17 1170616704
PRI371 57 1165646147
PRI372 11 1052178143
PRI373 13 1064501084
PRI374 732 1039299363
PRI375 18 1161964578
PRI376 8 1065684687
PRI377 35 1144185055
PRI378 18 1169266590
PRI379 11 1146467318
PRI38 22 1147922733
PRI380 520 1130532285
PRI381 24 1109904261
PRI382 241 1128821518
PRI383 22 1172993976
PRI384 42 1169489004
PRI385 374 1179142470
PRI386 25 1171283457
PRI387 95 1182694674
PRI388 387 1051668593
PRI389 28 1178144342
PRI39 47 1183977449
PRI390 297 1061561299
PRI391 14 1085218529
PRI392 29 1176194437
PRI393 262 1134778600
PRI394 28 1172380884
PRI395 164 1172827096
PRI396 50 1178545833
PRI397 106 1170115500
PRI398 409 1135976160
PRI399 39 1170267735
PRI4 10360 1160614863
PRI40 188 1133631545
PRI400 88 1183543404
PRI401 419 1138396166
PRI402 20 1104618136
PRI403 290 1160228177
PRI404 20 1140254199
PRI405 29 1146876900
PRI406 593 1183236336
PRI407 83 1175880761
PRI408 194 1183366334
PRI409 267 1103620965
PRI41 14 1142991141
PRI410 88 1171815606
PRI411 645 1154675985
PRI412 31 1154431127
PRI413 76 1178147875
PRI414 423 1122531646
PRI415 29 1172448949
PRI416 355 1141845987
PRI417 14 1144954889
PRI418 27 1179386709
PRI419 259 1105338696
PRI42 40 1160458361
PRI420 19 1133950218
PRI421 54 1180118078
PRI422 529 1166706593
PRI423 31 1175912639
PRI424 240 1145065826
PRI425 21 1180894405
PRI426 47 1179227752
PRI427 324 1182866248
PRI428 241 1177607280
PRI429 58 1182337510
PRI43 20 1057613772
PRI430 402 1152830512
PRI431 44 1151634948
PRI432 37 1143620230
PRI433 16 1088880759
PRI434 29 1172575319
PRI435 319 1128405637
PRI436 19 1122111145
PRI437 237 1167529979
PRI438 22 1166218701
PRI439 35 1180090100
PRI44 200 1140863931
PRI440 338 1164714195
PRI441 21 1180589910
PRI442 335 1183831259
PRI443 217 1147408674
PRI444 30 1144456804
PRI445 449 1137912908
PRI446 25 1152222839
PRI447 67 1184077943
PRI448 97 1122866973
PRI449 18 1175183648
PRI45 11 1151193512
PRI450 270 1078319496
PRI451 18 1176136734
PRI452 34 1128529128
PRI453 336 1179599436
PRI454 26 1152198720
PRI455 100 1184022181
PRI456 223 1167431580
PRI457 19 1091959869
PRI458 192 1176329468
PRI459 316 1169332729
PRI46 14 1181280751
PRI460 49 1174191359
PRI461 151 1119576440
PRI462 34 1160083819
PRI463 240 1164766365
PRI464 22 1171522146
PRI465 37 1182812516
PRI466 423 1169577328
PRI467 50 1148816672
PRI468 557 1183750783
PRI469 307 1160761335
PRI47 54 1173482317
PRI470 43 1176325681
PRI471 489 1174210476
PRI472 23 1177973310
PRI473 63 1183861711
PRI474 160 1099347348
PRI475 22 1182587292
PRI476 380 1110685127
PRI477 21 1180196129
PRI478 35 1156225239
PRI479 577 1175380290
PRI48 607 1183152867
PRI480 29 1147606532
PRI481 333 1160165881
PRI482 21 1173091154
PRI483 22 1156431823
PRI484 276 1083400079
PRI485 14 1026150293
PRI486 28 1183275310
PRI487 386 1111964003
PRI488 17 1125549417
PRI489 128 1135628917
PRI49 31 1167460459
PRI490 14 1091125214
PRI491 30 1156269024
PRI492 307 1161203999
PRI493 20 1139087515
PRI494 47 1182040418
PRI495 602 1164413197
PRI496 41 1167807540
PRI497 331 1148540042
PRI498 27 1155946803
PRI499 33 1173630125
PRI5 152425 840442381
PRI50 15 968255797
PRI500 402 1162958913
PRI501 25 1151582193
PRI502 86 1179818100
PRI503 369 1148376489
PRI504 23 1135238555
PRI505 226 1114879275
PRI506 24 1155260752
PRI507 36 1182993398
PRI508 289 1164436387
PRI509 30 1162980653
PRI51 141 1113642329
PRI510 222 1093874982
PRI511 17 1122547959
PRI512 29 1169235295
PRI513 387 1167088006
PRI514 18 1167884431
PRI515 62 1182749845
PRI516 246 1170557969
PRI517 38 1179859497
PRI518 335 1129497602
PRI519 21 1148579718
PRI52 11 1083973634
PRI520 60 1172507724
PRI521 249 1129111945
PRI522 27 1148917466
PRI523 440 1117703618
PRI524 23 1069132309
PRI525 43 1158135491
PRI526 348 1178821458
PRI527 31 1134311829
PRI528 161 1183805148
PRI529 301 1175334531
PRI53 16 954414851
PRI530 45 1172026447
PRI531 895 1147028264
PRI532 21 1184058029
PRI533 52 1169336829
PRI534 442 1147978791
PRI535 22 1144344431
PRI536 86 1180086042
PRI537 440 1162607155
PRI538 68 1173607909
PRI539 163 1182127574
PRI54 39 1178434910
PRI540 321 1166963360
PRI541 53 1177585670
PRI542 26 1148998822
PRI543 25 1148988166
PRI544 530 1173372077
PRI545 18 1137883702
PRI546 42 1170954641
PRI547 370 1137716293
PRI548 26 1108303806
PRI549 78 1180760906
PRI55 9 1103067380
PRI550 546 1139436696
PRI551 36 1151138005
PRI552 428 1153216606
PRI553 27 1149572242
PRI554 61 1181303924
PRI555 347 1134301180
PRI556 44 1172407846
PRI557 668 1146926824
PRI558 24 1164039393
PRI559 35 1152698423
PRI56 13 1114260520
PRI560 225 1050138502
PRI561 17 1116953631
PRI562 47 1161829558
PRI563 263 1131175559
PRI564 17 1167045095
PRI565 130 1170440659
PRI566 23 1170751301
PRI567 45 1168756544
PRI568 336 1077579028
PRI569 31 1171579240
PRI57 202 1058075412
PRI570 46 1165866303
PRI571 185 1169751544
PRI572 36 1160535067
PRI573 67 1085475194
PRI574 16 1175457768
PRI575 21 1175531784
PRI576 150 1179225597
PRI577 29 1173723084
PRI578 189 1134761868
PRI579 16 1139339206
PRI58 12 1137771012
PRI580 21 1153090874
PRI581 220 1149289905
PRI582 15 1183230533
PRI583 51 1183409088
PRI584 199 1182752069
PRI585 18 1045474622
PRI586 171 1059343895
PRI587 16 1172600038
PRI588 40 1158674954
PRI589 203 1164715697
PRI59 13 1168936209
PRI590 140 1142928696
PRI591 20 1131763145
PRI592 137 1148815782
PRI593 15 1100704625
PRI594 26 1127650628
PRI595 14 1150133421
PRI596 28 1166922896
PRI597 160 1129537305
PRI598 16 1117749341
PRI599 52 1176068226
PRI6 19989 1008567045
PRI60 29 1119598237
PRI600 217 1179197902
PRI601 29 1151336253
PRI602 173 1166863352
PRI603 20 1119185302
PRI604 41 1182586466
PRI605 303 1108937327
PRI606 17 1178542928
PRI607 89 1181878085
PRI608 198 1168056922
PRI609 37 1162632930
PRI61 13 1136681750
PRI610 82 1090767801
PRI611 16 1118484017
PRI612 38 1180674386
PRI613 197 1124462681
PRI614 22 1166614165
PRI615 197 1156201482
PRI616 13 1183357777
PRI617 31 1176936859
PRI618 211 1177301751
PRI619 23 1157099048
PRI62 72 1150950945
PRI620 89 1181629503
PRI621 141 1145455058
PRI622 21 1134683646
PRI623 203 1136922984
PRI624 26 1128803731
PRI625 47 1164969225
PRI626 216 1144273751
PRI627 27 1147212275
PRI628 245 1183082543
PRI629 150 1178032495
PRI63 8 1069277973
PRI630 63 1170025397
PRI631 394 1158613244
PRI632 51 1179270913
PRI633 213 1182001532
PRI634 236 1178712747
PRI635 105 1167396875
PRI636 295 1037508240
PRI637 49 1144253249
PRI638 87 1181792319
PRI639 111 1163791102
PRI64 14 1182870917
PRI640 51 1177181081
PRI641 281 1181322695
PRI642 207 1162030194
PRI643 84 1178030256
PRI644 327 1180516469
PRI645 106 1165371512
PRI646 203 1181400504
PRI647 194 1171186638
PRI648 102 1091623059
PRI649 61 1164043386
PRI65 276 1108950718
PRI650 64 1145917483
PRI651 258 1181958699
PRI652 428 1148473811
PRI653 31 1161024218
PRI654 312 1183814897
PRI655 251 1164201158
PRI656 50 1181207252
PRI657 404 1140670929
PRI658 64 1168296557
PRI659 179 1183657962
PRI66 18 1133613294
PRI660 305 1178937361
PRI661 77 1184032239
PRI662 534 1181954998
PRI663 446 1114064345
PRI664 54 1175815478
PRI665 422 1168928105
PRI666 52 1137859327
PRI667 203 1181815950
PRI668 56 1168842034
PRI669 103 1173394187
PRI67 30 1183791123
PRI670 328 1180716257
PRI671 89 1177817236
PRI672 208 1181521116
PRI673 120 1114992882
PRI674 38 1182996135
PRI675 353 1128563635
PRI676 28 1155358462
PRI677 97 1183744343
PRI678 69287 459583772
PRI68 396 1094012951
PRI69 9 1022060953
PRI7 6 1137401032
PRI70 318 1135144509
PRI71 17 1129061517
PRI72 11 1183170586
PRI73 170 1175242492
PRI74 19 1079921441
PRI75 20 1107184059
PRI76 319 1091478744
PRI77 16 1173300867
PRI78 111 1113574380
PRI79 9 1067860042
PRI8 10 1163372937
PRI80 18 1120312625
PRI81 134 1151339059
PRI82 9 1019371483
PRI83 11 1104292429
PRI84 67 1068212420
PRI85 10 1107843258
PRI86 14 1127464071
PRI87 306 1053659872
PRI88 16 1119162041
PRI89 223 1107213108
PRI9 114467 822454647
PRI90 13 1166110364
PRI91 32 1160815068
PRI92 428 1058620120
PRI93 17 1163742934
PRI94 12 1020059052
PRI95 95 1116707204
PRI96 18 1132868537
PRI97 11 1162762611
PRI98 13 1074540305
PRI99 9 1103306497
ROD1 42159 1008837853
ROD10 163 1166541022
ROD100 8 1139757719
ROD101 9 1174668373
ROD102 7 1067359328
ROD103 10 1182029473
ROD104 4 959918585
ROD105 6 1044932681
ROD106 68 1124872912
ROD107 10 1133876088
ROD108 19 1182564383
ROD109 10 1092721418
ROD11 7 1078339014
ROD110 16 1182453566
ROD111 12 1081345329
ROD112 9 1086039483
ROD113 7 934030466
ROD114 3 957465392
ROD115 29446 1078685671
ROD12 90 1160576642
ROD13 9 1118724328
ROD14 15 1161179778
ROD15 16 1135825973
ROD16 72442 1036109422
ROD17 26813 1037075404
ROD18 12 1120355466
ROD19 8 1163882538
ROD2 5909 1093927363
ROD20 12 1101462594
ROD21 7 1065740602
ROD22 110 1130872454
ROD23 10 1095487923
ROD24 8 1173337133
ROD25 8 1063713588
ROD26 9 1146396098
ROD27 10 1068290457
ROD28 8 1081733625
ROD29 11 1082140969
ROD3 6339 1107756976
ROD30 10 1147232155
ROD31 10 1171959357
ROD32 7 1110074623
ROD33 10 1164218519
ROD34 9 1108644203
ROD35 8 1072581452
ROD36 10 1046751576
ROD37 8 1141423843
ROD38 11 1027724205
ROD39 10 1152345994
ROD4 110071 874880522
ROD40 8 1082920857
ROD41 8 1089063230
ROD42 9 1143097394
ROD43 10 1072150743
ROD44 8 1099764473
ROD45 11 1087836125
ROD46 8 1171715672
ROD47 12 1136130400
ROD48 7 1113098900
ROD49 10 1162104909
ROD5 368979 428107367
ROD50 9 1083630069
ROD51 9 1170482326
ROD52 11 1099809287
ROD53 10 1145640092
ROD54 9 1132503232
ROD55 10 1140056814
ROD56 19 1075143845
ROD57 10 1147351773
ROD58 19 1151436343
ROD59 10 1088581837
ROD6 6 1107651413
ROD60 16 1164391722
ROD61 16 1073033435
ROD62 9 1157194591
ROD63 14 1023016171
ROD64 7 1166266691
ROD65 9 1087901740
ROD66 9 1097713367
ROD67 9 1154691504
ROD68 9 1025612394
ROD69 7 1082392531
ROD7 9 1154552993
ROD70 10 1140331137
ROD71 9 1166871002
ROD72 14 1168528777
ROD73 8 1126440038
ROD74 12 1149086196
ROD75 10 1051885153
ROD76 12 1161926762
ROD77 11 1086828534
ROD78 10 1148564844
ROD79 12 1022809212
ROD8 10 1090080857
ROD80 8 1104739191
ROD81 14 1038854127
ROD82 7 1113949024
ROD83 14 1147316566
ROD84 9 1098255843
ROD85 13 1183189045
ROD86 11 1140514852
ROD87 14 1175080086
ROD88 13 1051083644
ROD89 9 1156825032
ROD9 7 1101532017
ROD90 52 1118266047
ROD91 12 1173398982
ROD92 18 1154143271
ROD93 11 1123323681
ROD94 18 1080123782
ROD95 11 1146173548
ROD96 148 1098231299
ROD97 7 1166537123
ROD98 12 1154027383
ROD99 11 1029292292
STS1 422715 213740430
STS2 348965 243835819
STS3 575308 183346888
SYN1 54450 995654191
SYN2 10 1040305979
SYN3 6 1076407027
SYN4 9 1128400530
SYN5 10 1040305979
SYN6 6 1076407027
SYN7 333 913831861
SYN8 81628 894262538
SYN9 179515 678853231
TSA1 675528 274465015
TSA10 491192 443611767
TSA11 464181 476087645
TSA12 540291 380872693
TSA13 535748 387202332
TSA14 552160 395860719
TSA15 499112 393973649
TSA16 462266 345145472
TSA17 529507 428880230
TSA18 455421 496345807
TSA19 550542 444773023
TSA2 551981 321350516
TSA20 478162 355239068
TSA21 423856 348553053
TSA22 491562 422573299
TSA23 490034 425487114
TSA24 503013 447608420
TSA25 551548 412916060
TSA26 320152 599341413
TSA27 321648 516780882
TSA28 213058 240570297
TSA29 247905 86002956
TSA3 516598 398806258
TSA30 255131 65202908
TSA31 493149 400383134
TSA32 391059 545767960
TSA33 368396 574961292
TSA34 423098 474002342
TSA35 420477 476157201
TSA36 451326 415382230
TSA37 55893 33058475
TSA4 505646 416286608
TSA5 500719 360224396
TSA6 584826 316637773
TSA7 573575 366126568
TSA8 593046 269968508
TSA9 537002 422963238
UNA1 775 4564014
VRL1 351163 457346981
VRL10 184924 672611559
VRL100 35644 649464429
VRL101 23467 657877726
VRL102 25978 663706084
VRL103 24531 665021777
VRL104 23045 658870855
VRL105 22523 663482052
VRL106 22600 662506209
VRL107 22625 663126370
VRL108 22765 662548048
VRL109 25115 658265548
VRL11 234058 544215304
VRL110 22654 663566554
VRL111 22842 661579770
VRL112 25318 662414470
VRL113 23954 663400383
VRL114 23979 663284298
VRL115 24146 662178055
VRL116 25265 663622603
VRL117 24700 668469574
VRL118 24377 666170905
VRL119 24293 667090788
VRL12 236058 536821756
VRL120 24242 666307455
VRL121 23867 666335412
VRL122 23832 665636760
VRL123 22975 669128685
VRL124 24438 664793838
VRL125 23290 664314226
VRL126 27343 660213601
VRL127 24713 664774627
VRL128 23328 663753417
VRL129 24206 660256621
VRL13 164380 570533841
VRL130 25483 660396314
VRL131 24284 666786490
VRL132 23440 663978651
VRL133 23857 667632281
VRL134 26576 664738428
VRL135 23426 662937886
VRL136 24463 664889764
VRL137 25859 660480740
VRL138 25814 667687611
VRL139 26244 669656258
VRL14 71526 649975294
VRL140 26103 664750248
VRL141 23653 664105854
VRL142 26765 662537097
VRL143 25165 661566724
VRL144 30274 655088373
VRL145 23936 665147071
VRL146 24898 661591462
VRL147 25495 664190528
VRL148 23106 665607228
VRL149 30231 665267826
VRL15 70948 637475719
VRL150 23598 662903286
VRL151 24032 665370785
VRL152 23335 673003337
VRL153 24481 666080503
VRL154 25005 667966041
VRL155 23183 672462685
VRL156 23014 672490613
VRL157 30613 658356410
VRL158 30294 660984421
VRL159 26082 666494670
VRL16 43898 655971130
VRL160 31811 659569069
VRL161 25500 668868181
VRL162 28314 663033097
VRL163 29166 661808556
VRL164 25452 659113880
VRL165 24201 666353716
VRL166 28023 663117141
VRL167 33245 654253184
VRL168 31672 656987125
VRL169 27331 663982349
VRL17 28017 665072173
VRL170 24412 671404681
VRL171 24703 683833295
VRL172 25719 670125507
VRL173 26768 662665274
VRL174 36508 654620575
VRL175 32554 670131167
VRL176 40567 658779847
VRL177 25908 667259685
VRL178 43253 659801522
VRL179 39247 661060860
VRL18 28515 663857971
VRL180 33875 666287421
VRL181 30138 670946557
VRL182 24609 665585845
VRL183 33170 664341462
VRL184 34523 665769932
VRL185 33291 661616650
VRL186 44370 657386933
VRL187 35021 665532274
VRL188 28037 666423398
VRL189 35492 978798194
VRL19 32671 659452304
VRL190 37496 1119656729
VRL191 37923 1130901802
VRL192 38040 1133843948
VRL193 37523 1119932674
VRL194 37496 1119149144
VRL195 37277 1113506534
VRL196 37149 1110012774
VRL197 37053 1109906128
VRL198 37273 1112562481
VRL199 36738 1097911112
VRL2 133016 576069916
VRL20 27200 660013873
VRL200 37068 1107525129
VRL201 36932 1102584974
VRL202 37111 1107956022
VRL203 37272 1113127768
VRL204 37014 1105781088
VRL205 37161 1110249883
VRL206 36976 1105058231
VRL207 37061 1107627844
VRL208 37039 1106892121
VRL209 36595 1093726573
VRL21 35885 653865825
VRL210 36670 1095891129
VRL211 36952 1104061053
VRL212 36970 1104582761
VRL213 37503 1119163441
VRL214 37059 1106874927
VRL215 37128 1109105553
VRL216 37082 1107169017
VRL217 37199 1111341641
VRL218 37093 1108443340
VRL219 37044 1106545638
VRL22 23938 660978838
VRL220 37584 1121105389
VRL221 37307 1114144127
VRL222 36924 1103092257
VRL223 37272 1112590106
VRL224 37292 1113124849
VRL225 37267 1112394036
VRL226 37039 1106461412
VRL227 37077 1107444282
VRL228 37303 1113460703
VRL229 36822 1100149091
VRL23 24223 663195059
VRL230 36879 1101621387
VRL231 37069 1106541221
VRL232 37261 1111715470
VRL233 36994 1104936237
VRL234 36954 1103854243
VRL235 37018 1105741589
VRL236 37119 1108863424
VRL237 37503 1115688518
VRL238 37304 1114471937
VRL239 37149 1109654670
VRL24 30484 658271040
VRL240 37020 1105636095
VRL241 37101 1107942004
VRL242 37118 1108392087
VRL243 36642 1094361532
VRL244 36967 1103739088
VRL245 37098 1107534255
VRL246 37085 1107073700
VRL247 37183 1110129527
VRL248 37088 1107071539
VRL249 37621 1121207836
VRL25 23751 662188677
VRL250 37411 1117373191
VRL251 37395 1116908974
VRL252 37227 1111782348
VRL253 36419 1087090592
VRL254 36345 1084791108
VRL255 37329 1110148929
VRL256 37909 1128944819
VRL257 37639 1122647871
VRL258 37956 1128635316
VRL259 37745 1124074772
VRL26 23993 666060116
VRL260 37858 1126763515
VRL261 37896 1129006744
VRL262 37452 1116081628
VRL263 37877 1128105873
VRL264 37544 1121021583
VRL265 37595 1124692874
VRL266 36350 1085273481
VRL267 37743 1122383100
VRL268 37531 1120899857
VRL269 37608 1123440105
VRL27 23484 664870451
VRL270 37453 1118408802
VRL271 37226 1111831054
VRL272 37313 1116010490
VRL273 36911 1105786735
VRL274 37944 1100358165
VRL275 37602 1093562417
VRL276 36008 1075590019
VRL277 35953 1074175384
VRL278 36476 1090145093
VRL279 36179 1081321085
VRL28 24749 664274634
VRL280 36378 1086217761
VRL281 36298 1084385050
VRL282 36487 1089465697
VRL283 36484 1089220209
VRL284 36488 1089372547
VRL285 36486 1089338529
VRL286 36481 1089220424
VRL287 36592 1092059667
VRL288 36706 1094842466
VRL289 37105 1105437125
VRL29 26469 663572786
VRL290 36758 1096474054
VRL291 37926 1126378428
VRL292 38141 1132545419
VRL293 38137 1132526094
VRL294 38086 1131013558
VRL295 38121 1131732569
VRL296 38101 1131917304
VRL297 38126 1131976496
VRL298 38075 1087690298
VRL299 36383 1086819903
VRL3 315094 427431117
VRL30 29542 666876704
VRL300 36682 1095968100
VRL301 36604 1093480233
VRL302 36583 1092885006
VRL303 36591 1093110632
VRL304 36577 1092689105
VRL305 36560 1092204028
VRL306 36141 1080005541
VRL307 36025 1073589988
VRL308 36086 1075002863
VRL309 36102 1071451552
VRL31 30929 663264497
VRL310 37128 1098198848
VRL311 37584 1122051304
VRL312 37513 1120444335
VRL313 36041 1077014198
VRL314 35819 1070220007
VRL315 36167 1080786611
VRL316 39034 1087110310
VRL317 40346 1102010810
VRL318 38253 1095396120
VRL319 27587 785233057
VRL32 26609 665758715
VRL320 29381 672070309
VRL321 31070 667383066
VRL322 28103 669377583
VRL323 43850 656205080
VRL324 49606 647422212
VRL325 36881 665110982
VRL326 70256 628839383
VRL327 58983 650159121
VRL328 37915 658466890
VRL329 26499 671745822
VRL33 24508 665913453
VRL330 45145 662862553
VRL331 35075 661199865
VRL332 34569 664352267
VRL333 69802 231273763
VRL34 24236 664808184
VRL35 25807 664168769
VRL36 23355 658811974
VRL37 22601 665008768
VRL38 23339 661882449
VRL39 24306 660059820
VRL4 278257 596485111
VRL40 33302 992086980
VRL41 37094 1109119992
VRL42 37112 1109234873
VRL43 37136 1109746805
VRL44 29227 860084606
VRL45 23593 666740196
VRL46 24655 664251446
VRL47 22399 660067189
VRL48 22805 659252076
VRL49 23048 663961557
VRL5 324934 471829036
VRL50 23454 660166313
VRL51 22526 663955359
VRL52 22842 665064978
VRL53 22621 661342621
VRL54 23362 664843796
VRL55 23514 667731781
VRL56 22632 662348502
VRL57 22987 665729439
VRL58 22697 664820807
VRL59 22827 662360766
VRL6 283216 469078842
VRL60 24327 666850369
VRL61 23306 660002550
VRL62 24639 669829411
VRL63 24345 666430147
VRL64 22551 661622018
VRL65 24393 668682389
VRL66 22776 664050249
VRL67 23625 665473168
VRL68 25536 663205776
VRL69 22510 662578747
VRL7 252072 510639141
VRL70 23291 665231532
VRL71 23030 664226601
VRL72 22361 663217419
VRL73 23301 668005865
VRL74 23760 664018085
VRL75 23230 664664675
VRL76 23289 664594102
VRL77 24017 660503308
VRL78 24696 665178664
VRL79 22342 663260070
VRL8 261552 494594080
VRL80 23297 666948011
VRL81 23158 665317712
VRL82 22783 664305999
VRL83 23016 666212551
VRL84 23334 664609928
VRL85 22366 662346732
VRL86 22367 665476722
VRL87 22766 667406084
VRL88 22630 661875227
VRL89 22940 673366562
VRL9 250499 526801945
VRL90 22899 664074978
VRL91 22572 665122491
VRL92 23077 665245811
VRL93 22729 668121498
VRL94 22886 661772417
VRL95 28214 670013032
VRL96 23633 666799022
VRL97 22903 663209255
VRL98 25526 662817093
VRL99 22719 661581539
VRT1 151996 879100516
VRT10 24 1183125039
VRT100 37 1154265027
VRT101 113 640305917
VRT102 2 806190538
VRT103 2 696540660
VRT104 4 904864528
VRT105 44 1019397561
VRT106 36 1178642032
VRT107 61 1042460441
VRT108 153 1133976286
VRT109 20 1151700990
VRT11 27 1031473596
VRT110 1589 1155278298
VRT111 64 1040389365
VRT112 5 1114313003
VRT113 40 1121950258
VRT114 26 1165870027
VRT115 34 993803116
VRT116 10 863470745
VRT117 99 1055299498
VRT118 45 1173161375
VRT119 34 1154532236
VRT12 22 1168150288
VRT120 37 1165711270
VRT121 20 1174931749
VRT122 18 1153973849
VRT123 22 1182636590
VRT124 312 1171570949
VRT125 40 1165814453
VRT126 41 1170464824
VRT127 19 1155157253
VRT128 42 1177238185
VRT129 40 1181828030
VRT13 47 1163387179
VRT130 52 1166638748
VRT131 30 1154120422
VRT132 26 1093949723
VRT133 25 1160740832
VRT134 37 1158359519
VRT135 24 1031287813
VRT136 48 1177450183
VRT137 37 1168924425
VRT138 18 1164074289
VRT139 26 1182902339
VRT14 25 1139276204
VRT140 39 1133969144
VRT141 36 1168754407
VRT142 31 1163137436
VRT143 36 1170882423
VRT144 36 1152871582
VRT145 21 1177136033
VRT146 17 1131769706
VRT147 40 1099550703
VRT148 14 1151376722
VRT149 40 1181857143
VRT15 27 1160142853
VRT150 43 1118286302
VRT151 21 1172396618
VRT152 21 1159704045
VRT153 37 1180805679
VRT154 36 1074349268
VRT155 305 1147865056
VRT156 37 1155455580
VRT157 53 1170748576
VRT158 39 1042530955
VRT159 5 1145352964
VRT16 32 1169570528
VRT160 8 1166817677
VRT161 22 1099238862
VRT162 24 1181050320
VRT163 28 1128461858
VRT164 23 1179977145
VRT165 17 1140261904
VRT166 47 1162361489
VRT167 33 1082875689
VRT168 40 1151038532
VRT169 35 1168555234
VRT17 16539 1109591775
VRT170 21 1052433236
VRT171 5 1056736991
VRT172 8 1141521528
VRT173 13 1130579885
VRT174 20 1160195610
VRT175 50 1171449262
VRT176 36 1181564440
VRT177 159 1113225433
VRT178 22 1003732213
VRT179 42 1170859841
VRT18 298573 690422199
VRT180 43 1076296835
VRT181 41 1138566252
VRT182 14 1179788972
VRT183 13 1137303478
VRT184 17 1162516663
VRT185 15 1104770266
VRT186 16 1019314169
VRT187 23 1178565343
VRT188 37 1182347574
VRT189 50 1134087574
VRT19 140166 939601363
VRT190 24 926554202
VRT191 4 1160654489
VRT192 6 1055180276
VRT193 11 1145381641
VRT194 18 1181285424
VRT195 15 1146666012
VRT196 27 1182848304
VRT197 21 1151141727
VRT198 16 1122899890
VRT199 42 1156993143
VRT2 30 1174650673
VRT20 393201 557792495
VRT200 18 1168032833
VRT201 24 1179938402
VRT202 27 1158754540
VRT203 31 1171954388
VRT204 14 1058831880
VRT205 7 1098198485
VRT206 10 1112454070
VRT207 21 982002519
VRT208 10 1173938281
VRT209 28 1176020601
VRT21 489230 346433233
VRT210 41 1179233542
VRT211 101 1118100577
VRT212 88 1107333274
VRT213 92 1110353805
VRT214 75 1110401066
VRT215 47 1183640734
VRT216 58 1143023906
VRT217 33 701808784
VRT218 1 1377224146
VRT219 1 1246042375
VRT22 529054 350155128
VRT220 1 1134302525
VRT221 1 1092803421
VRT222 1 995116563
VRT223 1 979649957
VRT224 3 1100551194
VRT225 3 511216884
VRT226 1 1415942608
VRT227 1 1279781030
VRT228 1 1144564707
VRT229 1 1114117749
VRT23 351465 571626733
VRT230 1 1027171557
VRT231 1 998592877
VRT232 3 1103810273
VRT233 4 510174135
VRT234 1 1950672471
VRT235 1 1882935974
VRT236 1 1702342136
VRT237 1 1361375652
VRT238 1 1317398316
VRT239 1 1293891082
VRT24 60780 1110009698
VRT240 1 1269970046
VRT241 1 1248769876
VRT242 1 1238911699
VRT243 1 1201415365
VRT244 1 1199165587
VRT245 1 1184551933
VRT246 1 1183987023
VRT247 1 1134708421
VRT248 1 1024245046
VRT249 1 993383533
VRT25 269221 908898057
VRT250 3 1080922639
VRT251 39 1080538033
VRT252 42 1162049517
VRT253 43 1144321272
VRT254 19 1033892758
VRT255 8 1159899222
VRT256 12 1157225835
VRT257 19 1098867675
VRT258 15 1097791464
VRT259 18 1112130599
VRT26 13721 1154567745
VRT260 34 1182680941
VRT261 17 1164381965
VRT262 34 1077194331
VRT263 34 1012246650
VRT264 33 1009704254
VRT265 8 201061856
VRT266 1 2146314909
VRT267 1 459926735
VRT268 1 2140055507
VRT269 1 526359502
VRT27 47 1182953113
VRT270 1 2132484007
VRT271 1 510744347
VRT272 1 2141402031
VRT273 1 154081089
VRT274 1 2143815925
VRT275 1 17068361
VRT276 1 2139332349
VRT277 1 1965638399
VRT278 1 1730884321
VRT279 1 1292683186
VRT28 42 1176638933
VRT280 1 1220333517
VRT281 1 1209226565
VRT282 7 1134997840
VRT283 26 1123273225
VRT284 25 1160795076
VRT285 6 147321427
VRT286 1 2144885605
VRT287 1 368539449
VRT288 1 2136077662
VRT289 1 338547956
VRT29 267 1168597478
VRT290 1 2137795666
VRT291 1 330263317
VRT292 1 2145962954
VRT293 1 25971532
VRT294 1 2035433746
VRT295 1 1925992481
VRT296 1 1778043439
VRT297 1 1581089616
VRT298 1 1245844088
VRT299 1 1157923350
VRT3 123 1174179528
VRT30 17 1056807004
VRT300 1 1112128736
VRT301 2 1122751352
VRT302 11 1154196115
VRT303 44 1172047204
VRT304 24 1172348617
VRT305 17 1176756037
VRT306 32 1112452156
VRT307 33 1117361619
VRT308 7 1120783487
VRT309 41 1174844090
VRT31 4 1123547344
VRT310 42 1145319211
VRT311 50 1118086011
VRT312 46 858628186
VRT313 5 1183989260
VRT314 39 1181983406
VRT315 16 1169772349
VRT316 33 1168068530
VRT317 62450 455423914
VRT32 6 1096697320
VRT33 20 1158617966
VRT34 42 1176628400
VRT35 39 827624945
VRT36 1 839681426
VRT37 1 825560060
VRT38 2 1082779519
VRT39 3 1072075408
VRT4 106340 999210135
VRT40 8 1112968075
VRT41 21 1180520471
VRT42 22 1158850226
VRT43 353 1181688611
VRT44 28 1098865212
VRT45 1 662004353
VRT46 2 911653698
VRT47 3 1021932445
VRT48 490 1179856557
VRT49 30 1161799788
VRT5 72668 919264025
VRT50 24 1180126066
VRT51 24 1139184549
VRT52 40 1180636041
VRT53 73 1164818053
VRT54 7 1156606571
VRT55 3 1012738546
VRT56 6 1130561284
VRT57 468 1183012903
VRT58 10 1163204068
VRT59 618 1178963146
VRT6 38 1174624699
VRT60 13 971142702
VRT61 5 1115794738
VRT62 6 1049980901
VRT63 34 1152243713
VRT64 20 1141871979
VRT65 38 1132348904
VRT66 226 1180434283
VRT67 21 1114739427
VRT68 21 1172326162
VRT69 53 1183886833
VRT7 42 1157042340
VRT70 20 1122316722
VRT71 17 1136974292
VRT72 22 1140340918
VRT73 23 1161212858
VRT74 23 1154719176
VRT75 119 1154956026
VRT76 90 1170752658
VRT77 16 447555359
VRT78 1 843366180
VRT79 1 842558404
VRT8 52 1150524292
VRT80 1 707956555
VRT81 1 635713434
VRT82 2 1006930617
VRT83 6 953838719
VRT84 1 690654357
VRT85 2 1036857559
VRT86 3 1135937014
VRT87 37 1176417013
VRT88 4329 1156513083
VRT89 264920 688883100
VRT9 24 1174750678
VRT90 397202 413444402
VRT91 235838 658431382
VRT92 74 1171078851
VRT93 46 1177526580
VRT94 23 1135464976
VRT95 428 1148384437
VRT96 18 1172319565
VRT97 64 1174757191
VRT98 36 1160960135
VRT99 30 1178103092
2.2.7 Selected Per-Organism Statistics
The following table provides the number of entries and bases of DNA/RNA for
the twenty most sequenced organisms in Release 264.0, excluding chloroplast and
mitochondrial sequences, metagenomic sequences, Whole Genome Shotgun sequences,
'constructed' CON-division sequences, synthetic construct sequences, uncultured
sequences, Transcriptome Shotgun Assembly sequences, and Targeted Locus Study
sequences:
Entries Bases Species
28009503 773933605694 Homo sapiens
1945466 296898020056 Triticum aestivum
9010325 268021106922 Severe acute respiratory syndrome coronavirus 2
113558 246951178671 Hordeum vulgare
753 212675690135 Hordeum bulbosum
1347604 126088504181 Hordeum vulgare subsp. vulgare
164 93011095388 Viscum album
29876 92980158773 Hordeum vulgare subsp. spontaneum
10099299 46318374347 Mus musculus
183077 31481051337 Escherichia coli
504 22852581183 Lissotriton helveticus
1627 22052873125 Triturus cristatus
1343 21278745710 Lissotriton vulgaris
29814 21128007178 Avena sativa
37884 21022050191 Klebsiella pneumoniae
1547 20633298192 Chenopodium quinoa
2641080 20529832955 Arabidopsis thaliana
553560 20141516169 Capra hircus
768 17031737000 Bombina variegata
2244724 16211175315 Bos taurus
2.2.8 Growth of GenBank
The following table lists the number of bases and the number of sequence
records in each release of GenBank, beginning with Release 3 in 1982.
CON-division records are not represented in these statistics: because they
are constructed from the non-CON records in the database, their inclusion
here would be a form of double-counting. Also note that this table is limited
to 'traditional', non-set-based (WGS/TSA/TLS) GenBank records.
From 1982 to the present, the number of bases in GenBank has doubled
approximately every 18 months.
Release Date Base Pairs Entries
3 Dec 1982 680338 606
14 Nov 1983 2274029 2427
20 May 1984 3002088 3665
24 Sep 1984 3323270 4135
25 Oct 1984 3368765 4175
26 Nov 1984 3689752 4393
32 May 1985 4211931 4954
36 Sep 1985 5204420 5700
40 Feb 1986 5925429 6642
42 May 1986 6765476 7416
44 Aug 1986 8442357 8823
46 Nov 1986 9615371 9978
48 Feb 1987 10961380 10913
50 May 1987 13048473 12534
52 Aug 1987 14855145 14020
53 Sep 1987 15514776 14584
54 Dec 1987 16752872 15465
55 Mar 1988 19156002 17047
56 Jun 1988 20795279 18226
57 Sep 1988 22019698 19044
57.1 Oct 1988 23800000 20579
58 Dec 1988 24690876 21248
59 Mar 1989 26382491 22479
60 Jun 1989 31808784 26317
61 Sep 1989 34762585 28791
62 Dec 1989 37183950 31229
63 Mar 1990 40127752 33377
64 Jun 1990 42495893 35100
65 Sep 1990 49179285 39533
66 Dec 1990 51306092 41057
67 Mar 1991 55169276 43903
68 Jun 1991 65868799 51418
69 Sep 1991 71947426 55627
70 Dec 1991 77337678 58952
71 Mar 1992 83894652 65100
72 Jun 1992 92160761 71280
73 Sep 1992 101008486 78608
74 Dec 1992 120242234 97084
75 Feb 1993 126212259 106684
76 Apr 1993 129968355 111911
77 Jun 1993 138904393 120134
78 Aug 1993 147215633 131328
79 Oct 1993 157152442 143492
80 Dec 1993 163802597 150744
81 Feb 1994 173261500 162946
82 Apr 1994 180589455 169896
83 Jun 1994 191393939 182753
84 Aug 1994 201815802 196703
85 Oct 1994 217102462 215273
86 Dec 1994 230485928 237775
87 Feb 1995 248499214 269478
88 Apr 1995 286094556 352414
89 Jun 1995 318624568 425211
90 Aug 1995 353713490 492483
91 Oct 1995 384939485 555694
92 Dec 1995 425860958 620765
93 Feb 1996 463758833 685693
94 Apr 1996 499127741 744295
95 Jun 1996 551750920 835487
96 Aug 1996 602072354 920588
97 Oct 1996 651972984 1021211
98 Dec 1996 730552938 1114581
99 Feb 1997 786898138 1192505
100 Apr 1997 842864309 1274747
101 Jun 1997 966993087 1491069
102 Aug 1997 1053474516 1610848
103 Oct 1997 1160300687 1765847
104 Dec 1997 1258290513 1891953
105 Feb 1998 1372368913 2042325
106 Apr 1998 1502542306 2209232
107 Jun 1998 1622041465 2355928
108 Aug 1998 1797137713 2532359
109 Oct 1998 2008761784 2837897
110 Dec 1998 2162067871 3043729
111 Apr 1999 2569578208 3525418
112 Jun 1999 2974791993 4028171
113 Aug 1999 3400237391 4610118
114 Oct 1999 3841163011 4864570
115 Dec 1999 4653932745 5354511
116 Feb 2000 5805414935 5691170
117 Apr 2000 7376080723 6215002
118 Jun 2000 8604221980 7077491
119 Aug 2000 9545724824 8214339
120 Oct 2000 10335692655 9102634
121 Dec 2000 11101066288 10106023
122 Feb 2001 11720120326 10896781
123 Apr 2001 12418544023 11545572
124 Jun 2001 12973707065 12243766
125 Aug 2001 13543364296 12813516
126 Oct 2001 14396883064 13602262
127 Dec 2001 15849921438 14976310
128 Feb 2002 17089143893 15465325
129 Apr 2002 19072679701 16769983
130 Jun 2002 20648748345 17471130
131 Aug 2002 22616937182 18197119
132 Oct 2002 26525934656 19808101
133 Dec 2002 28507990166 22318883
134 Feb 2003 29358082791 23035823
135 Apr 2003 31099264455 24027936
136 Jun 2003 32528249295 25592865
137 Aug 2003 33865022251 27213748
138 Oct 2003 35599621471 29819397
139 Dec 2003 36553368485 30968418
140 Feb 2004 37893844733 32549400
141 Apr 2004 38989342565 33676218
142 Jun 2004 40325321348 35532003
143 Aug 2004 41808045653 37343937
144 Oct 2004 43194602655 38941263
145 Dec 2004 44575745176 40604319
146 Feb 2005 46849831226 42734478
147 Apr 2005 48235738567 44202133
148 Jun 2005 49398852122 45236251
149 Aug 2005 51674486881 46947388
150 Oct 2005 53655236500 49152445
151 Dec 2005 56037734462 52016762
152 Feb 2006 59750386305 54584635
153 Apr 2006 61582143971 56620500
154 Jun 2006 63412609711 58890345
155 Aug 2006 65369091950 61132599
156 Oct 2006 66925938907 62765195
157 Dec 2006 69019290705 64893747
158 Feb 2007 71292211453 67218344
159 Apr 2007 75742041056 71802595
160 Jun 2007 77248690945 73078143
161 Aug 2007 79525559650 76146236
162 Oct 2007 81563399765 77632813
163 Dec 2007 83874179730 80388382
164 Feb 2008 85759586764 82853685
165 Apr 2008 89172350468 85500730
166 Jun 2008 92008611867 88554578
167 Aug 2008 95033791652 92748599
168 Oct 2008 97381682336 96400790
169 Dec 2008 99116431942 98868465
170 Feb 2009 101467270308 101815678
171 Apr 2009 102980268709 103335421
172 Jun 2009 105277306080 106073709
173 Aug 2009 106533156756 108431692
174 Oct 2009 108560236506 110946879
175 Dec 2009 110118557163 112910950
176 Feb 2010 112326229652 116461672
177 Apr 2010 114348888771 119112251
178 Jun 2010 115624497715 120604423
179 Aug 2010 117476523128 122941883
180 Oct 2010 118551641086 125764384
181 Dec 2010 122082812719 129902276
182 Feb 2011 124277818310 132015054
183 Apr 2011 126551501141 135440924
184 Jun 2011 129178292958 140482268
185 Aug 2011 130671233801 142284608
186 Oct 2011 132067413372 144458648
187 Dec 2011 135117731375 146413798
188 Feb 2012 137384889783 149819246
189 Apr 2012 139266481398 151824421
190 Jun 2012 141343240755 154130210
191 Aug 2012 143081765233 156424033
192 Oct 2012 145430961262 157889737
193 Dec 2012 148390863904 161140325
194 Feb 2013 150141354858 162886727
195 Apr 2013 151178979155 164136731
196 Jun 2013 152599230112 165740164
197 Aug 2013 154192921011 167295840
198 Oct 2013 155176494699 168335396
199 Dec 2013 156230531562 169331407
200 Feb 2014 157943793171 171123749
201 Apr 2014 159813411760 171744486
202 Jun 2014 161822845643 173353076
203 Aug 2014 165722980375 174108750
204 Oct 2014 181563676918 178322253
205 Dec 2014 184938063614 179295769
206 Feb 2015 187893826750 181336445
207 Apr 2015 189739230107 182188746
208 Jun 2015 193921042946 185019352
209 Aug 2015 199823644287 187066846
210 Oct 2015 202237081559 188372017
211 Dec 2015 203939111071 189232925
212 Feb 2016 207018196067 190250235
213 Apr 2016 211423912047 193739511
214 Jun 2016 213200907819 194463572
215 Aug 2016 217971437647 196120831
216 Oct 2016 220731315250 197390691
217 Dec 2016 224973060433 198565475
218 Feb 2017 228719437638 199341377
219 Apr 2017 231824951552 200877884
220 Jun 2017 234997362623 201663568
221 Aug 2017 240343378258 203180606
222 Oct 2017 244914705468 203953682
223 Dec 2017 249722163594 206293625
224 Feb 2018 253630708098 207040555
225 Apr 2018 260189141631 208452303
226 Jun 2018 263957884539 209775348
227 Aug 2018 260806936411 208831050 (Section 1.3.1 of GB 227.0 release notes explains decrease)
228 Oct 2018 279668290132 209656636
229 Dec 2018 285688542186 211281415
230 Feb 2019 303709510632 212260377
231 Apr 2019 321680566570 212775414
232 Jun 2019 329835282370 213383758
233 Aug 2019 366733917629 213865349
234 Oct 2019 386197018538 216763706
235 Dec 2019 388417258009 215333020 (Section 1.3.2 of GB 235.0 release notes explains decrease)
236 Feb 2020 399376854872 216214215
237 Apr 2020 415770027949 216531829
238 Jun 2020 427823258901 217122233
239 Aug 2020 654057069549 218642238
240 Oct 2020 698688094046 219055207
241 Dec 2020 723003822007 221467827
242 Feb 2021 776291211106 226241476
243 Apr 2021 832400799511 227123201
244 Jun 2021 866009790959 227888889
245 Aug 2021 940513260726 231982592
246 Oct 2021 1014763752113 233642893
247 Dec 2021 1053275115030 234557297
248 Feb 2022 1173984081721 236338284
249 Apr 2022 1266154890918 237520318
250 Jun 2022 1395628631187 239017893
251 Aug 2022 1492800704497 239915786
252 Oct 2022 1562963366851 240539282
253 Dec 2022 1635594138493 241015745
254 Feb 2023 1731302248418 241830635
255 Apr 2023 1826746318813 242554936
256 Jun 2023 1966479976146 243560863
257 Aug 2023 2112058517945 246119175
258 Oct 2023 2433391164875 247777761
259 Dec 2023 2570711588044 249060436
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 3213818003787 250803006
261 Jun 2024 3387240663231 251094334
262 Aug 2024 3675462701077 251998350
263 Oct 2024 4250942573681 252347664
264 Dec 2024 5085904976338 254365075
The following table lists the number of bases and the number of sequence
records for WGS sequences processed at GenBank, beginning with Release 129.0
in April of 2002. Please note that WGS data are not distributed in conjunction
with GenBank releases. Rather, per-project data files are continuously
available in the WGS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/wgs
ftp://ftp.ncbi.nih.gov/genbank/wgs
Release Date Base Pairs Entries
129 Apr 2002 692266338 172768
130 Jun 2002 3267608441 397502
131 Aug 2002 3848375582 427771
132 Oct 2002 3892435593 434224
133 Dec 2002 6702372564 597042
134 Feb 2003 6705740844 597345
135 Apr 2003 6897080355 596818
136 Jun 2003 6992663962 607155
137 Aug 2003 7144761762 593801
138 Oct 2003 8662242833 1683437
139 Dec 2003 14523454868 2547094
140 Feb 2004 22804145885 3188754
141 Apr 2004 24758556215 4112532
142 Jun 2004 25592758366 4353890
143 Aug 2004 28128611847 4427773
144 Oct 2004 30871590379 5285276
145 Dec 2004 35009256228 5410415
146 Feb 2005 38076300084 6111782
147 Apr 2005 39523208346 6685746
148 Jun 2005 46767232565 8711924
149 Aug 2005 53346605784 10276161
150 Oct 2005 56162807647 11169448
151 Dec 2005 59638900034 12088491
152 Feb 2006 63183065091 12465546
153 Apr 2006 67488612571 13573144
154 Jun 2006 78858635822 17733973
155 Aug 2006 80369977826 17960667
156 Oct 2006 81127502509 18500772
157 Dec 2006 81611376856 18540918
158 Feb 2007 86043478524 19421576
159 Apr 2007 93022691867 23446831
160 Jun 2007 97102606459 23718400
161 Aug 2007 101964323738 25384475
162 Oct 2007 102003045298 25354041
163 Dec 2007 106505691578 26177471
164 Feb 2008 108635736141 27439206
165 Apr 2008 110500961400 26931049
166 Jun 2008 113639291344 39163548
167 Aug 2008 118593509342 40214247
168 Oct 2008 136085973423 46108952
169 Dec 2008 141374971004 48394838
170 Feb 2009 143797800446 49036947
171 Apr 2009 144522542010 48948309
172 Jun 2009 145959997864 49063546
173 Aug 2009 148165117763 48443067
174 Oct 2009 149348923035 48119301
175 Dec 2009 158317168385 54076973
176 Feb 2010 163991858015 57134273
177 Apr 2010 165536009514 58361599
178 Jun 2010 167725292032 58592700
179 Aug 2010 169253846128 58994334
180 Oct 2010 175339059129 59397637
181 Dec 2010 177385297156 59608311
182 Feb 2011 190034462797 62349795
183 Apr 2011 191401393188 62715288
184 Jun 2011 200487078184 63735078
185 Aug 2011 208315831132 64997137
186 Oct 2011 218666368056 68330215
187 Dec 2011 239868309609 73729553
188 Feb 2012 261370512675 78656704
189 Apr 2012 272693351548 80905298
190 Jun 2012 287577367116 82076779
191 Aug 2012 308196411905 84020064
192 Oct 2012 333881846451 86480509
193 Dec 2012 356002922838 92767765
194 Feb 2013 390900990416 103101291
195 Apr 2013 418026593606 110509314
196 Jun 2013 453829752320 112488036
197 Aug 2013 500420412665 124812020
198 Oct 2013 535842167741 130203205
199 Dec 2013 556764321498 133818570
200 Feb 2014 591378698544 139725795
201 Apr 2014 621015432437 143446790
202 Jun 2014 719581958743 175779064
203 Aug 2014 774052098731 189080419
204 Oct 2014 805549167708 196049974
205 Dec 2014 848977922022 200301550
206 Feb 2015 873281414087 205465046
207 Apr 2015 969102906813 243779199
208 Jun 2015 1038937210221 258702138
209 Aug 2015 1163275601001 302955543
210 Oct 2015 1222635267498 309198943
211 Dec 2015 1297865618365 317122157
212 Feb 2016 1399865495608 333012760
213 Apr 2016 1452207704949 338922537
214 Jun 2016 1556175944648 350278081
215 Aug 2016 1637224970324 359796497
216 Oct 2016 1676238489250 363213315
217 Dec 2016 1817189565845 395301176
218 Feb 2017 1892966308635 409490397
219 Apr 2017 2035032639807 451840147
220 Jun 2017 2164683993369 487891767
221 Aug 2017 2242294609510 499965722
222 Oct 2017 2318156361999 508825331
223 Dec 2017 2466098053327 551063065
224 Feb 2018 2608532210351 564286852
225 Apr 2018 2784740996536 621379029
226 Jun 2018 2944617324086 639804105
227 Aug 2018 3204855013281 665309765
228 Oct 2018 3444172142207 722438528
229 Dec 2018 3656719423096 773773190
230 Feb 2019 4164513961679 945019312
231 Apr 2019 4421986382065 993732214
232 Jun 2019 4847677297950 1022913321
233 Aug 2019 5585922333160 1075272215
234 Oct 2019 5985250251028 1097629174
235 Dec 2019 6277551200690 1127023870
236 Feb 2020 6968991265752 1206720688
237 Apr 2020 7788133221338 1267547429
238 Jun 2020 8114046262158 1302852615
239 Aug 2020 8841649410652 1408122887
240 Oct 2020 9215815569509 1432874252
241 Dec 2020 11830842428018 1517995689
242 Feb 2021 12270717209612 1563938043
243 Apr 2021 12732048052023 1590670459
244 Jun 2021 13442974346437 1632796606
245 Aug 2021 13888187863722 1653427055
246 Oct 2021 14599101574547 1721064101
247 Dec 2021 14922033922302 1734664952
248 Feb 2022 15428122140820 1750505007
249 Apr 2022 16071520702170 1781374217
250 Jun 2022 16710373006600 1796349114
251 Aug 2022 17511809676629 2024099677
252 Oct 2022 18231960808828 2167900306
253 Dec 2022 19086596616569 2241439349
254 Feb 2023 20116642176263 2337838461
255 Apr 2023 20926504760221 2440470464
256 Jun 2023 21791125594114 2611654455
257 Aug 2023 22294446104543 2631493489
258 Oct 2023 23600199887231 2775205599
259 Dec 2023 24651580464335 2863228552
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 27225116587937 3333621823
261 Jun 2024 27900199328333 3380877515
262 Aug 2024 29643594176326 3569715357
263 Oct 2024 31362454467668 3745772758
264 Dec 2024 32983029087303 3957195833
The following table provides the number of bases and the number of sequence
records for bulk-oriented Transcriptome Shotgun Assembly (TSA) RNA sequencing
projects processed at GenBank, beginning with Release 190.0 in June of 2012.
TSA sequences processed prior to Release 190.0 in June of 2012 were
handled individually, and are present in the gbtsa*.seq files of GenBank
releases (hence, they contribute to the statistics in the first table
of this section).
Subsequent to that date NCBI began processing TSA submissions using an
approach that is analogous to the bulk-oriented approach used for WGS,
assigning a TSA project code (for example: GAAA) to each TSA submission.
Note 1 : Although we provide statistics for bulk-oriented TSA submissions
as of the dates for GenBank releases, TSA files are not distributed or updated
in conjunction with those releases. Rather, per-project TSA data files are
continuously available in the TSA areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tsa
ftp://ftp.ncbi.nih.gov/genbank/tsa
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TSA submissions as separate records, without a common TSA project
code. In which case, they will not be included in this table.
Note 3 : Statistics for bulk-oriented TSA projects originating at the
European Nucleotide Archive of the INSDC were not included in this table
until the October 2016 GenBank Release.
Note 4 : This table is incomplete. Statistics for Releases 190.0 to
200.0 will be back-filled if time allows.
Release Date Base Pairs Entries
201 Apr 2014 23632325832 29734989
202 Jun 2014 31707343431 38011942
203 Aug 2014 33676182560 40556905
204 Oct 2014 36279458440 43567759
205 Dec 2014 46056420903 62635617
206 Feb 2015 49765340047 66706014
207 Apr 2015 55796332435 71989588
208 Jun 2015 60697472570 76974601
209 Aug 2015 69360654413 87827013
210 Oct 2015 70917172944 81790031
211 Dec 2015 77583339176 87488539
212 Feb 2016 81932555094 92132318
213 Apr 2016 87811163676 98147566
214 Jun 2016 94413958919 104677061
215 Aug 2016 103399742586 113179607
216 Oct 2016 113209225762 124199597
217 Dec 2016 125328824508 142094337
218 Feb 2017 133517212104 151431485
219 Apr 2017 149038907599 165068542
220 Jun 2017 158112969073 176812130
221 Aug 2017 167045663417 186777106
222 Oct 2017 172909268535 192754804
223 Dec 2017 181394660188 201559502
224 Feb 2018 193940551226 214324264
225 Apr 2018 205232396043 227364990
226 Jun 2018 216556686631 238788334
227 Aug 2018 225520004678 249295386
228 Oct 2018 235875573598 259927414
229 Dec 2018 248592892188 274845473
230 Feb 2019 263936885705 294772430
231 Apr 2019 277118019688 311247136
232 Jun 2019 285390240861 319927264
233 Aug 2019 294727165179 331347807
234 Oct 2019 305371891408 342811151
235 Dec 2019 325433016129 367193844
236 Feb 2020 340994289065 386644871
237 Apr 2020 349692751528 396392280
238 Jun 2020 359947709062 409725050
239 Aug 2020 366968951160 417524567
240 Oct 2020 382996662270 435968379
241 Dec 2020 392206975386 446397378
242 Feb 2021 407605409948 463151000
243 Apr 2021 425076483459 481154920
244 Jun 2021 436594941165 494641358
245 Aug 2021 440578422611 498305045
246 Oct 2021 449891016597 508319391
247 Dec 2021 455870853358 514158576
248 Feb 2022 465013156502 524464601
249 Apr 2022 474421076448 534770586
250 Jun 2022 485056129761 546991572
251 Aug 2022 497501380386 560196830
252 Oct 2022 511476787957 574020080
253 Dec 2022 611850391049 649918843
254 Feb 2023 630615054587 672261981
255 Apr 2023 636291358227 678332682
256 Jun 2023 643127590034 683922756
257 Aug 2023 646176166908 686271945
258 Oct 2023 659924904311 701336089
259 Dec 2023 668807109326 715803123
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 689648317082 741066498
261 Jun 2024 695405769319 746753803
262 Aug 2024 706085554263 755907377
263 Oct 2024 812661461811 948733596
264 Dec 2024 820128973511 957403887
The following table provides the number of bases and the number of sequence
records for Targeted Locus Study (TLS) sequencing projects of special marker
genes processed at GenBank, beginning with Release 217.0 in December of 2016.
Note 1 : Although we provide statistics for bulk-oriented TLS submissions
as of the dates for GenBank releases, TLS files are not distributed or updated
in conjunction with those releases. Rather, per-project TLS data files are
continuously available in the TLS areas of the NCBI FTP site:
ftp://ftp.ncbi.nih.gov/ncbi-asn1/tls
ftp://ftp.ncbi.nih.gov/genbank/tls
Note 2 : NCBI's partner institutions within the INSDC might still choose
to treat TLS submissions as separate records, without a common TLS project
code. In which case, they will not be included in this table.
Note 3 : This table is incomplete. Statistics for releases prior to 217.0
will be back-filled if time allows.
Release Date Base Pairs Entries
217 Dec 2016 584697919 1268690
218 Feb 2017 636923295 1438349
219 Apr 2017 636923295 1438349 (unchanged)
220 Jun 2017 824191338 1628475
221 Aug 2017 824191338 1628475 (unchanged)
222 Oct 2017 2993818315 9479460
223 Dec 2017 4458042616 12695198
224 Feb 2018 4531966831 12819978
225 Apr 2018 5612769448 14782654
226 Jun 2018 5896511468 15393041
227 Aug 2018 6077824493 15822538
228 Oct 2018 8435112913 20752288
229 Dec 2018 8511829281 20924588
230 Feb 2019 9146836085 23259929
231 Apr 2019 9623321565 24240761
232 Jun 2019 10182427815 25530139
233 Aug 2019 10531800829 26363945
234 Oct 2019 10848455369 27460978
235 Dec 2019 11280596614 28227180
236 Feb 2020 13669678196 34037371
237 Apr 2020 24615270313 65521132
238 Jun 2020 27500635128 75063181
239 Aug 2020 27825059498 75682157
240 Oct 2020 28814798868 78177358
241 Dec 2020 33036509446 88039152
242 Feb 2021 33634122995 90130561
243 Apr 2021 37998534461 102395753
244 Jun 2021 38198113354 102662929
245 Aug 2021 39930167315 106995218
246 Oct 2021 40168874815 107569935
247 Dec 2021 41143480750 109379021
248 Feb 2022 41321107981 109809966
249 Apr 2022 41324192343 109820387
250 Jun 2022 41999358847 111142107
251 Aug 2022 43852280645 115103527
252 Oct 2022 43860512749 115123306
253 Dec 2022 44009657455 115552377
254 Feb 2023 46465508548 121067644
255 Apr 2023 46567924833 121186672
256 Jun 2023 47302831210 122798571
257 Aug 2023 48289699026 124421006
258 Oct 2023 50868407906 130654568
259 Dec 2023 51568356978 132355132
n/a Feb 2024 n/a n/a No GenBank Release delivered in Feb 2024
260 Apr 2024 53492243256 135115766
261 Jun 2024 54512778803 135446337
262 Aug 2024 77026446552 187321998 Data spike caused by restoration of stats for the KEQH TLS project : 48-mln records
263 Oct 2024 77037504468 187349395
264 Dec 2024 77038271475 187349466
3. FILE FORMATS
The flat file examples included in this section, while not always from the
current release, are usually fairly recent. Any differences compared to the
actual records are the result of updates to the entries involved.
3.1 File Header Information
With the exception of the lists of new, changed, and
deleted accession numbers, each of the files of a GenBank release begins
with the same header, except for the first line, which contains the file
name, and the sixth line, which contains the title of the file. The first
line of the file contains the file name in character positions 1 to 9 and
the full database name (Genetic Sequence Data Bank, aka 'GenBank') starting
in column 22. The brief names of the files in this release are listed in
Section 2.2.
The second line contains the date of the current release in the form
`month day year', beginning in position 27. The fourth line contains
the current GenBank release number. The release number appears in
positions 48 to 52 and consists of three numbers separated by a decimal
point. The number to the left of the decimal is the major release
number. The digit to the right of the decimal indicates the version of
the major release; it is zero for the first version. The sixth line
contains a title for the file. The eighth line lists the number of
entries (loci), number of bases (or base pairs), and number of reports
of sequences (equal to number of entries in this case). These numbers are
right-justified at fixed positions. The number of entries appears in
positions 1 to 8, the number of bases in positions 16 to 26, and the
number of reports in positions 40 to 47. The third, fifth, seventh, and
ninth lines are blank.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBBCT1.SEQ Genetic Sequence Data Bank
December 15 2024
NCBI-GenBank Flat File Release 264.0
Bacterial Sequences (Part 1)
179284 loci, 605564943 bases, from 179284 reported sequences
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 1. Sample File Header
3.4 Sequence Entry Files
GenBank releases contain one or more sequence entry data files, one
for each "division" of GenBank.
3.4.1 File Organization
Each of these files has the same format and consists of two parts:
header information (described in section 3.1) and sequence entries for
that division (described in the following sections).
3.4.2 Entry Organization
In the second portion of a sequence entry file (containing the
sequence entries for that division), each record (line) consists of
two parts. The first part is found in positions 1 to 10 and may
contain:
1. A keyword, beginning in column 1 of the record (e.g., REFERENCE is
a keyword).
2. A subkeyword beginning in column 3, with columns 1 and 2 blank
(e.g., AUTHORS is a subkeyword of REFERENCE). Or a subkeyword beginning
in column 4, with columns 1, 2, and 3 blank (e.g., PUBMED is a
subkeyword of REFERENCE).
3. Blank characters, indicating that this record is a continuation of
the information under the keyword or subkeyword above it.
4. A code, beginning in column 6, indicating the nature of an entry
(feature key) in the FEATURES table; these codes are described in
Section 3.4.12.1 below.
5. A number, ending in column 9 of the record. This number occurs in
the portion of the entry describing the actual nucleotide sequence and
designates the numbering of sequence positions.
6. Two slashes (//) in positions 1 and 2, marking the end of an entry.
The second part of each sequence entry record contains the information
appropriate to its keyword, in positions 13 to 80 for keywords and
positions 11 to 80 for the sequence.
The following is a brief description of each entry field. Detailed
information about each field may be found in Sections 3.4.4 to 3.4.15.
LOCUS - A short mnemonic name for the entry, chosen to suggest the
sequence's definition. Mandatory keyword/exactly one record.
DEFINITION - A concise description of the sequence. Mandatory
keyword/one or more records.
ACCESSION - The primary accession number is a unique, unchanging
identifier assigned to each GenBank sequence record. (Please use this
identifier when citing information from GenBank.) Mandatory keyword/one
or more records.
VERSION - A compound identifier consisting of the primary
accession number and a numeric version number associated with the
current version of the sequence data in the record. This is optionally
followed by an integer identifier (a "GI") assigned to the sequence
by NCBI. Mandatory keyword/exactly one record.
NOTE : Presentation of GI sequence identifiers in the GenBank
flatfile format was discontinued as of March 2017.
NID - An alternative method of presenting the NCBI GI
identifier (described above).
NOTE: The NID linetype is obsolete and was removed from the
GenBank flatfile format in December 1999.
PROJECT - The identifier of a project (such as a Genome
Sequencing Project) to which a GenBank sequence record belongs.
Optional keyword/one or more records.
NOTE: The PROJECT linetype is obsolete and was removed from the
GenBank flatfile format after Release 171.0 in April 2009.
DBLINK - Provides cross-references to resources that
support the existence a sequence record, such as the Project Database
and the NCBI Trace Assembly Archive. Optional keyword/one or
more records.
KEYWORDS - Short phrases describing gene products and other
information about an entry. Mandatory keyword in all annotated
entries/one or more records.
SEGMENT - Information on the order in which this entry appears in a
series of discontinuous sequences from the same molecule. Optional
keyword (only in segmented entries)/exactly one record.
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
SOURCE - Common name of the organism or the name most frequently used
in the literature. Mandatory keyword in all annotated entries/one or
more records/includes one subkeyword.
ORGANISM - Formal scientific name of the organism (first line)
and taxonomic classification levels (second and subsequent lines).
Mandatory subkeyword in all annotated entries/two or more records.
In the event that the organism name exceeds 68 characters (80 - 13 + 1)
in length, it will be line-wrapped and continue on a second line,
prior to the taxonomic classification. Unfortunately, very long
organism names were not anticipated when the fixed-length GenBank
flatfile format was defined in the 1980s. The possibility of linewraps
makes the job of flatfile parsers more difficult : essentially, one
cannot be sure that the second line is truly a classification/lineage
unless it consists of multiple tokens, delimited by semi-colons.
The long-term solution to this problem is to introduce an additional
subkeyword, possibly 'LINEAGE'. But because changes like this can be
very disruptive for customers, implementation has not yet been scheduled.
REFERENCE - Citations for all articles containing data reported
in this entry. Includes seven subkeywords and may repeat. Mandatory
keyword/one or more records.
AUTHORS - Lists the authors of the citation. Optional
subkeyword/one or more records.
CONSRTM - Lists the collective names of consortiums associated
with the citation (eg, International Human Genome Sequencing Consortium),
rather than individual author names. Optional subkeyword/one or more records.
TITLE - Full title of citation. Optional subkeyword (present
in all but unpublished citations)/one or more records.
JOURNAL - Lists the journal name, volume, year, and page
numbers of the citation. Mandatory subkeyword/one or more records.
MEDLINE - Provides the Medline unique identifier for a
citation. Optional subkeyword/one record.
NOTE: The MEDLINE linetype is obsolete and was removed
from the GenBank flatfile format in April 2005.
PUBMED - Provides the PubMed unique identifier for a
citation. Optional subkeyword/one record.
REMARK - Specifies the relevance of a citation to an
entry. Optional subkeyword/one or more records.
COMMENT - Cross-references to other sequence entries, comparisons to
other collections, notes of changes in LOCUS names, and other remarks.
Optional keyword/one or more records/may include blank records.
FEATURES - Table containing information on portions of the
sequence that code for proteins and RNA molecules and information on
experimentally determined sites of biological significance. Optional
keyword/one or more records.
BASE COUNT - Summary of the number of occurrences of each basepair
code (a, c, t, g, and other) in the sequence. Optional keyword/exactly
one record.
NOTE: The BASE COUNT linetype is obsolete and was removed
from the GenBank flatfile format in October 2003.
CONTIG - This linetype provides information about how individual sequence
records can be combined to form larger-scale biological objects, such as
chromosomes or complete genomes. Rather than presenting actual sequence
data, a special join() statement on the CONTIG line provides the accession
numbers and basepair ranges of the underlying records which comprise the
object.
As of August 2005, the 2L chromosome arm of Drosophila melanogaster
(accession number AE014134) provided a good example of CONTIG use.
ORIGIN - Specification of how the first base of the reported sequence
is operationally located within the genome. Where possible, this
includes its location within a larger genetic map. Mandatory
keyword/exactly one record.
- The ORIGIN line is followed by sequence data (multiple records).
// - Entry termination symbol. Mandatory at the end of an
entry/exactly one record.
3.4.3 Sample Sequence Data File
An example of a complete sequence entry file follows. (This example
has only two entries.) Note that in this example, as throughout the
data bank, numbers in square brackets indicate items in the REFERENCE
list. For example, in ACARR58S, [1] refers to the paper by Mackay, et
al.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
GBSMP.SEQ Genetic Sequence Data Bank
December 15 1992
GenBank Flat File Release 74.0
Structural RNA Sequences
2 loci, 236 bases, from 2 reported sequences
LOCUS AAURRA 118 bp ss-rRNA RNA 16-JUN-1986
DEFINITION A.auricula-judae (mushroom) 5S ribosomal RNA.
ACCESSION K03160
VERSION K03160.1
KEYWORDS 5S ribosomal RNA; ribosomal RNA.
SOURCE A.auricula-judae (mushroom) ribosomal RNA.
ORGANISM Auricularia auricula-judae
Eukaryota; Fungi; Eumycota; Basidiomycotina; Phragmobasidiomycetes;
Heterobasidiomycetidae; Auriculariales; Auriculariaceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Huysmans,E., Dams,E., Vandenberghe,A. and De Wachter,R.
TITLE The nucleotide sequences of the 5S rRNAs of four mushrooms and
their use in studying the phylogenetic position of basidiomycetes
among the eukaryotes
JOURNAL Nucleic Acids Res. 11, 2871-2880 (1983)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 34 c 34 g 23 t
ORIGIN 5' end of mature rRNA.
1 atccacggcc ataggactct gaaagcactg catcccgtcc gatctgcaaa gttaaccaga
61 gtaccgccca gttagtacca cggtggggga ccacgcggga atcctgggtg ctgtggtt
//
LOCUS ABCRRAA 118 bp ss-rRNA RNA 15-SEP-1990
DEFINITION Acetobacter sp. (strain MB 58) 5S ribosomal RNA, complete sequence.
ACCESSION M34766
VERSION M34766.1
KEYWORDS 5S ribosomal RNA.
SOURCE Acetobacter sp. (strain MB 58) rRNA.
ORGANISM Acetobacter sp.
Prokaryotae; Gracilicutes; Scotobacteria; Aerobic rods and cocci;
Azotobacteraceae.
REFERENCE 1 (bases 1 to 118)
AUTHORS Bulygina,E.S., Galchenko,V.F., Govorukhina,N.I., Netrusov,A.I.,
Nikitin,D.I., Trotsenko,Y.A. and Chumakov,K.M.
TITLE Taxonomic studies of methylotrophic bacteria by 5S ribosomal RNA
sequencing
JOURNAL J. Gen. Microbiol. 136, 441-446 (1990)
FEATURES Location/Qualifiers
rRNA 1..118
/note="5S ribosomal RNA"
BASE COUNT 27 a 40 c 32 g 17 t 2 others
ORIGIN
1 gatctggtgg ccatggcggg agcaaatcag ccgatcccat cccgaactcg gccgtcaaat
61 gccccagcgc ccatgatact ctgcctcaag gcacggaaaa gtcggtcgcc gccagayy
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 9. Sample Sequence Data File
3.4.4 LOCUS Format
3.4.4.1 : Important notice about parsing the LOCUS line
Users who process the data elements of the LOCUS line should use a
token-based parsing approach rather than parsing its content based on
fixed column positions.
Historically, the LOCUS line has had a fixed length and its elements have
been presented at specific column positions. A complete description of the
data fields and their typical column positions is provided in Section 3.4.4.2 .
But with the anticipated increases in the lengths of accession numbers, and
the advent of sequences that are gigabases long, maintaining the column
positions will not always be possible and the overall length of the LOCUS
line could exceed 79 characters.
Consider this LOCUS line for a typical complete bacterial genome:
LOCUS CP032762 5868661 bp DNA circular BCT 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Now contrast this with a hypothetical gigabase-scale WGS sequence record that
utilizes the 6 + 2 + 7/8/9 accession format:
LOCUS AZZZAA02123456789 9999999999 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Here, Locus-Name/Accession-Number must occupy the space at position 29 which
normally separates the Locus from the Sequence Length. And if the sequence
length had been 10 Gigabases or greater, the Locus-Name and Sequence Length
would directly abut each other:
LOCUS AZZZAA0212345678910000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
In cases like this, a space would be introduced to ensure that the two fields
are separated, all other values would be shifted to the right, and the length of
the LOCUS line would increase:
LOCUS AZZZAA02123456789 10000000000 bp DNA linear PRI 15-OCT-2018
------------+--------------+-+---------+---------+---------+---------+---------
1 13 28 30 40 50 60 70 79
Because the Locus-Name/Accession-Number is left-justified and the
Sequence-Length is right-justified, *most* GenBank records will conform to the
historical column positions that are described below. But since there will be
exceptions, we recommend that users parse the LOCUS line based on
whitespace-separated tokens.
3.4.4.2 : Data elements of the LOCUS line
The data elements of the LOCUS line format and their typical/historical
column positions are as follows:
Positions Contents
--------- --------
01-05 'LOCUS'
06-12 spaces
13-28 Locus Name (usually identical to the Accession Number)
29-29 space
30-40 Sequence Length, right-justified
41-41 space
42-43 'bp'
44-44 space
45-47 Strandedness : spaces (if not known), ss- (single-stranded),
ds- (double-stranded), or ms- (mixed-stranded)
48-53 Molecule Type: NA, DNA, RNA, tRNA (transfer RNA), rRNA (ribosomal RNA),
mRNA (messenger RNA), uRNA (small nuclear RNA), cRNA (viral cRNA)
Left justified.
54-55 space
56-63 Molecule Topology : 'linear' followed by two spaces,
or 'circular'
64-64 space
65-67 Division Code
68-68 space
69-79 Update Date, in the form dd-MMM-yyyy (e.g., 15-MAR-1991)
These column positions are typical/nominal, not guaranteed. See Section
3.4.4.1 for important suggestions about parsing the LOCUS line.
The Locus Name element was originally designed to help group entries with
similar sequences: the first three characters designated the organism; the
fourth and fifth characters could be used to show other group designations,
such as gene product; for segmented entries (now obsolete) the last character
could be one of a series of sequential integers. Here are two examples of
older GenBank records that have Locus Names :
LOCUS HUMPDNRC 273 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S125 polymorphic dinucleotide repeat.
ACCESSION L10620
LOCUS HUMPDNRG 169 bp DNA linear PRI 04-OCT-1993
DEFINITION Human D9S114 polymorphic dinucleotide repeat.
ACCESSION L10624
But in the mid-1990s, maintaining unique Locus Names in addition to unique
Accession Numbers became unsustainable and the assignment of new Locus Names
ceased. The overwhelming majority of sequence records now have no Locus Name,
and their Accession Number is displayed on the LOCUS line instead. For example:
LOCUS AF035771 1357 bp mRNA linear PRI 30-JUN-1998
DEFINITION Homo sapiens Na+/H+ exchanger regulatory factor 2 (NHERF-2) mRNA,
complete cds.
ACCESSION AF035771
The Division Code element of the LOCUS format is a three-letter abbreviation
whose value can be :
PRI - primate sequences
ROD - rodent sequences
MAM - other mammalian sequences
VRT - other vertebrate sequences
INV - invertebrate sequences
PLN - plant, fungal, and algal sequences
BCT - bacterial sequences
VRL - viral sequences
PHG - bacteriophage sequences
SYN - synthetic sequences
UNA - unannotated sequences
EST - EST sequences (Expressed Sequence Tags)
PAT - patent sequences
STS - STS sequences (Sequence Tagged Sites)
GSS - GSS sequences (Genome Survey Sequences)
HTG - HTGS sequences (High Throughput Genomic sequences)
HTC - HTC sequences (High Throughput cDNA sequences)
ENV - Environmental sampling sequences
CON - Constructed sequences
TSA - Transcriptome Shotgun Assembly sequences
The Molecule Type for all non-coding RNA sequences is 'RNA'. Further
information about the specific type of non-coding RNA can be obtained from
the full-length ncRNA feature that will be present on such sequences.
3.4.5 DEFINITION Format
The DEFINITION record gives a brief description of the sequence,
proceeding from general to specific. It starts with the common name of
the source organism, then gives the criteria by which this sequence is
distinguished from the remainder of the source genome, such as the
gene name and what it codes for, or the protein name and mRNA, or some
description of the sequence's function (if the sequence is
non-coding). If the sequence has a coding region, the description may
be followed by a completeness qualifier, such as cds (complete coding
sequence). There is no limit on the number of lines that may be part
of the DEFINITION. The last line must end with a period.
3.4.5.1 DEFINITION Format for NLM Entries
The DEFINITION line for entries derived from journal-scanning at the NLM is
an automatically generated descriptive summary that accompanies each DNA and
protein sequence. It contains information derived from fields in a database
that summarize the most important attributes of the sequence. The DEFINITION
lines are designed to supplement the accession number and the sequence itself
as a means of uniquely and completely specifying DNA and protein sequences. The
following are examples of NLM DEFINITION lines:
NADP-specific isocitrate dehydrogenase [swine, mRNA, 1 gene, 1585 nt]
94 kda fiber cell beaded-filament structural protein [rats, lens, mRNA
Partial, 1 gene, 1873 nt]
inhibin alpha {promoter and exons} [mice, Genomic, 1 gene, 1102 nt, segment
1 of 2]
cefEF, cefG=acetyl coenzyme A:deacetylcephalosporin C o-acetyltransferase
[Acremonium chrysogenum, Genomic, 2 genes, 2639 nt]
myogenic factor 3, qmf3=helix-loop-helix protein [Japanese quails,
embryo, Peptide Partial, 246 aa]
The first part of the definition line contains information describing
the genes and proteins represented by the molecular sequences. This can
be gene locus names, protein names and descriptions that replace or augment
actual names. Gene and gene product are linked by "=". Any special
identifying terms are presented within brackets, such as: {promoter},
{N-terminal}, {EC 2.13.2.4}, {alternatively spliced}, or {3' region}.
The second part of the definition line is delimited by square brackets, '[]',
and provides details about the molecule type and length. The biological
source, i.e., genus and species or common name as cited by the author.
Developmental stage, tissue type and strain are included if available.
The molecule types include: Genomic, mRNA, Peptide. and Other Genomic
Material. Genomic molecules are assumed to be partial sequence unless
"Complete" is specified, whereas mRNA and peptide molecules are assumed
to be complete unless "Partial" is noted.
3.4.6 ACCESSION Format
This field contains a series of six-character and/or eight-character
identifiers called 'accession numbers'. The six-character accession
number format consists of a single uppercase letter, followed by 5 digits.
The eight-character accession number format consists of two uppercase
letters, followed by 6 digits. The 'primary', or first, of the accession
numbers occupies positions 13 to 18 (6-character format) or positions
13 to 20 (8-character format). Subsequent 'secondary' accession numbers
(if present) are separated from the primary, and from each other, by a
single space. In some cases, multiple lines of secondary accession
numbers might be present, starting at position 13.
The primary accession number of a GenBank entry provides a stable identifier
for the biological object that the entry represents. Accessions do not change
when the underlying sequence data or associated features change.
Secondary accession numbers arise for a number of reasons. For example, a
single accession number may initially be assigned to a sequence described in
a publication. If it is later discovered that the sequence must be entered
into the database as multiple entries, each entry would receive a new primary
accession number, and the original accession number would appear as a secondary
accession number on each of the new entries. In the event that a large number
of continuous secondary accession numbers exist, a range can be employed:
SecAccession1-SecAccession2
In such cases, the alphabetic prefix letters of the initial and terminal
accession numbers within the range *MUST* be identical. For example:
AE000111-AE000510O
^^ ^^
Additionally, the value of the numeric portion of the initial secondary
within the range must be less than the value of the numeric portion of the
terminal secondary.
3.4.7.1 VERSION Format
This line contains a compound identifier consisting of the accession
number plus the sequential version number of the associated sequence.
LOCUS AF181452 1294 bp DNA PLN 12-OCT-1999
DEFINITION Hordeum vulgare dehydrin (Dhn2) gene, complete cds.
ACCESSION AF181452
VERSION AF181452.1
^^^^^^^^^^
Compound
Accession.Version
Number
A compound Accession.Version consists of two parts: a stable, unchanging
primary-accession number portion (see Section 3.4.6 for a description of
accession numbers), and a sequentially increasing numeric version number.
The accession and version numbers are separated by a period. The initial
version number assigned to a new sequence is one.
An accession number allows one to retrieve the same biological object in the
database, regardless of any changes that are made to the entry over time. But
those changes can include changes to the sequence data itself, which is of
fundamental importance to many database users. So a numeric version number is
associated with the sequence data in every database entry. If an entry (for
example, AF181452) undergoes two sequence changes, its compound accession
number on the VERSION line would start as AF181452.1 . After the first sequence
change this would become: AF181452.2 . And after the second change: AF181452.3 .
Numeric NCBI "GI" sequence identifiers also used to be included on the
VERSION line, but that practice was discontinued in March of 2017.
GenBank Releases contain only the most recent versions of all sequences
in the database. However, older versions can be obtained via
Accession.Version-based queries with NCBI's web-Entrez and network-Entrez
applications. A sequence 'revision history' resource is also available,
within Entrez:Nucleotide. For example:
http://www.ncbi.nlm.nih.gov/nuccore/AF123456.1?report=girevhist
NOTE: All the version numbers for the compound Accession.Version identifier
system were initialized to a value of one (".1") in February 1999, when the
system was first introduced.
3.4.7.2 DBLINK Format
This line contains cross-references to other underlying resources that
support the existence of a GenBank sequence record. For example:
LOCUS ANHA01000001 503 bp DNA linear BCT 23-NOV-2012
DEFINITION Campylobacter coli BIGS0016 3011, whole genome shotgun sequence.
ACCESSION ANHA01000001 ANHA01000000
VERSION ANHA01000001.1
DBLINK BioProject: PRJNA177352
BioSample: SAMN01795900
A DBLINK cross-reference consists of two data fields delimited by a colon.
The first field provides the cross-reference type ("BioProject"), while the
second contains the actual cross-reference identifier ("PRJNA177352").
The second field can consist of multiple comma-separated identifiers,
if a sequence record has multiple DBLINK cross-references of a given type.
For example:
DBLINK BioProject:PRJNA174162,PRJNA999998,PRJNA999999
And, as in this example, there can be multiple distinct types of DBLINK
cross-references. Each new type will start on a new line, with the first
colon-delimited token being the name of the cross-referenced resource.
As of April 2013, the supported DBLINK cross-reference types are "Project"
(predecessor of BioProject), "BioProject", "BioSample", "Trace Assembly Archive",
"Sequence Read Archive", and "Assembly".
DBLINK cross-references of type 'BioProject' are BioProject Accession
Number identifiers within the Entrez:BioProject resource at the NCBI:
http://www.ncbi.nlm.nih.gov/bioproject
At the above URL, a search for PRJNA177352 would provide information about the
Campylobacter coli sequencing project (underway or completed), the center(s)
performing the sequencing and annotation, information about the organism, etc.
For a more detailed overview of NCBI's BioProject resource:
http://www.ncbi.nlm.nih.gov/books/NBK54016/
DBLINK cross-references of type 'Assembly' are AssemblyID identifiers within
the Assembly resource at NCBI:
http://www.ncbi.nlm.nih.gov/assembly
At the above URL, a search for GCA_000321225.1 would provide assembly details
and statistics for the Odobenus rosmarus divergens (Pacific walrus) genome assembly
submitted by the center(s) that performed the assembly. For a more detailed overview
of NCBI's Assembly resource:
http://www.ncbi.nlm.nih.gov/assembly/help/
3.4.8 KEYWORDS Format
The KEYWORDS field does not appear in unannotated entries, but is
required in all annotated entries. Keywords are separated by
semicolons; a "keyword" may be a single word or a phrase consisting of
several words. Each line in the keywords field ends in a semicolon;
the last line ends with a period. If no keywords are included in the
entry, the KEYWORDS record contains only a period.
3.4.9 SEGMENT Format
NOTE: The SEGMENT linetype is obsolete given the conversion of
of all segmented sets to gapped CON-division records, completed
as of GenBank Release 221.0 in August 2017. No new segmented set
submissions will be accepted by GenBank.
The SEGMENT keyword is used when two (or more) entries of known
relative orientation are separated by a short (<10 kb) stretch of DNA.
It is limited to one line of the form `n of m', where `n' is the
segment number of the current entry and `m' is the total number of
segments.
3.4.10 SOURCE Format
The SOURCE field consists of two parts. The first part is found after
the SOURCE keyword and contains free-format information including an
abbreviated form of the organism name followed by a molecule type;
multiple lines are allowed, but the last line must end with a period.
The second part consists of information found after the ORGANISM
subkeyword. The formal scientific name for the source organism (genus
and species, where appropriate) is found on the same line as ORGANISM.
The records following the ORGANISM line list the taxonomic
classification levels, separated by semicolons and ending with a
period.
3.4.11 REFERENCE Format
The REFERENCE field consists of five parts: the keyword REFERENCE, and
the subkeywords AUTHORS, TITLE (optional), JOURNAL, MEDLINE (optional),
PUBMED (optional), and REMARK (optional).
The REFERENCE line contains the number of the particular reference and
(in parentheses) the range of bases in the sequence entry reported in
this citation. Additional prose notes may also be found within the
parentheses. The numbering of the references does not reflect
publication dates or priorities.
The AUTHORS line lists the authors in the order in which they appear
in the cited article. Last names are separated from initials by a
comma (no space); there is no comma before the final `and'. The list
of authors ends with a period. The TITLE line is an optional field,
although it appears in the majority of entries. It does not appear in
unpublished sequence data entries that have been deposited directly
into the GenBank data bank, the European Nucleotide Archive,
or the DNA Data Bank of Japan. The TITLE field does not end with a
period.
The JOURNAL line gives the appropriate literature citation for the
sequence in the entry. The word `Unpublished' will appear after the
JOURNAL subkeyword if the data did not appear in the scientific
literature, but was directly deposited into the data bank. For
published sequences the JOURNAL line gives the Thesis, Journal, or
Book citation, including the year of publication, the specific
citation, or In press.
For Book citations, the JOURNAL line is specially-formatted, and
includes:
editor name(s)
book title
page number(s)
publisher-name/publisher-location
year
For example:
LOCUS AY277550 1440 bp DNA linear BCT 17-JUN-2003
DEFINITION Stenotrophomonas maltophilia strain CSC13-6 16S ribosomal RNA gene,
partial sequence.
ACCESSION AY277550
....
REFERENCE 1 (bases 1 to 1440)
AUTHORS Gonzalez,J.M., Laiz,L. and Saiz-Jimenez,C.
TITLE Classifying bacterial isolates from hypogean environments:
Application of a novel fluorimetric method dor the estimation of
G+C mol% content in microorganisms by thermal denaturation
temperature
JOURNAL (in) Saiz-Jimenez,C. (Ed.);
MOLECULAR BIOLOGY AND CULTURAL HERITAGE: 47-54;
A.A. Balkema, The Netherlands (2003)
The presence of "(in)" signals the fact that the reference is for a book
rather than a journal article. A semi-colon signals the end of the editor
names. The next semi-colon signals the end of the page numbers, and the
colon that immediately *precedes* the page numbers signals the end of the
book title. The publisher name and location are a free-form text string.
Finally, the year appears at the very end of the JOURNAL line, enclosed in
parentheses.
The MEDLINE line provides the National Library of Medicine's Medline
unique identifier for a citation (if known). Medline UIs are 8 digit
numbers.
The PUBMED line provides the PubMed unique identifier for a citation
(if known). PUBMED ids are numeric, and are record identifiers for article
abstracts in the PubMed database :
http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed
Citations in PubMed that do not fall within Medline's scope will have only
a PUBMED identifier. Similarly, citations that *are* in Medline's scope but
which have not yet been assigned Medline UIs will have only a PUBMED identifier.
If a citation is present in both the PubMed and Medline databases, both a
MEDLINE and a PUBMED line will be present.
The REMARK line is a textual comment that specifies the relevance
of the citation to the entry.
3.4.12 FEATURES Format
GenBank releases use a feature table format designed jointly by GenBank,
the European Nucleotide Archive, and the DNA Data Bank of Japan. This format
is in use by all three databases. The most complete and accurate Feature
Table documentation can be found on the Web at:
http://www.insdc.org/documents/feature-table
The feature table contains information about genes and gene products,
as well as regions of biological significance reported in the
sequence. The feature table contains information on regions of the
sequence that code for proteins and RNA molecules. It also enumerates
differences between different reports of the same sequence, and
provides cross-references to other data collections, as described in
more detail below.
The first line of the feature table is a header that includes the
keyword `FEATURES' and the column header `Location/Qualifiers.' Each
feature consists of a descriptor line containing a feature key and a
location (see sections below for details). If the location does not
fit on this line, a continuation line may follow. If further
information about the feature is required, one or more lines
containing feature qualifiers may follow the descriptor line.
The feature key begins in column 6 and may be no more than 15
characters in length. The location begins in column 22. Feature
qualifiers begin on subsequent lines at column 22. Location,
qualifier, and continuation lines may extend from column 22 to 80.
Feature tables are required, due to the mandatory presence of the
source feature. The sections below provide a brief introduction to
the feature table format.
3.4.12.1 Feature Key Names
The first column of the feature descriptor line contains the feature
key. It starts at column 6 and can continue to column 20. The list of
valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.2
3.4.12.2 Feature Location
The second column of the feature descriptor line designates the
location of the feature in the sequence. The location descriptor
begins at position 22. Several conventions are used to indicate
sequence location.
Base numbers in location descriptors refer to numbering in the entry,
which is not necessarily the same as the numbering scheme used in the
published report. The first base in the presented sequence is numbered
base 1. Sequences are presented in the 5' to 3' direction.
Location descriptors can be one of the following:
1. A single base;
2. A contiguous span of bases;
3. A site between two bases;
4. A single base chosen from a range of bases;
5. A single base chosen from among two or more specified bases;
6. A joining of sequence spans;
7. A reference to an entry other than the one to which the feature
belongs (i.e., a remote entry), followed by a location descriptor
referring to the remote sequence;
A site between two residues, such as an endonuclease cleavage site, is
indicated by listing the two bases separated by a carat (e.g., 23^24).
A single residue chosen from a range of residues is indicated by the
number of the first and last bases in the range separated by a single
period (e.g., 23.79). The symbols < and > indicate that the end point
of the range is beyond the specified base number.
A contiguous span of bases is indicated by the number of the first and
last bases in the range separated by two periods (e.g., 23..79). The
symbols < and > indicate that the end point of the range is beyond the
specified base number. Starting and ending positions can be indicated
by base number or by one of the operators described below.
Operators are prefixes that specify what must be done to the indicated
sequence to locate the feature. The following are the operators
available, along with their most common format and a description.
complement (location): The feature is complementary to the location
indicated. Complementary strands are read 5' to 3'.
join (location, location, .. location): The indicated elements should
be placed end to end to form one contiguous sequence.
order (location, location, .. location): The elements are found in the
specified order in the 5 to 3 direction, but nothing is implied about
the rationality of joining them.
3.4.12.3 Feature Qualifiers
Qualifiers provide additional information about features. They take
the form of a slash (/) followed by a qualifier name and, if
applicable, an equal sign (=) and a qualifier value. Feature
qualifiers begin at column 22.
The list of valid feature keys is available at:
http://www.insdc.org/documents/feature-table#7.3
Qualifiers convey many types of information. Their values can,
therefore, take several forms:
1. Free text;
2. Controlled vocabulary or enumerated values;
3. Citations or reference numbers;
4. Sequences;
Text qualifier values must be enclosed in double quotation marks. The
text can consist of any printable characters (ASCII values 32-126
decimal). If the text string includes double quotation marks, each set
must be `escaped' by placing a double quotation mark in front of it
(e.g., /note="This is an example of ""escaped"" quotation marks").
Some qualifiers require values selected from a limited set of choices.
For example, as of June 2022 the `/exception' qualifier has only four
allowed values: 'RNA editing', 'reasons given in citation', 'rearrangement
required for product', and 'annotated by transcript or proteomic data'.
These are known as controlled vocabulary qualifier values. Controlled
qualifier values are case sensitive.
Citation or published reference numbers for the entry should be
enclosed in square brackets ([]) to distinguish them from other
numbers.
A literal sequence of bases (e.g., "atgcatt") should be enclosed in
quotation marks. Literal sequences are distinguished from free text by
context. Qualifiers that take free text as their values do not take
literal sequences, and vice versa.
3.4.12.4 Cross-Reference Information
One type of information in the feature table lists cross-references to
the annual compilation of transfer RNA sequences in Nucleic Acids
Research, which has kindly been sent to us on CD-ROM by Dr. Sprinzl.
Each tRNA entry of the feature table contains a /note= qualifier that
includes a reference such as `(NAR: 1234)' to identify code 1234 in
the NAR compilation. When such a cross-reference appears in an entry
that contains a gene coding for a transfer RNA molecule, it refers to
the code in the tRNA gene compilation. Similar cross-references in
entries containing mature transfer RNA sequences refer to the
companion compilation of tRNA sequences published by D.H. Gauss and M.
Sprinzl in Nucleic Acids Research.
3.4.12.5 Feature Table Examples
In the first example a number of key names, feature locations, and
qualifiers are illustrated, taken from different sequences. The first
table entry is a coding region consisting of a simple span of bases
and including a /gene qualifier. In the second table entry, an NAR
cross-reference is given (see the previous section for a discussion of
these cross-references). The third and fourth table entries use the
symbols `<`and `>' to indicate that the beginning or end of the
feature is beyond the range of the presented sequence. In the fifth
table entry, the symbol `^' indicates that the feature is between
bases.
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
CDS 5..1261
/product="alpha-1-antitrypsin precursor"
/map="14q32.1"
/gene="PI"
tRNA 1..87
/note="Leu-tRNA-CAA (NAR: 1057)"
/anticodon=(pos:35..37,aa:Leu)
mRNA 1..>66
/note="alpha-1-acid glycoprotein mRNA"
transposon <1..267
/note="insertion element IS5"
misc_recomb 105^106
/note="B.subtilis DNA end/IS5 DNA start"
conflict 258
/replace="t"
/citation=[2]
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 10. Feature Table Entries
The next example shows the representation for a CDS annotated on a scaffold/
CON-division entry built from contigs of the LQNL01 WGS project:
1 10 20 30 40 50 60 70 79
---------+---------+---------+---------+---------+---------+---------+---------
LOCUS KZ271580 141308 bp DNA linear CON 17-AUG-2017
DEFINITION Onchocerca flexuosa isolate Red Deer unplaced genomic scaffold
O_flexuosa-1.0_Cont1703, whole genome shotgun sequence.
ACCESSION KZ271580 LQNL01000000
VERSION KZ271580.1
DBLINK BioProject: PRJNA230512
BioSample: SAMN04226856
KEYWORDS WGS; HIGH_QUALITY_DRAFT.
...
mRNA complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/product="hypothetical protein"
CDS complement(join(<1..1557,1914..2102,2273..2312))
/locus_tag="X798_08235"
/codon_start=1
/product="hypothetical protein"
/protein_id="OZC04795.1"
/db_xref="GI:1233056989"
/translation="MPKKQKSKIPESSGESAHSPIWSVTRRQRTELSPRRDDEIGSTQ
SFSSRTVTTTERVQMIPLPVTFDAPVDVLTPTGRNERFLATTKITSESYSLPVIGGIT
ISGAPLYTGLYIVPKTTKTRNVRTMMTTTTTTTYSAIEINDNEEELKVETEEKTVPQS
TRITLDFPMDYEVVDFEDLLAASPAEEKEHLYVVVGKKDSPTRTTDAADYVVKMIDID
LPSSESKDSPSIERISDAEIEGLMTEIEEGYSDRHDYDAYEGTIASTSRSNEIDQEPI
HRYVTVYHNGISSEKLSPEVERISKEVSTVVAKLSGAYKRASIEGEHIIYTDTKTGQT
LQKGTQSENRQIGESPRRLKSTYTVRFSDPFRIEADDYPWTQQENQSEIIFQKEKKDQ
IGTLDEWQKEKDQQTQINQKGAKIIEEIRQKKPVNAGKLITGLFKKGETYLDYPATET
YKGPVDSTYRILDVESEPIEQLVSVYHNGRSDEFVPIEEKKPSIDVGEVFTDAAQALG
AKITGLFKRGPAHLDYPTSGPYDGPLASTSLALDVEGEPLQQHVNVYHSGRSDEPMIK
IVEIPTEIPVEEVLEEKPIVTAKIITGLF"
CONTIG join(LQNL01005322.1:1..30605,gap(100),LQNL01005323.1:1..85586,
gap(100),LQNL01005324.1:1..24917)
//
---------+---------+---------+---------+---------+---------+---------+---------
1 10 20 30 40 50 60 70 79
Example 11. Scaffold/CON-division join() sequence
3.4.13 ORIGIN Format
The ORIGIN record may be left blank, may appear as `Unreported.' or
may give a local pointer to the sequence start, usually involving an
experimentally determined restriction cleavage site or the genetic
locus (if available). The ORIGIN record ends in a period if it
contains data, but does not include the period if the record is left
empty (in contrast to the KEYWORDS field which contains a period
rather than being left blank).
3.4.14 SEQUENCE Format
The nucleotide sequence for an entry is found in the records following
the ORIGIN record. The sequence is reported in the 5' to 3' direction.
There are sixty bases per record, listed in groups of ten bases
followed by a blank, starting at position 11 of each record. The
number of the first nucleotide in the record is given in columns 4 to
9 (right justified) of the record.
3.4.15 CONTIG Format
As an alternative to SEQUENCE, a CONTIG record can be present
following the ORIGIN record. A join() statement utilizing a syntax
similar to that of feature locations (see the Feature Table specification
mentioned in Section 3.4.12) provides the accession numbers and basepair
ranges of other GenBank sequences which contribute to a large-scale
biological object, such as a chromosome or complete genome. Here is
an example of the use of CONTIG :
CONTIG join(AE003590.3:1..305900,AE003589.4:61..306076,
AE003588.3:61..308447,AE003587.4:61..314549,AE003586.3:61..306696,
AE003585.5:61..343161,AE003584.5:61..346734,AE003583.3:101..303641,
[ lines removed for brevity ]
AE003782.4:61..298116,AE003783.3:16..111706,AE002603.3:61..143856)
However, the CONTIG join() statement can also utilize a special operator
which is *not* part of the syntax for feature locations:
gap() : Gap of unknown length.
gap(X) : Gap with an estimated integer length of X bases.
To be represented as a run of n's of length X
in the sequence that can be constructed from
the CONTIG line join() statement .
gap(unkX) : Gap of unknown length, which is to be represented
as an integer number (X) of n's in the sequence that
can be constructed from the CONTIG line join()
statement.
The value of this gap operator consists of the
literal characters 'unk', followed by an integer.
Here is an example of a CONTIG line join() that utilizes the gap() operator:
CONTIG join(complement(AADE01002756.1:1..10234),gap(1206),
AADE01006160.1:1..1963,gap(323),AADE01002525.1:1..11915,gap(1633),
AADE01005641.1:1..2377)
The first and last elements of the join() statement may be a gap() operator.
But if so, then those gaps should represent telomeres, centromeres, etc.
Consecutive gap() operators are illegal.
4. ALTERNATE RELEASES
NCBI is supplying sequence data in the GenBank flat file format to
maintain compatibility with existing software which require that
particular format. Although we have made every effort to ensure
that these data are presented in the traditional flat file format,
if you encounter any problems in using these data with software which
is based upon the flat file format, please contact us at:
info@ncbi.nlm.nih.gov
The flat file is just one of many possible report formats that can be
generated from the richer representation supported by the ASN.1 form of the
data. Developers of new software tools should consider using the ASN.1 form
directly to take advantage of those features. Documentation and a Software
Developer's Toolkit for ASN.1 are available through NCBI.
The Software Developer's Toolkit and PostScript documentation for Linux,
MacOS and Microsoft Windows systems is available in a compressed UNIX tar
file by anonymous ftp from 'ftp.ncbi.nih.gov', in the toolbox/ncbi_tools++
directory. The file is 'ncbi_cxx--18_0_0.tar.gz'.
5. KNOWN PROBLEMS OF THE GENBANK DATABASE
5.1 Incorrect Gene Symbols in Entries and Index
The /gene qualifier for many GenBank entries contains values other than the
official gene symbol, such as the product or the standard name of the gene.
6. GENBANK ADMINISTRATION
The National Center for Biotechnology Information (NCBI), National Library
of Medicine, National Institutes of Health, is responsible for the production
and distribution of the NIH GenBank Sequence Database. NCBI distributes
GenBank sequence data by anonymous FTP, e-mail servers and other
network services. For more information, you may contact NCBI at the
e-mail address: info@ncbi.nlm.nih.gov .
6.1 Registered Trademark Notice
GenBank (R) is a registered trademark of the U.S. Department of Health
and Human Services for the Genetic Sequence Data Bank.
6.2 Citing GenBank
If you have used GenBank in your research, we would appreciate it if
you would include a reference to GenBank in all publications related
to that research.
When citing data in GenBank, it is appropriate to give the sequence
name, primary accession number, and the publication in which the
sequence first appeared. If the data are unpublished, we urge you to
contact the group which submitted the data to GenBank to see if there
is a recent publication or if they have determined any revisions or
extensions of the data.
It is also appropriate to list a reference for GenBank itself. The
following publication, which describes the GenBank database, should
be cited:
Sayers EW, Cavanaugh M, Clark K, Pruitt KD, Sherry ST, Yankie L,
Karsch-Mizrachi I, "GenBank 2024 update", Nucleic Acids Research,
Volume 52, Issue D1, January 2024, pp. D134-D137.
PMID: 37889039
PMCID: PMC10767886
DOI: 10.1093/nar/gkad903
The following statement is an example of how one might cite GenBank
data. It cites the sequence, its primary accession number, the group
who determined the sequence, and GenBank. The numbers in parentheses
refer to the GenBank citation above and to the REFERENCE in the
GenBank sequence entry.
`We scanned the GenBank (1) database for sequence similarities and
found one sequence (2), GenBank accession number V00002, which showed
significant similarity...'
(1) Sayers, EW. et al, Nucleic Acids Res. 52(D1):D134-D137 (2024)
(2) Nellen, W. and Gallwitz, D. J. Mol. Biol. 159, 1-18 (1982)
6.3 GenBank Distribution Formats and Media
Complete flat file releases of the GenBank database are available via
NCBI's anonymous ftp server:
ftp://ftp.ncbi.nih.gov
Each release is cumulative, incorporating all previous GenBank data.
No retrieval software is provided. GenBank distribution via CD-ROM
ceased as of GenBank Release 106.0 (April, 1998).
6.4 Other Methods of Accessing GenBank Data
Entrez is a molecular biology database system that presents an integrated
view of DNA and protein sequence data, 3D structure data, complete genomes,
and associated PubMed articles. The system is produced by the National
Center for Biotechnology Information (NCBI), and is available only via
the Internet (using the Web-Entrez and Network-Entrez applications).
Accessing Entrez is easy: Simply direct your web browser of choice to:
http://www.ncbi.nlm.nih.gov/
The Web version of Entrez has all the capabilities of the network version,
but with the visual style of the World Wide Web. If you prefer the "look and
feel" of Network-Entrez, you may download Network-Entrez from the NCBI's
FTP server:
ftp://ftp.ncbi.nih.gov/
Versions are available for PC/Windows, Macintosh and several Unix variants.
For information about Network-Entrez, Web-Entrez or any other NCBI
services, you may contact NCBI by e-mail at info@ncbi.nlm.nih.gov .
6.5 Request for Corrections and Comments
We welcome your suggestions for improvements to GenBank. We are
especially interested to learn of errors or inconsistencies in the
data. BankIt or Genome Workbench can be used to submit revisions to
previous submissions. In addition, suggestions and corrections can
be sent by electronic mail to: update@ncbi.nlm.nih.gov. Please be
certain to indicate the primary accession number of the entry to which
your comments apply; it is helpful if you also give the entry name and
the current contents of any data field for which you are recommending
a change.
6.6 Credits and Acknowledgments
Credits -
GenBank Submission Coordination
Ilene Mizrachi
GenBank Annotation Staff
Michael Baxter, Shelby Bidwell, Larissa Brown,
Vincent Calhoun, Andreina Castillo Siri, Larry Chlumsky,
Scott Durkin, Michel Eschenbrenner, Michael Fetchko, Linda Frisse,
Andrea Gocke, Anjanette Johnston, Erica Lam,
Mark Landree, Jason Lowry, Richard McVeigh, Ilene Mizrachi,
DeAnne Olsen Cravaritis, Leigh Riley, Susan Schafer, Augustus Tilley,
Beverly Underwood, and Linda Yankie
GenBank Release Coordination
Mark Cavanaugh
Data Management and Preparation
Serge Bazhin, Evgueni Belyi, Colleen Bollin, Mark Cavanaugh, Yoon Choi,
Sergey Dikunov, Ilya Dondoshansky, Justin Foley, Viatcheslav Gorelenkov,
Sergiy Gotvyanskyy, Eugene Gribov, Sergei Kalashnikov, Jonathan Kans,
Leonid Khotomliansky, Michael Kimelman, Dmitri Kishchukov, Michael Kornbluh,
Alex Kotliarov, Frank Ludwig, Vasuki Palanigobu, Anton Perkov,
Andriy Petrow, Sergey Petrunin, Dmitrii Saprykin, Wenyao Shi, Denis Sinyakov,
Thomas Smith, Vladimir Soussov, Vitaly Stakhovsky, Elena Starchenko,
Hanzhen Sun, Andrei Vereshchagin, Jewen Xiao, Liwei Zhou
Database Administration
Viatcheslav Khotomliansky, Igor Lozitskiy, Craig Oakley, Yevgeniy Semenov,
Benjamin Slade, Constantin Vasilyev
Customer Support
David Brodsky, Hanguan Liu, Cooper Park, Monica Romiti, Eric Sayers,
Majda Valjavec-Gratian
Project Direction/Leadership
Steve Sherry : Acting Director, NLM
Kim Pruitt : Acting Director, NCBI
Valerie Schneider : Acting Branch Chief, NCBI/IEB
Eugene Yaschenko : Chief Technology Officer, NCBI/IRB
Acknowledgments -
Contractor support for GenBank production and distribution has been
provided by Management Systems Designers, Inc., ComputerCraft Corporation,
and The KEVRIC Company, Inc.
6.7 Disclaimer
The United States Government makes no representations or warranties
regarding the content or accuracy of the information. The United States
Government also makes no representations or warranties of merchantability
or fitness for a particular purpose or that the use of the sequences will
not infringe any patent, copyright, trademark, or other rights. The
United States Government accepts no responsibility for any consequence
of the receipt or use of the information.
For additional information about GenBank releases, please contact
NCBI by e-mail at info@ncbi.nlm.nih.gov, or by mail at:
GenBank
National Library of Medicine
Bldg. 38A Rm. 8N-809
8600 Rockville Pike
Bethesda, MD 20894
