CL Educate Limited: (This Draft Red Herring Prospectus Will Be Updated Upon Filing With The Roc)
CL Educate Limited: (This Draft Red Herring Prospectus Will Be Updated Upon Filing With The Roc)
CL Educate Limited: (This Draft Red Herring Prospectus Will Be Updated Upon Filing With The Roc)
CL EDUCATE LIMITED
Our Company was incorporated in New Delhi as ‘Career Launcher (India) Private Limited’ on April 25, 1996 under the Companies Act, 1956 (“Companies Act 1956”), with the Registrar of
Companies, National Capital Territory of Delhi and Haryana (“RoC”). Pursuant to a resolution of our shareholders dated April 25, 2000, our Company was converted to a public limited company
following which our name was changed to ‘Career Launcher (India) Limited’, and a fresh certificate of incorporation was issued by the RoC on June 17, 2000. Pursuant to a resolution of our
shareholders dated February 28, 2011, our name was changed to ‘CL Educate Limited’, and a fresh certificate of incorporation was issued by the RoC on March 18, 2011.
Registered Office: DTJ 925, DLF Tower-B, Jasola District Centre, New Delhi 110 025, India, Tel: +91 (11) 4507 0311
For more information in relation to change in our name and registered office, see “History and Certain Corporate Matters” on page 138.
Corporate Office: 15-A, Knowledge Park-II, Greater Noida 201 310, Uttar Pradesh, India Tel: +91 (120) 3969 600 Fax: +91 (120) 3969 601
Company Secretary and Compliance Officer: Rachna Sharma, Company Secretary Tel: +91 (11) 4507 0311 Fax: +91 (11) 4504 0166
E-mail: compliance@cleducate.com Website: www.cleducate.com CIN: U74899DL1996PLC078481
Promoters: Satya Narayanan .R, Gautam Puri, Nikhil Mahajan, R. Shiva Kumar, Sreenivasan .R, Sujit Bhattacharyya and Bilakes
Consulting Private Limited
INITIAL PUBLIC OFFERING OF UPTO 4,000,000 EQUITY SHARES OF FACE VALUE OF ` 10 EACH (“EQUITY SHARES”) OF CL EDUCATE LIMITED (“CL EDUCATE” OR
“OUR COMPANY” OR “THE COMPANY” OR THE “ISSUER”) FOR CASH AT A PRICE OF ` [●] PER EQUITY SHARE (THE “OFFER PRICE”) AGGREGATING UP TO ` [●]
MILLION (THE “OFFER”). THE OFFER COMPRISES A FRESH ISSUE OF 2,017,478 EQUITY SHARES BY OUR COMPANY (“FRESH ISSUE”) AND AN OFFER FOR SALE OF
UPTO 1,982,522 EQUITY SHARES BY THE SELLING SHAREHOLDERS (AS DEFINED IN THE SECTION “DEFINITIONS AND ABBREVIATIONS”) (“OFFER FOR SALE”).
THE OFFER SHALL CONSTITUTE 29.28% OF THE POST OFFER PAID-UP EQUITY SHARE CAPITAL OF OUR COMPANY. FOR DETAILS OF THE EQUITY SHARES
OFFERED BY EACH SELLING SHAREHOLDER, SEE “CAPITAL STRUCTURE” ON PAGE 61.
THE PRICE BAND WILL BE DECIDED BY THE COMPANY AND GAJA SELLING SHAREHOLDERS AND THE MINIMUM BID LOT WILL BE DECIDED BY the
IPO COMMITTEE OF OUR COMPANY, IN CONSULTATION WITH THE BOOK RUNNING LEAD MANAGER AND ADVERTISED IN [●] EDITION OF [●] (A WIDELY
CIRCULATED ENGLISH NATIONAL NEWSPAPER) AND [●] EDITION OF [●] (A WIDELY CIRCULATED HINDI NATIONAL NEWSPAPER) AT LEAST FIVE WORKING
DAYS PRIOR TO THE BID/OFFER OPENING DATE AND SHALL BE MADE AVAILABLE TO THE BSE LIMITED AND THE NATIONAL STOCK EXCHANGE OF INDIA
LIMITED FOR THE PURPOSE OF UPLOAD ON THEIR WEBSITE.
THE FACE VALUE OF THE EQUITY SHARE IS `10 EACH
In case of revision in the Price Band, the Bid/Offer Period will be extended for at least three additional Working Days (as defined herein) after revision of the Price Band subject to the Bid/Offer
Period not exceeding a total of 10 Working Days. Any revision in the Price Band and the revised Bid/Offer Period, if applicable, will be widely disseminated by notification to the BSE Limited (the
“BSE”) and the National Stock Exchange of India Limited (the “NSE”, together with the BSE, the “Stock Exchanges”), by issuing a press release, and also by indicating the change on the website
of the Book Running Lead Manager (“BRLM”) and at the terminals of the other members of the Syndicate and by intimation to Self Certified Syndicate Banks (“SCSBs”) and Registered Brokers.
In terms of Rule 19(2)(b)(i) of the Securities Contracts (Regulation) Rules, 1957, as amended, (the “SCRR”) the Offer is being made for at least 25% of the post-Offer paid-up Equity Share capital
of our Company. The Offer is being made through the Book Building Process, in compliance with Regulation 26(1) of the Securities and Exchange Board of India (Issue of Capital and Disclosure
Requirements) Regulations, 2009, as amended (“SEBI ICDR Regulations”), where 50% of the Offer will be allocated on a proportionate basis to Qualified Institutional Buyers (“QIBs”) (the
“QIB Category”), provided that the IPO Committee of our Company may, in consultation with the BRLM allocate up to 60% of the QIB Category to Anchor Investors, on a discretionary basis
(the “Anchor Investor Portion”), of which one-third shall be reserved for domestic Mutual Funds, subject to valid Bids being received from domestic Mutual Funds at or above the Anchor
Investor Offer Price. Further, 5% of the QIB Category (excluding the Anchor Investor Portion) shall be available for allocation on a proportionate basis to Mutual Funds only. The remainder shall
be available for allocation on a proportionate basis to QIBs and Mutual Funds, subject to valid Bids being received from them at or above the Offer Price. Further, not less than 15% of the Offer
will be available for allocation on a proportionate basis to Non-Institutional Investors and not less than 35% of the Offer will be available for allocation to Retail Individual Investors, in accordance
with the SEBI ICDR Regulations, subject to valid Bids being received at or above the Offer Price. Retail Individual Investors may participate in this Offer through the ASBA process by providing
the details of the ASBA Accounts in which the corresponding Bid Amounts will be blocked by the SCSBs. QIBs (excluding Anchor Investors) and Non-Institutional Investors can participate in
the Offer only through the ASBA process. Anchor Investors are not permitted to participate in this Offer through the ASBA process. For details in this regard, specific attention is invited to “Offer
Procedure” on page 428.
RIsks in relation to the first offer
This being the first public issue of the securities of our Company, there has been no formal market for the Equity Shares. The face value of the Equity Shares is ` 10 and the Floor Price and Cap
Price are [●] times and [●] times the face value of the Equity Shares, respectively. The Offer Price (as determined by the IPO Committee of our Company in consultation with the BRLM and as
stated in “Basis for Offer Price” on page 90) should not be taken to be indicative of the market price of the Equity Shares after the Equity Shares are listed. No assurance can be given regarding
an active and/or sustained trading in the Equity Shares or regarding the price at which the Equity Shares will be traded after listing.
GENERAL RISKS
Investments in equity and equity-related securities involve a degree of risk and Bidders should not invest any funds in this Offer unless they can afford to take the risk of losing their investment.
Bidders are advised to read the Risk Factors carefully before making an investment decision in this Offer. For making an investment decision, Bidders must rely on their own examination of our
Company and this Offer, including the risks involved. The Equity Shares offered in this Offer have not been recommended or approved by the Securities and Exchange Board of India (“SEBI”),
nor does SEBI guarantee the accuracy or adequacy of this Draft Red Herring Prospectus. Specific attention of the Bidders is invited to “Risk Factors” on page 11.
ISSUER’S AND SELLING SHAREHOLDERS’ ABSOLUTE RESPONSIBILITY
Our Company, having made all reasonable inquiries, accepts responsibility for and confirms that this Draft Red Herring Prospectus contains all information with regard to our Company and the
Offer, which is material in the context of the Offer, that the information contained in this Draft Red Herring Prospectus is true and correct in all material aspects and is not misleading in any material
respect, that the opinions and intentions expressed herein are honestly held and that there are no other facts, the omission or inclusion of which makes this Draft Red Herring Prospectus as a whole
or any of such information or the expression of any such opinions or intentions, misleading in any material respect. Further, each Selling Shareholder accepts responsibility only for statements in
this Draft Red Herring Prospectus in relation to itself and the Equity Shares being sold by it in connection with the Offer for Sale. None of the Selling Shareholders assume any responsibility for
any other statements, including, inter-alia, any of the statements made by or relating to the Company or its business or any other statements by any of the other Selling Shareholders in this Draft
Red Herring Prospectus.
LISTING
The Equity Shares issued though the Red Herring Prospectus are proposed to be listed on the Stock Exchanges. We have received in-principle approvals from the BSE and the NSE for the listing
of the Equity Shares pursuant to letters dated [●] and [●], respectively. [●] is the Designated Stock Exchange.
BOOK RUNNING LEAD MANAGER REGISTRAR TO THE OFFER
Unless the context otherwise indicates or implies, the following terms have the following meanings in this Draft
Red Herring Prospectus, and references to any statute or regulations or policies will include any amendments
or re-enactments thereto, from time to time. In case of any inconsistency between the definitions given below
and the definitions contained in the General Information Document (as defined below), the definitions given
below shall prevail.
Term Description
AoA/Articles of Association or Articles The articles of association of our Company, as amended
Auditors The statutory auditors of our Company, being Haribhakti & Co. LLP, Chartered
Accountants
Bilakes Bilakes Consulting Private Limited
Board or Board of Directors The board of directors of our Company, or a duly constituted committee thereof
CCPS 0.01% compulsorily convertible non-cumulative preference shares of our Company
of face value ` 10 each
Corporate Office The corporate office of our Company, at 15-A, Knowledge Park-II, Greater Noida
201 310, Uttar Pradesh, India
CLEF Career Launcher Education Foundation
CLEIS Career Launcher Education Infrastructure and Services Limited
CLEIS ESOP 2008 Employee Stock Option Plan 2008, the employee stock option plan established by
CLEIS
CLEWS Career Launcher Employees Welfare Society
CLHES CL Higher Educational Services Private Limited
CLIP Career Launcher Infrastructure Private Limited
CL Media CL Media Private Limited
Director(s) The director(s) on the Board of Directors of our Company
ESOP 2001 The employee stock option plan established by our Company with effect from May
DVGHVFULEHGLQ³Capital Structure´RQSDJH61
ESOP 2008 The employee stock option plan established by our Company with effect from April
1, 2008, as amended at the board meeting held on August 11, 2014 and approved at
the annual general meeting held on September 5, 2014, DV GHVFULEHG LQ ³Capital
Structure´RQSDJH61
Equity Shares The Equity Shares of our Company of a face value of ` 10 each
Gaja Selling Shareholders Gaja Trustee Company Private Limited (as trustee for Gaja Capital India Fund ±I)
and GPE (India) Limited
GKP GK Publications Private Limited
Group Entities Companies, firms and ventures promoted by the Promoters, irrespective of whether
such entities are covered under Section 370(1)(B) of the Companies Act 1956 and
disclosed in ³Our Promoters and Group Entities´RQSDJH160
HDFC Housing Development Finance Corporation Limited
HDFC SHA SKDUHKROGHUV¶DJUHHPHQWGDWHG6HSWHPEHUbetween our Company, HDFC,
Satya Narayanan .R, Gautam Puri, R. Sreenivasan, R. Shiva Kumar, Sujit
Bhattacharyya and Nikhil Mahajan
IPO Committee The IPO Committee of the Board of Directors of our Company, comprising Satya
Narayanan .R, Sridar Iyengar, Gopal Jain and Nikhil Mahajan, constituted on
September 5, 2014
Kestone Kestone Integrated Marketing Services Private Limited
MoA/Memorandum of Association The memorandum of association of our Company, as amended from time to time
OCPS 0.01% optionally convertible preference shares of our Company of face value ` 10
each
Promoters Satya Narayanan .R, Gautam Puri, Nikhil Mahajan, R. Shiva Kumar, Sreenivasan
.R, Sujit Bhattacharyya and Bilakes Consulting Private Limited
1
Term Description
Promoter Group Persons and entities constituting the promoter group of our Company, pursuant to
Regulation 2(1)(zb) of the SEBI ICDR Regulations
Registered Office The registered office of our Company, at DTJ 925, DLF Tower-B, Jasola District
Centre, New Delhi 110 025, India
Selling Shareholder(s) Gautam Puri, Satya Narayanan .R, Sreenivasan .R, R. Shiva Kumar, Sujit
Bhattacharyya, Nikhil Mahajan, Parul Mahajan, Nikhil Mahajan HUF, Gaja
Trustee Company Private Limited (as trustee for Gaja Capital India Fund ±I), GPE
(India) Limited, Arindam Lahiri, Sanjay Shivnani, Manav Agarwal, Rakesh
Mittal, Poonam Mittal, Akansha Consultancy Services Limited, R.V.Subramanian,
Vivek Trilokinath, Narayan Ramachandran, Edelweiss Finance & Investments
Limited, GHIOF Mauritius and Sharad Awasthi. For details of Equity Shares
offered by each Selling Shareholder, see ³Capital Structure´RQSDJH61
Subsidiaries Kestone Integrated Marketing Services Private Limited, G.K. Publications Private
Limited, Career Launcher Education Infrastructure and Services Limited, CL Media
Private Limited, Career Launcher Infrastructure Private Limited, CL Higher
Educational Services Private Limited and Kestone Asia Hub Pte Ltd.
Term Description
Allotted/Allotment/Allot Issue, allotment and transfer of Equity Shares to successful Bidders pursuant to this
Offer
Allottee A Bidder to whom the Equity Shares are Allotted
Allotment Advice The note or advice or intimation of Allotment, sent to each successful Bidder who
has been or is to be Allotted the Equity Shares after approval of the Basis of
Allotment by the Designated Stock Exchange
Anchor Investor A QIB, who applies under the Anchor Investor Portion in accordance with the
requirements specified in the SEBI ICDR Regulations
Anchor Investor Bidding Date The date one Working Day prior to the Bid/Offer Opening Date on which Bids
by Anchor Investors shall open and allocation to the Anchor Investors shall be
completed
Anchor Investor Offer Price The final price at which Equity Shares will be issued and Allotted to Anchor
Investors in terms of the Red Herring Prospectus and the Prospectus, which will
be a price equal to or higher than the Offer Price but not higher than the Cap
Price. The Anchor Investor Offer Price will be decided by the IPO Committee of
our Company in consultation with the BRLM
Anchor Investor Portion Up to 60% of the QIB Category which, may be allocated by the IPO Committee
of our Company in consultation with the BRLM, to Anchor Investors, on a
discretionary basis. One third of the Anchor Investor Portion is reserved for
domestic Mutual Funds, at or above the Anchor Investor Offer Price
Application Supported by Blocked The application (whether physical or electronic) by an ASBA Bidder to make a
Amount/ ASBA Bid authorizing the relevant SCSB to block the Bid Amount in the relevant
ASBA Account
ASBA Account Account maintained with an SCSB which will be blocked by such SCSB to the
extent of the appropriate Bid Amount in relation to a Bid by an ASBA Bidder
ASBA Bid A Bid made by an ASBA Bidder
ASBA Bidder Any Bidder (other than Anchor Investors) who Bids through the ASBA process
Bankers to the Offer/Escrow Collection The bank(s) which is/are clearing members and registered with the SEBI as
Banks bankers to the offer, with whom the Escrow Accounts in relation to the Offer will
be opened, in this case being [Ɣ]
Basis of Allotment The basis on which the Equity Shares will be Allotted to successful bidders under
WKH2IIHUGHVFULEHGLQ³Offer Procedure´RQSDJH428
Bid An indication to make an offer during the Bid/Offer Period by a Bidder (including
an ASBA Bidder), or on the Anchor Investor Bidding Date by an Anchor Investor,
pursuant to submission of a Bid cum Application Form, to subscribe for or
purchase our Equity Shares at a price within the Price Band, including all revisions
and modifications thereto, to the extent permissible under SEBI ICDR Regulations
Bid Amount The highest value of the optional Bids as indicated in the Bid cum Application
Form and payable by the Bidder upon submission of the Bid in the Offer
Bid cum Application Form The form in terms of which the Bidder shall make a Bid and which shall be
considered as the application for the Allotment of Equity Shares pursuant to the
terms of the Red Herring Prospectus and the Prospectus
Bidder Any prospective investor who makes a Bid pursuant to the terms of the Red
2
Term Description
Herring Prospectus and the Bid cum Application Form, including an ASBA Bidder
and Anchor Investor
Bid/Offer Closing Date Except in relation to Anchor Investors, the date after which the Syndicate,
Registered Brokers and SCSBs shall not accept any Bids for the Offer, which shall
be published in >Ɣ@HGLWLRQRI>Ɣ@ (a widely circulated English national newspaper)
and [Ɣ] editions of [Ɣ] (a widely circulated Hindi national newspaper). The IPO
Committee of our Company in consultation with the BRLM, may decide to close
the Bid/Offer Period for QIBs one Working Day prior to the Bid/Offer Closing
Date, subject to the SEBI ICDR Regulations
Bid/Offer Opening Date Except in relation to Anchor Investors, the date on which the Syndicate and the
SCSBs shall start accepting Bids for the Offer, which shall be published by our
Company in >Ɣ@ HGLWLRQ RI >Ɣ@ (a widely circulated English national newspaper)
and [Ɣ] editions of [Ɣ] (a widely circulated Hindi national newspaper)
Bid/Offer Period Except in relation to Anchor Investor, the period between the Bid/Offer Opening
Date and the Bid/Offer Closing Date, inclusive of both days during which
prospective Bidders (excluding Anchor Investors) can submit their Bids, including
any revisions thereof
Book Building Process The book building process as described in Schedule XI of the SEBI ICDR
Regulations, in terms of which the Offer is being made
Book Running Lead Manager/BRLM The book running lead manager to the Offer, in this case being Kotak Mahindra
Capital Company Limited
Broker Centers Broker centers notified by the Stock Exchanges, where Bidders can submit the Bid
cum Application Forms to a Registered Broker. The details of such Broker Centers,
along with the names and contact details of the Registered Brokers are available on
the websites of the Stock Exchanges (www.nseindia.com and www.bseindia.com)
Cap Price The higher end of the Price Band above which the Offer Price and Anchor Investor
Offer Price will not be finalized and above which no Bids will be accepted,
including any revisions thereof
Client ID &OLHQWLGHQWLILFDWLRQQXPEHURIWKH%LGGHU¶VEHQHILFLDU\DFFRXQW
Cut-off Price The Offer Price, finalized by the IPO Committee of our Company in consultation
with the BRLM, which shall be any price within the Price Band. Only Retail
Individual Investors are entitled to Bid at the Cut-off Price. QIBs (including
Anchor Investors) and Non-Institutional Investors are not entitled to Bid at the Cut-
off Price
Demographic Details 7KH GHWDLOV RI WKH %LGGHUV LQFOXGLQJ WKH %LGGHUV¶ DGGUHVV QDPH RI WKH %LGGHUV¶
father/husband, investor status, occupation and bank account details
Designated Branches Such branches of the SCSBs which shall collect the Bid cum Application Form
used by ASBA Bidders, a list of which is available at the website of the SEBI
(http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-Intermediaries)
and updated from time to time
Designated Date The date on which the Escrow Collection Banks transfer the funds from the
Escrow Accounts to the Public Offer Account(s) or the Refund Account(s), as
appropriate, and the Registrar to the Offer issues instruction to SCSBs for
transfer of funds from the ASBA Accounts to the Public Offer Account(s) in
terms of the Red Herring Prospectus
Designated Stock Exchange [Ɣ]
DP Depository Participant
DP ID 'HSRVLWRU\3DUWLFLSDQW¶Videntity number
Draft Red Herring Prospectus/DRHP This draft red herring prospectus dated September 26, 2014 filed with the SEBI
and issued in accordance with the SEBI ICDR Regulations, which does not contain
complete particulars of the price at which our Equity Shares are offered
Eligible NRI A non-resident Indian, resident in a jurisdiction outside India where it is not
unlawful to make an offer or invitation under the Offer and in relation to whom the
Red Herring Prospectus constitutes an invitation to subscribe for the Equity Shares
Eligible QFI Qualified Foreign Investors from such jurisdictions outside India where it is not
unlawful to make an offer or invitation under the Offer and in relation to whom the
Red Herring Prospectus constitutes an invitation to purchase the Equity Shares
offered thereby and who have opened dematerialised accounts with SEBI
registered qualified depositary participants and are deemed as FPIs under the SEBI
FPI Regulations
Escrow Account(s) Account(s) opened with the Escrow Collection Bank(s) for the Offer and in whose
favour the Bidders (excluding ASBA Bidders) will issue cheques or demand drafts
in respect of the Bid Amount when submitting a Bid
Escrow Agreement Agreement to be entered into amongst our Company, the Selling Shareholders, the
3
Term Description
Registrar to the Offer, the BRLM, the Syndicate Members, the Refund Bank(s) and
the Escrow Collection Bank(s) for collection of the Bid Amounts and where
applicable remitting refunds, if any, to the Bidders (excluding ASBA Bidders), on
the terms and conditions thereof
First Bidder The Bidder whose name appears first in the Bid cum Application Form or the
Revision Form
Floor Price The lower end of the Price Band, and any revisions thereof, below which the Offer
Price will not be finalized and below which no Bids will be accepted and which
shall not be less than the face value of the Equity Shares
Fresh Issue Fresh issue of 2,017,478 Equity Shares by our Company as part of the Offer, in
terms of this Draft Red Herring Prospectus
General Information Document The General Information Document for investing in public issues prepared and
issued in accordance with the circular (CIR/CFD/DIL/12/2013) dated October
QRWLILHGE\6(%,DQGLQFOXGHGLQ³Offer Procedure´RQSDJH428
Maximum RII Allottees The maximum number of RIIs who can be allotted the minimum Bid Lot. This is
computed by dividing the total number of Equity Shares available for Allotment
to RIIs by the minimum Bid Lot
Mutual Fund Portion 5% of the QIB Category (excluding the Anchor Investor Portion) available for
allocation to Mutual Funds only, on a proportionate basis
Net Proceeds Proceeds of the Offer that will be available to our Company, which shall be the
gross proceeds of the Offer less the Offer-related expenses and the proceeds of the
Offer for Sale
Non-Institutional Category The portion of the Offer, being not less than 15% of the Offer or 600,000 Equity
Shares, available for allocation on a proportionate basis to Non-Institutional
Investors subject to valid Bids being received at or above the Offer Price
Non-Institutional Investors/NIIs All Bidders, including FPIs registered with the SEBI that are not QIBs (including
Anchor Investors) or Retail Individual Investors who have Bid for Equity Shares
for an amount of more than ` 2,00,000
Offer Public offer of upto 4,000,000 Equity Shares for cash at a price of ` >Ɣ@ SHU
Equity Share, aggregating up to ` >Ɣ@ million, comprising a Fresh Issue of
2,017,478 Equity Shares of our Company and an Offer for Sale of upto
1,982,522 Equity Shares by the Selling Shareholders
Offer Agreement The agreement dated September 26, 2014 entered into amongst our Company, the
Selling Shareholders and the BRLM, pursuant to which certain arrangements are
agreed to in relation to the Offer
Offer for Sale Offer for sale of upto 1,982,522 Equity Shares being offered by the Selling
Shareholder pursuant to the Red Herring Prospectus
Offer Price The final price at which Equity Shares will be Allotted to the Bidders (except
Anchor Investors), as determined in accordance with the Book Building Process on
the Pricing Date
Price Band Price band of the Floor Price of ` >Ɣ@DQGD&DS3ULFHRI` >Ɣ@LQFOXGLQJUHYLVLRQV
thereof. The Price Band and the minimum Bid lot for the Offer will be decided by
our Company and the Gaja Selling Shareholders in consultation with the BRLM
and advertised in >Ɣ@ HGLWLRQ RI >Ɣ@ (a widely circulated English national
newspaper) and [Ɣ] editions of [Ɣ] (a widely circulated Hindi national newspaper),
at least five Working Days prior to the Bid/Offer Opening Date, with the relevant
financial ratios calculated at the Floor Price and at the Cap Price and shall be made
available to the Stock Exchanges for the purpose of uploading on their website
Pricing Date The date on which the IPO Committee of our Company in consultation with the
BRLM, shall finalize the Offer Price
Prospectus The Prospectus to be filed with the RoC for this Offer on or after the Pricing Date
in accordance with the provisions of Section 26 of the Companies Act, 2013 and
the SEBI ICDR Regulations, including any addenda or corrigenda thereto
Public Offer Account The account(s) to be opened with the Banker(s) to the Offer to receive monies from
the Escrow Account(s) and the ASBA Accounts on the Designated Date
QIB Category The portion of the Offer, being 50% of the Offer or 2,000,000 Equity Shares
available for allocation to QIBs on a proportionate basis, including the Anchor
Investor Portion (in which allocation shall be on a discretionary basis, as
determined by the IPO Committee of our Company in consultation with the
BRLM), subject to valid Bids being received at or above the Offer Price
Qualified Institutional Buyers or QIBs A qualified institutional buyer as defined under Regulation 2(1)(zd) of the SEBI
ICDR Regulations
Red Herring Prospectus or RHP The red herring prospectus to be issued in accordance with Section 32 of the
Companies Act, 2013 and the SEBI ICDR Regulations, which will not have
4
Term Description
complete particulars of the price at which the Equity Shares shall be issued and
which shall be filed with the RoC at least three Working Days before the
Bid/Offer Opening Date and will become the Prospectus after filing with the
RoC after the Pricing Date, including any addenda or corrigenda thereto
Refund Account(s) Account(s) opened with the Refund Bank(s) from which refunds, if any, of the
whole or part of the Bid Amount shall be made to the Bidders (excluding ASBA
Bidders)
Refund Bank(s) Escrow Collection Bank(s) with whom Refund Account(s) will be opened and
from which a refund of the whole or part of the Bid Amount, if any, shall be made,
in this case being [Ɣ]
Registered Brokers Stock brokers registered with the stock exchanges having nationwide terminals,
other than the members of the Syndicate
Registrar Agreement The agreement dated September 26, 2014, entered into between our Company, the
Selling Shareholders and the Registrar to the Offer in relation to the responsibilities
and obligations of the Registrar to the Offer pertaining to the Offer
Registrar to the Offer Karvy Computershare Private Limited
Retail Category The portion of the Offer, being not less than 35% of the Offer or 1,400,000 Equity
Shares, available for allocation to Retail Individual Investors, which shall not be
less than the minimum Bid lot, subject to availability in the Retail Category and the
remaining Equity Shares to be Allotted on a proportionate basis
Retail Individual Investors/ RIIs Bidders (including HUFs and Eligible NRIs) whose Bid Amount for Equity Shares
in the Offer is not more than ` 2,00,000
Revision Form The form used by the Bidders to modify the quantity of Equity Shares or the Bid
Amount in any of their Bid cum Application Forms or any previous Revision
Form(s)
Self Certified Syndicate Banks or SCSBs The banks registered with the SEBI which offer the facility of ASBA and the list of
which is available on the website of the SEBI
(http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-Intermediaries)
Specified Locations Bidding centers where the Syndicate shall accept Bid cum Application Forms, a
list of which is available on the website of the SEBI
(http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-Intermediaries)
and updated from time to time
Stock Exchanges BSE Limited and National Stock Exchange of India Limited
Syndicate Agreement The agreement to be entered into amongst the members of the Syndicate, our
Company, the Selling Shareholders and the Registrar to the Offer in relation to the
collection of Bids in the Offer (other than Bids directly submitted to the SCSBs
under the ASBA process or to Registered Brokers at the Broker Centers)
Syndicate Members Intermediaries registered with the SEBI and permitted to carry out activities as an
XQGHUZULWHULQWKLVFDVHEHLQJ>Ɣ@
Syndicate or members of the Collectively, the BRLM and the Syndicate Members
Syndicate
Underwriters The members of the Syndicate
Underwriting Agreement The agreement among our Company, the Selling Shareholders and the
Underwriters, to be entered into on or after the Pricing Date
Working Day(s) All days, excluding Sundays and public holidays, on which commercial banks in
India are open for business, except with reference to announcement of Price
Band and Bid/Offer Period, where working day shall mean all days, excluding
Saturdays, Sundays and public holidays, which are working days for commercial
banks in India
Term Description
BSE BSE Limited
CAGR Compounded Annual Growth Rate
Category III FPIs FPIs registered as category III FPIs under the SEBI FPI Regulations, which shall
include all other FPIs not eligible under category I and II foreign portfolio investors,
such as endowments, charitable societies, charitable trusts, foundations, corporate
bodies, trusts, individuals and family offices
Companies Act Companies Act, 1956, as superseded and substituted by notified provisions of the
Companies Act, 2013
Companies Act 1956 Companies Act, 1956
Competition Act Competition Act, 2002
5
Term Description
Consolidated FDI Policy The current consolidated FDI Policy, effective from April 17, 2014, issued by the
Department of Industrial Policy and Promotion, Ministry of Commerce and
Industry, Government of India, and any modifications thereto or substitutions
thereof, issued from time to time
Copyright Act Copyright Act, 1957
Depository A depository registered with the SEBI under the Securities and Exchange Board of
India (Depositories and Participants) Regulations, 1996
Depositories Act Depositories Act, 1996
EPS Earnings per share
FDI Foreign direct investment
FEMA Foreign Exchange Management Act, 2000
FII(s) Foreign Institutional Investors as defined under Securities and Exchange Board of
India (Foreign Institutional Investors) Regulations, 2000, registered with the SEBI
under applicable laws in India and deemed as FPIs under the SEBI FPI
Regulations
Financial Year/Fiscal The period of 12 months commencing on April 1 of the immediately preceding
calendar year and ending on March 31 of that particular calendar year
FPIs A foreign portfolio investor who has been registered pursuant to the SEBI FPI
Regulations, provided that any QFI or FII who holds a valid certificate of
registration shall be deemed to be an FPI until the expiry of the block of three
years for which fees have been paid as per the Securities and Exchange Board of
India (Foreign Institutional Investors) Regulations, 1995
GoI The Government of India
HUF Hindu undivided family
ICAI The Institute of Chartered Accountants of India
IFRS International Financial Reporting Standards
Income Tax Act Income Tax Act, 1961
Indian GAAP Generally Accepted Accounting Principles in India
Mutual Funds Mutual funds registered with the SEBI under the SEBI (Mutual Funds) Regulations,
1996
MCA The Ministry of Corporate Affairs, GoI
NR/ Non-resident A person resident outside India, as defined under the FEMA and includes a Non-
resident Indian
NSE The National Stock Exchange of India Limited
PAN Permanent account number
PAT Profit after tax
RBI The Reserve Bank of India
RoC or Registrar of Companies The Registrar of Companies, National Capital Territory of Delhi and Haryana
RoNW Return on Net Worth
INR or Rupee or ` or Rs. Indian Rupee, the official currency of the Republic of India
SCRR Securities Contracts (Regulation) Rules, 1957
SEBI Securities and Exchange Board of India constituted under the SEBI Act
SEBI Act Securities and Exchange Board of India Act, 1992
SEBI ICDR Regulations Securities and Exchange Board of India (Issue of Capital and Disclosure
Requirements) Regulations, 2009
SEBI FPI Regulations Securities and Exchange Board of India (Foreign Portfolio Investors) Regulations,
2014
Securities Act United States Securities Act, 1933
Takeover Regulations Securities and Exchange Board of India (Substantial Acquisition of Shares and
Takeovers) Regulations, 2011
Trademarks Act Trademarks Act, 1999
US$ or USD or US Dollar United States Dollar, the official currency of the United States of America
USA or U.S. or US United States of America
Term Description
AICTE All India Council for Technical Education
AIIMS MBBS All India Institute of Medical Science MBBS
AIPMT All India Pre Medical Test
ATMA AIMS Test for Management Admission
CAT Common Admission Test
6
Term Description
CA-CPT Chartered Accountancy ± Common Proficiency Test
CBSE Central Board of Secondary Education
CLAT Common Law Admission Test
CMAT Common Management Admission Test
GMAT Graduate Management Admission Test
GRE Graduate Record Examinations
ICSE Indian Certificate of Secondary Education
IELTS International English Language Testing System
IGCSE International General Certification of Secondary Education
IIMs Indian Institutes of Management
IITs Indian Institutes of Technology
ISBNs International Standard Book Numbers
JEE-Advanced Joint Entrance Exam-Advanced
JEE-Main Joint Entrance Exam ± Main
LSAT Law School Admission Test
NATA National Aptitude Test in Architecture
NITs National Institutes of Technology
NMAT NMIMS Management Aptitude Test
SAT Scholastic Assessment Test
SNAP Symbiosis National Aptitude Test
TOEFL Test of English as a Foreign Language
XAT XLRI Admission Test
The words and expressions used but not defined in this Draft Red Herring Prospectus will have the same
meaning as assigned to such terms under the Companies Act, the Securities and Exchange Board of India Act,
1992 WKH³SEBI Act´, the SCRA, the Depositories Act and the rules and regulations made thereunder.
7
CERTAIN CONVENTIONS, USE OF FINANCIAL INFORMATION AND MARKET DATA
AND CURRENCY OF PRESENTATION
Certain Conventions
All references in this Draft Red Herring Prospectus to ³,QGLD´ are to the Republic of India. All references in
this Draft Red Herring Prospectus to the ³86´, ³86$´ or ³8QLWHG 6WDWHV´ are to the United States of
America.
Financial Data
Unless stated otherwise, the financial data in this Draft Red Herring Prospectus is derived from our consolidated
restated financial statements for and as of fiscal 2010, 2011, 2012, 2013 and 2014, and our standalone restated
financial statements for and as of fiscal 2010, 2011, 2012, 2013 and 2014, prepared in accordance with the
*HQHUDOO\$FFHSWHG$FFRXQWLQJ3ULQFLSOHVLQ,QGLD³Indian GAAP´DQGWKH&RPSDQLHV$FW and restated in
accordance with the SEBI ICDR Regulations.
Our financial year commences on April 1 and ends on March 31, so all references to a particular financial year
are to the twelve-month period ended March 31 of that year.
There are significant differences between the Indian GAAP, the International Financial Reporting Standards
³IFRS´DQGWKH*HQHUDOO\$FFHSWHG$FFRXQWLQJ3ULQFLSOHVLQWKH8QLWHG6WDWHVRI$PHULFD³U.S. GAAP´
Accordingly, the degree to which the financial statements included in this Draft Red Herring Prospectus will
provide meaningful LQIRUPDWLRQLVHQWLUHO\GHSHQGHQWRQWKHUHDGHU¶VOHYHORIIDPLOLDULW\ZLWK,QGLDQDFFRXQWLQJ
practices. Any reliance by persons not familiar with Indian accounting practices, Indian GAAP, the Companies
Act and the SEBI Regulations on the financial disclosures presented in this Draft Red Herring Prospectus should
accordingly be limited. We have not attempted to quantify the impact of IFRS or U.S. GAAP on the financial
data included in this Draft Red Herring Prospectus, nor do we provide a reconciliation of our financial
statements to those under U.S. GAAP or IFRS and we urge you to consult your own advisors regarding such
differences and their impact on our financial data.
Certain figures contained in this Draft Red Herring Prospectus, including financial information, have been
subject to rounding adjustments. All decimals have been rounded off to two decimal points. In certain instances,
(i) the sum or percentage change of such numbers may not conform exactly to the total figure given; and (ii) the
sum of the numbers in a column or row in certain tables may not conform exactly to the total figure given for
that column or row.
Industry and market data used throughout this Draft Red Herring Prospectus has been obtained from various
industry publications such as the &5,6,/ 5HVHDUFK 5HSRUW GDWHG 0D\ RQ µ$VVHVVPHQW IRU 7HVW
Preparation, K- 9RFDWLRQDO 7UDLQLQJ DQG 3XEOLVKLQJ ,QGXVWULHV¶ WKH ³CRISIL Report´. Industry
publications generally state that the information contained in such publications has been obtained from publicly
available documents from various sources believed to be reliable but their accuracy and completeness are not
guaranteed and their reliability cannot be assured. Although we believe the industry and market data used in this
Draft Red Herring Prospectus is reliable, it has not been independently prepared or verified by us, the Selling
Shareholders or the BRLM or any of their affiliates or advisors. The data used in these sources may have been
reclassified by us for the purposes of presentation. Data from these sources may also not be comparable. The
extent to which the industry and market data presented in this Draft Red Herring Prospectus is meaningful
GHSHQGVXSRQWKHUHDGHU¶VIDPLOLDULW\ZLWKDQGXQGHUVWDQGLQJRIWKHPHWKRGRORJLHVXVHGLQFRPSLOLQJVXFKGDWD
There are no standard data gathering methodologies in the industry in which we conduct our business and
methodologies and assumptions may vary widely among different market and industry sources.
&HUWDLQ LQIRUPDWLRQ LQ WKH FKDSWHUV WLWOHG ³Summary of Industry´ ³Summary of Business´ ³Industry
Overview´DQG³Our Business´RIWKLV'UDIW5HG+HUULQJ3URVSectus has been obtained from CRISIL Research,
a division of CRISIL Limited, which has issued the following disclaimer:
CRISIL Research, a division of CRISIL Limited (CRISIL) has taken due care and caution in preparing this
report (Report) based on the Information obtained by CRISIL from sources which it considers reliable (Data).
8
However, CRISIL does not guarantee the accuracy, adequacy or completeness of the Data / Report and is not
responsible for any errors or omissions or for the results obtained from the use of Data / Report. This Report is
not a recommendation to invest / disinvest in any company covered in the Report. CRISIL especially states that
it has no liability whatsoever to the subscribers / users / transmitters/ distributors of this Report. CRISIL
5HVHDUFK RSHUDWHV LQGHSHQGHQWO\ RI DQG GRHV QRW KDYH DFFHVV WR LQIRUPDWLRQ REWDLQHG E\ &5,6,/¶V 5DWLQJV
Division / CRISIL Risk and Infrastructure Solutions Ltd (CRIS), which may, in their regular operations, obtain
information of a confidential nature. The views expressed in this Report are that of CRISIL Research and not of
&5,6,/¶V 5DWLQJV 'LYLVLRQ &5,6 1R SDUW RI WKLV 5HSRUW PD\ EH SXEOLVKHGUHSURGXFHG LQ DQ\ IRUP ZLWKRXW
&5,6,/¶VSULRUZULWWHQDSSURYDO
Such data involves risks, uncertainties and numerous assumptions and is subject to change based on various
IDFWRUVLQFOXGLQJWKRVHGLVFXVVHGLQ³Risk Factors´RQSDJH11. Accordingly, investment decisions should not
be based solely on such information.
All UHIHUHQFHVWR³Rupees´RU³`´RU³Rs.´DUHWR,QGLDQ5XSHHVWKHRIILFLDOFXUUHQF\RIWKH5HSXEOLFRI,QGLD
$OO UHIHUHQFHV WR ³U.S. Dollar´ RU ³USD´ RU ³US$´ DUH WR 8QLWHG 6WDWHV 'ROODU WKH RIILFLDO FXUUHQF\ RI WKH
United States of America. All reference WR ³SGD´ RU ³Singapore Dollar´is to Singapore Dollar, the official
currency of the Republic of Singapore.
Exchange Rates
This Draft Red Herring Prospectus contains translations of certain U.S. Dollar and other currency amounts into
Indian Rupees. These convenience translations should not be construed as a representation that those U.S.
Dollar or other currency amounts could have been, or can be converted into Indian Rupees, at any particular rate
or at all.
The exchange rates of the respective foreign currencies as on March 31, 2010, March 31, 2011, March 31, 2012,
March 31, 2013 and March 31, 2014, are provided below.
(`)
Currency Exchange Rate Exchange Rate Exchange Rate Exchange Rate Exchange Rate as
as on March 31, as on March as on March 30, as on March 28, on March 28,
2010 31, 2011 2012* 2013** 2014***
1 US$ 45.14 44.65 51.16 54.39 60.10
1 SGD 32.11 35.37 40.52 43.71 47.50
Source: RBI & Bloomberg
*Not available for March 31, 2012 on account of it being a non-trading day.
** Not available for March 29, 2012, March 30, 2012 and March 31, 2012 as these were non-trading days.
*** Not available for March 29, 2012, March 30, 2012 and March 31, 2012 as these were non-trading days.
9
FORWARD-LOOKING STATEMENTS
This Draft Red +HUULQJ 3URVSHFWXV FRQWDLQV FHUWDLQ ³IRUZDUG-ORRNLQJ VWDWHPHQWV´ 7KHVH IRUZDUG ORRNLQJ
statements generally can be identified by words or phrases such as ³DLP´ ³DQWLFLSDWH´ ³EHOLHYH´ ³H[SHFW´
³HVWLPDWH´³LQWHQG´³REMHFWLYH´³SODQ´³SURMHFW´³ZLOOFRQWLQXH´ ³VHHNWR´³ZLOOSXUVXH´RURWKHUZRUGVRU
phrases of similar import. Similarly, statements which describe our strategies, objectives, plans or goals are also
forward-looking statements.
These forward-looking statements are based on our current plans, estimates and expectations and actual results
may differ materially from those suggested by such forward-looking statements being subject to risks,
uncertainties and assumptions about us that could cause actual results to differ materially from those
contemplated by the relevant forward-looking statement, including, but not limited to:
x Our inability to maintain and grow our business and brand image.
x Execution risks in relation to our competitive and growth strategies.
x Our inability to successfully identify and integrate acquisitions may adversely affect our growth strategy.
x Failure on our part to effectively compete.
x Failure to attract students in our test prep business, including due to an unsatisfactory success ratio.
x Our inability to cater to and suitably update and enhance the depth of our product offerings.
x Any changes in our relationships with our business partners or non-adherence to prescribed service
standards, payment default or other contractual breaches or irregularities.
x Recent global economic conditions have been unprecedented and challenging and continue to affect the
Indian job market, in particular with respect to demand for MBA graduates.
x We do not, typically, have long term exclusive arrangements with content developers for our test prep and
publication and content development businesses.
x Our publication and content development business is subject to several risks, including in relation to
distribution and content development.
x Introduction of a stringent regulatory framework by the Government in the future in relation to our business
segments.
x Risks associated with the K-12 school business, including in relation to the regulatory framework and our
dependence on third parties.
x Litigation with a former business partner, in relation to a school formerly operated under the brand Indus
World Schools.
x The use of the Indus World School name and logo has been challenged by certain third parties.
x Risks in relation to our vocational training business, including fixed price contracts, which could result in
cost overruns and payment delays from our partnerships with the Central and State Governments.
)RU D IXUWKHU GLVFXVVLRQ RI IDFWRUV WKDW FRXOG FDXVH RXU DFWXDO UHVXOWV WR GLIIHU VHH ³Risk Factors´ ³Our
Business´ DQG³Management¶V Discussion and Analysis of Financial Condition and Results of Operations´
on pages 11, 117 and 359, respectively. By their nature, certain market risk disclosures are only estimates and
could be materially different from what actually occurs in the future. As a result, actual future gains or losses
could materially differ from those that have been estimated. Forward-looking statements reflect our current
views as of the date of this Draft Red Herring Prospectus and are not a guarantee of future performance.
Although we believe that the assumptions on which such statements are based are reasonable, any such
assumptions as well as the statement based on them could prove to be inaccurate.
Neither our Company, nor the Selling Shareholders, nor the Syndicate, nor any of their respective affiliates have
any obligation to update or otherwise revise any statements reflecting circumstances arising after the date hereof
or to reflect the occurrence of underlying events, even if the underlying assumptions do not come to fruition. In
accordance with SEBI requirements, our Company and the BRLM will ensure that investors in India are
informed of material developments until the receipt of final listing and trading approvals for the Equity Shares
pursuant to the Offer.
10
SECTION II - RISK FACTORS
Any investment in equity shares involves a high degree of risk. You should carefully consider all the information
in this Draft Red Herring Prospectus, including the risks, uncertainties and challenges described below, before
PDNLQJDQLQYHVWPHQWLQRXU(TXLW\6KDUHV<RXVKRXOGUHDGWKLVVHFWLRQLQFRQMXQFWLRQZLWK³Our Business´
DQG³Management's Discussion and Analysis of Financial Condition and Results of Operations´RQSDJHV
117 and 359, respectively, as well as other financial and statistical information contained elsewhere in this
Draft Red Herring Prospectus.
If any or a combination of the following risks, or other risks and uncertainties that are not currently known or
are now deemed immaterial, actually materialize, our business, financial condition, results of operations and
prospects may suffer, the trading price of our Equity Shares may decline, and all or part of your investment in
our Equity Shares may be lost. Unless otherwise stated, we are not in a position to specify or quantify the
financial or other risks mentioned here.
Unless otherwise stated, the financial information in this section is derived from our restated consolidated
financial statements as at and for the years ended March 31, 2014, March 31, 2013, March 31, 2012, March 31,
2011 and March 31, 2010.
This Draft Red Herring Prospectus contains forward-looking statements that involve risks and uncertainties.
Our actual results may differ materially from those anticipated in these forward-looking statements as a result
of certain factors, including the considerations described below and elsewhere in this Draft Red Herring
3URVSHFWXV6HH³Forward-Looking Statements´RQSDJH10.
1. Our business and prospects may be adversely affected if we are unable to maintain and grow our
business and brand image.
We believe that our brand is associated with academic excellence and that our future success will be
significantly influenced by continued investment in our brands Career Launcher, LST, GK Publications and
Indus World Schools. We also believe that continuing to develop awareness of our brands, through focused and
consistent branding and marketing initiatives, among students, parents and other players in the education
industry is critical to our ability to increase enrolments and revenues, increase penetration of our offerings in
existing markets and expansion into new markets.
The factors that may impair our reputation and dilute the impact of our branding and marketing initiatives may
include the media strategies of our competitors, and the success ratio of our students vis-à-vis students enrolled
with any of our competitors, the costs of our branding and marketing campaigns, and any adverse publicity
involving us, our students or faculty hired by us or our business partners. For instance, we have filed a civil suit
in the High Court of Delhi in relation to the comparative advertisements by Triumphant Institute of
0DQDJHPHQW(GXFDWLRQ3ULYDWH/LPLWHG³T.I.M.E.´DQGRWKHUV as such advertisements were disparaging and
denigrating the services and courses of our Company.
In particular, as a significant part of our operations is conducted through test prep centers and schools operated
by our business partners, we license our trademarks and brands to several third parties over whose activities we
cannot, and do not, exercise direct day-to-day control. While our agreements with our business partners prohibit
them from effecting any damage to our brand and intellectual property, and require them to indemnify us in case
of any such losses, any misuse or mismanagement on the part of our business partners may dilute the value of
our brand and intellectual property, which may adversely affect our reputation, business and prospects. Any
impairment of our reputation or erosion of our brand due to such factors, or any other risks or uncertainties
presently unforeseen by us, may have an adverse effect on our business and prospects.
For more information on certain legal proceedings in which we are involved with certain former business
SDUWQHUVVHHULVNIDFWRUV³We are currently involved in litigation with a former business partner, in relation to
a school formerly operated under the brand Indus World Schools.´ DQG³We, our Directors and Promoters
11
are involved in certain legal proceedings, which, if determined adversely, may adversely affect our business
and financial condition.´EHORZDVZHOODV³Outstanding Litigation and Material Developments´RQSDJH393.
2. Our competitive and growth strategies are subject to execution risks that may impact our business and
prospects.
Our continued success in the future depends on our ability to effectively implement our competitive and growth
strategies. Our inability to manage new or recently begun business ventures, especially where we have limited
or no prior experience, may result in our inability to sustain such business ventures, which may result in a
diminution, loss or write-off of our investment in such ventures or lines of business. For instance, we had
licensed the use of our trade name and provided education soft skills to the Indus World School of Business
which was launched in 2008, in association with the CarHHU /DXQFKHU (GXFDWLRQ )RXQGDWLRQ ³CLEF´ to
provide higher education in management studies. However, the Indus World School of Business ceased
operations in the calendar year 2012, due to global economic conditions, which we believe, resulted in reduced
GHPDQG IRU VXFK PDQDJHPHQW FRXUVHV DV ZHOO DV &/()¶V DQG RXU LQDELOLW\ WR PHHW FHUWDLQ LQIUDVWUXFWXUDO
requirements prescribed by the All India Council for Technical Education. In this regard, we were required to
create provisions for, and write off balances due, in the nature of short term loans and advances recoverable
from CLEF. As on March 31, 2014, our Company had written off accumulated interest on loan granted to
CLEF, aggregating to ` 15.49 million in relation to the infrastructure fee payable to us.
We may also fail to identify new markets and new business opportunities with sufficient growth potential to
grow our business, and we may fail to attract or increase enrolments or to recruit, train and retain qualified
faculty for our test prep centers and Indus World Schools.
Moreover, our strategic expansion plans may not succeed due to various factors, including competition,
operational difficulties, failure to effectively market our new offerings, failure to maintain quality and
consistency or failure to ensure or sustain compliance and due performance of contractual obligations by our
business partners or other service providers. For instance, in our test preparation and training, generally referred
to as test prep segment, we had entered into an agreHPHQWZLWK%ULOOLDQW7XWRULDOV3ULYDWH /LPLWHG³Brilliant
Tutorials´LQ1RYHPEHUWRRSHUDWH(QJLQHHULQJWHVWSUHSFRXUVHVXQGHUWKHEUDQG%ULOOLDQW7XWRULDOVDQG
based on study material provided by Brilliant Tutorials, on a revenue sharing basis. However, we terminated our
relationship with Brilliant Tutorials with effect from October 2012, due to certain operational difficulties in
services provided by Brilliant Tutorials. Our Company and our Directors are presently involved in three
consumer disputes, in which certain students have sought compensation on account of discontinuation of classes
by Brilliant Tutorials. In addition, in the K-12 schools business, the planned expansion of the Indus World
School, Pune was restricted, due to certain unforeseen difficulties in expanding the school land and
infrastructure.
Failure in effectively implementing any of our competitive and growth strategies may have an adverse effect on
our business and prospects.
3. We may be required to enter into strategic partnerships and acquisitions in the future, in relation to
our growth strategy. If we are unable to successfully identify and integrate acquisitions, our growth
strategy and prospects may be adversely affected.
We have in the past relied on inorganic growth as a key part of our growth strategy, including for new business
VHJPHQWVLQFOXGLQJRXUDFTXLVLWLRQRI*.3XEOLFDWLRQV3ULYDWH/LPLWHG³GKP´LQ.HVWRQH,QWHJUDWHG
0DUNHWLQJ 6HUYLFHV 3ULYDWH /LPLWHG ³Kestone´ LQ /DZ 6FKRRO 7XWRULDOV ³LST´ in 2004, Arun Roy
&ODVVHV ³ARC´ LQ DQG .KXUDQD ,QIRUPDWLRQ DQG 7UDLQLQJ 6\VWHPV 3ULYDWH /LPLWHG ³KITS´ LQ
and we may seek to enter into partnerships and identify and complete acquisitions and investments that meet our
strategic and financial return criteria. However, there can be no assurance that we will be able to identify
suitable acquisition or investment targets, arrange adequate financing on commercially reasonable terms for
planned acquisitions or investments, negotiate commercially reasonable terms for strategic partnerships, the
acquisition of, or investment in, target companies or businesses, integrate their operations with our own, and
realize our expectations and strategic objectives from planned investments and acquisitions. We cannot assure
you that our future acquisitions will prove value accretive to us and our shareholders.
We may face several risks in relation to entering into strategic partnerships and acquisitions in the future,
including but not limited to the following:
12
x we may not be able to complete any future strategic acquisitions on commercially acceptable terms;
x our due diligence processes may fail to identify all the problems, liabilities or other shortcomings or
challenges in relation to proposed strategic transactions;
x ZH PD\ IDFH GLIILFXOWLHV LQ LQWHJUDWLQJ DFTXLUHG HQWLWLHV¶ DFFRXQWLQJ PDQDJHPHQW LQIRUPDWLRQ KXPDQ
resource and other administrative systems with our own;
x we may have higher than anticipated costs in relation to proposed strategic transactions;
x we may not be able to achieve the strategic purpose of our proposed acquisitions, investments, alliances,
collaborations or partnerships;
x our management may be distracted or strained by the challenges posed by strategic transactions, or
related transition and integration activities;
x we may be unable to recruit, train and retain sufficient skilled faculty members and other personnel, to
successfully operate our growing business, including new and recent business ventures conducted
pursuant to our strategic acquisitions, investments, alliances, collaborations or partnerships;
x our relationships with our current and new employees, distributors, customers and business partners may
be strained or impaired; and
x we may face litigation, arbitral or other claims in connection with, or may inherit such claims or
liabilities, as a result of any strategic transaction, including claims from erstwhile employees,
distributors, customers, business partners or other third parties.
Any inability to identify suitable acquisition, investment or other strategic growth opportunities or to complete
such transactions on commercially viable terms in the future may adversely affect our competitiveness or
growth prospects.
4. We operate in a significantly fragmented and competitive market and any failure on our part to
effectively compete may adversely affect our profitability and market share.
Competition in each of our business segments, as well as in the education sector as a whole, is generally
fragmented. In particular, we face significant competition from local or regional players in the business
segments and geographical markets in which we operate, and our success depends to a significant extent on our
ability to ensure the continued quality, relevance and innovation of our courses and services.
For instance, in the test prep segment, we believe that we face competition in each of the courses that we offer,
from multiple regional players, in addition to larger players that have wider coverage across India. Large pan-
India players in the market include T.I.M.E., Aakash, IMS, FIIT-JEE and PT Education. There are also other
players, which have a limited geographical scope and spread and do not compete on a pan-India level. In the K-
12 segment, especially in metropolitan and other larger cities and towns in India and among the more affluent
section of society, we believe that we face greater competitive pressures from private schools and educational
institutions (relative to government schools). The vocational training business is generally driven by programs
launched by, and under the aegis of, various State and Central Governments in India in a need-based manner,
wherein contracts are awarded through the tender process, where we face competition from other players
including Aptech, Centum Learning and IL&FS Training. We also conduct recruitment, training and event
management services for corporates and we face competition from other players including from corporates who
may undertake to recruit and train their own staff. While we have, in the past, been awarded a number of
contracts in this segment, we cannot assure you that we will continue to be awarded such contracts. Further, in
the event that our competitors follow a policy of severely under-bidding us in any of our business segments, our
market share and, consequently, our revenues may be adversely affected.
In the publishing and content development business, in addition to competition from traditional print and
publishing companies, we believe that we may also face an increasing level of competition from multimedia
companies that are engaged in developing educational content and providing multimedia products and services
in the education sector. Cengage, Wiley, Pearson, McGraw Hill, Arihant and S. Chand are some of the key
players.
Our test prep and publication and content development businesses also face significant competition from online
content provided through internet websites. Online content is typically available to consumers at a lower cost
than printed books and guides, and is also interactive and user friendly. In particular, the growing urban
population in India with access to the internet may prefer online content over printed material, thereby adversely
affecting our test prep business and sales of titles under the GK Publications brand.
13
)XUWKHU,QGLD¶VJUDGXDOWUDQVLWLRQIURPWKHWUDGLWLRQDOFODVVURRPWHDFKLQJPRGHOWRWKHRQOLQHRUYLUWXDOPRGHO
and related aspirations and requirements to digitize content and to supplement our network of test prep centers
with more innovative new media solutions and technology platforms adds an additional dimension to the
challenges posed to us by the competitive factors shaping the education sector in which we currently operate.
Some of our competitors may have better financial and other resources than we have, or may be able to develop
more effective advertisement and marketing campaigns or better priced or more innovative courses, services and
delivery platforms than us, which may enable them to compete against us more effectively for future
enrollments. These competitive factors may force us to reduce our fees and/or increase our spend in order to
continue to attract student enrolments and to retain and attract faculty members, and to pursue new market
opportunities. Increased competition could result in reduced demand for our products and services, increased
expenses, reduced margins and loss of market share. Failure to compete successfully against current or future
competitors could harm our business, operating cash flows and financial condition.
5. A significant portion of our operating revenues is derived from our test prep business. Failure to
attract students in our test prep business, including due to an unsatisfactory success ratio, may
adversely affect our business and prospects.
Our test prep business constituted 46.48%, 49.54% and 48.82% of our consolidated revenues in fiscal 2014,
2013 and 2012, respectively. Notwithstanding increased diversification of our operations, we currently do, and
expect to continue for the short and medium term future to, depend significantly on our revenues from our test
prep business.
Therefore, we may experience reduction in cash flows and liquidity if the amount of business in this segment is
significantly reduced for any reason. Among other factors, we believe that the satisfactory performance of our
students in various competitive entrance examinations is critical to our brand image and may, in turn, affect our
future enrollments, revenues and profitability. We endeavor to retain the trust placed in us by our students and
their parents, as well as our partners and other third parties, by adopting a results-oriented approach as well as
providing quality course offerings and high service standards for our test prep business and focusing on aptitude
based testing. Among other things, this requires constant upgrades to our pedagogy, course materials and
faculty. However, individual performance in a particular competitive entrance examination determines the rank
and the professional college or institute into which a student receives admission. In addition to the course
content and training provided by us, individual performance depends on various factors unrelated to us,
including personal merit, ability to perform under pressure, and the physical health and mental state of the
student. If our students do not perform well in competitive entrance examinations, a significant opinion shift or
degree of dissatisfaction in relation to any of our courses or services may arise, despite our best efforts and
resources, consequently adversely affecting our brand image, enrollments and future revenues and profitability.
Further, an unsatisfactory success ratio in our test prep business may have a corresponding adverse affect on our
goodwill and reputation across our other business segments, thereby adversely affecting our results of operations
and prospects as a whole.
6. Our inability to cater to and suitably update and enhance the depth of our product offerings may
adversely affect our revenues in the test prep segment as well as our publishing and content
development business.
We are a diversified provider of educational products, services, content and infrastructure, with a presence
across the education value chain. We offer a wide range of test prep courses, assisting students in India for
admission into various undergraduate and graduate professional courses. For instance, as on March 31, 2014, we
had 32,286 enrolments in our MBA courses, followed by 12,138 enrolments in our Civil Services courses, and
9,220 enrolments in our Law courses. Further, under our GK Publications brand, under which we have set up an
in-house content development team and developed an extensive content library, we publish niche test prep
books, guides, mock test papers and question banks for popular professional and entrance examinations,
particularly in Engineering, Bank entrances, GATE and Civil Services. During the year ended March 31, 2014,
we released 945 titles and had sold over 1.1 million copies under the GK Publications brand.
The course structure and content for our course offerings are based on our understanding and experience of past
and prevailing patterns and models of various competitive entrance examinations in India. In the event that there
14
are significant changes in these test patterns and models, and we are unable to suitably adopt, update and
augment our existing course material in line in a timely and cost-effective manner, we may be unable to meet
the expectations of our students and their parents, which may in turn, adversely affect our business, financial
condition, results of operations and prospects, not only in the test prep segment but across all of our other
business segments.
We are also continuing to explore opportunities to increase penetration of our test prep business through
offering an increased number of courses through, and increasing enrolments with, our individual test prep
centers, and to expand our distribution network through setting up greater numbers of new test prep centers as
well as points of sale for our publication and content development business, across India. However, we may
incur substantial costs to expand our course offerings and market reach, including in relation to due diligence,
infrastructure costs, difficulty in recruiting and training faculty members and other personnel or in expanding
our distributor network for our publication and content development business. We cannot guarantee that our
course offerings will be successful, whether due to factors within or outside our control, including general
economic conditions or failure to understand market demand and trends. For instance, if the weightage given to
aptitude-based test results by various educational institutions reduces in favor of other factors, including
knowledge-based testing or other factors, the demand for our existing test prep courses and content offered
through titles published by us under the GK Publications brand may be significantly diminished. In such an
event, if we are unable to realign our course offerings so as to address such emphasis-shifts in competitive test
patterns, our revenues and profitability may be adversely affected, and we may lose or be required to write off a
part of our investment in development and promotion of new course offerings, including, for instance, if we are
required to discontinue certain course offerings and titles entirely or at a significant number of test prep centers
or points of sale, respectively.
Such factors, or any other risks or uncertainties presently unforeseen by us, may have an adverse effect on our
business, financial condition, results of operations and prospects.
7. We operate a majority of our test prep centers through business partners. Any changes in our
relationships with our business partners or non-adherence to prescribed service standards, payment
default or other contractual breaches or irregularities, may adversely affect our business prospects,
financial condition and results of operations.
We have a network of 164 test prep centers, across 73 cities in India, as on March 31, 2014, with 76 owned
centers RI ZKLFK DUH WHPSRUDU\ µ6PDUW &DUHHU &HQWHUV¶ and 88 operated under a partnership model. In
addition, we had two owned test prep centers in UAE. Our business is significantly dependent on our ability to
maintain our relationships and favorable commercial arrangements with existing business partners, as well as
our ability to grow our business through new business partners.
Our business partners are required to, among other things, operate in a specified territory, conduct our specified
courses including all classes, tests and examinations and collect and deposit fees in designated bank accounts at
various locations. Our business partners are also required to obtain our prior written consent for operating in any
other territory and increasing scope of the courses offered. Further, our business partners are required to adhere
to our operating standards, including in relation to appointment of faculty, academic and other staff, equipment,
machinery, furniture and fittings. We also engage in periodic conferences with, and require periodic reporting
(typically including weekly reports as to calendar of programs and capacity utilization) from, our business
partners, as well as retaining rights for inspection and audits of the centers and their assets and records, with a
view to studying capacity utilization, resolving any problems and ensuring uninterrupted functioning of test prep
centers operated by our business partners. In the event we find any such center unfit to operate, our business
partners are obliged to provide alternate arrangements to ensure uninterrupted service. However, we are
restricted in our ability to monitor and control our EXVLQHVV SDUWQHUV¶ daily operations and there can be no
assurance that our business partners will adhere to prescribed service standards and will not misuse our brand or
intellectual property that have been licensed to them, or otherwise defraud us, including by way of under-
reporting enrollments (and, therefore, revenues). We may also be forced to incur additional costs to set up new
partnerships to replace existing partnerships that have to be terminated. While our agreements with our business
partners are terminable at our option on the occurrence of any specified events of default and our business
partners are subject to certain restrictions as to competing business, there can be no assurance that our business
partners will not enter into any competing businesses, or otherwise breach their obligations towards us.
15
In the event that any of our business partners terminates its relationship with us, and joins any of our
competitors or starts independent training centers, leveraging experience gained and while working in
partnership with us or by using our course material, our revenues and business may be adversely affected. In the
past, we have pursued claims against some of our business partners due to their mismanagement or non-
compliance with contractual obligations, including where some of our erstwhile business partners have started
competing businesses. For instance, our Company has initiated arbitration proceedings against C.B. Mor
Agencies Private Limited, a former business partner, and its director Nihit Mor for damage caused to the
goodwill and reputation of our Company, loss caused by starting a similar business in the same premises,
impersonation as study center RI RXU &RPSDQ\ DQG LOOHJDO DQG XQDXWKRUL]HG XVH RI RXU &RPSDQ\¶V VWXG\
material. For more informationVHH³Outstanding Litigation and Material Developments´RQSDJH393.
Any significant adverse changes in our relationships with our business partners may adversely affect the quality,
pricing and variety of the test prep courses that we offer through particular centers or generally across our test
prep business, which may, in turn, adversely affect our business, financial condition, results of operations and
prospects.
8. Recent global economic conditions have been unprecedented and challenging and continue to affect
the Indian job market, in particular with respect to demand for MBA graduates, which may have an
adverse effect on our business, financial condition and prospects.
Recent global and domestic economic conditions have been unprecedented and challenging, with tighter credit
conditions and recession in most major economies, commencing in 2008 and continued into 2011. While the
global economy has recovered to an appreciable extent, the Indian economy continues to grow at a sluggish
pace, and we are unable to predict with any degree of certainty the pace or sustainability of economic recovery.
Continued concerns on the systemic impact of long-term and wide-spread recession, combined with declining
business confidence, have contributed to a decline in global and domestic employment opportunities,
particularly placement opportunities for management graduates in India and worldwide. Similarly, it is possible
that increasing pressures on household incomes, due to employment instability and high inflation, may have
disincentivized some students from pursuing expensive higher education opportunities or, for instance, to seek
placements in the public sector in India due to a perception of higher employment opportunities as well as
greater employment stability in the public sector, as compared to the private sector. We believe that such factors
may have adversely impacted demand for certain of our test prep courses, in particular, MBA test prep courses
(where enrollments have decreased from 39,403 as of March 31, 2013 to 32,286 as of March 31, 2014), which
have historically been, and continue to be our most popular and higher revenue-generating course offerings.
Further, if we are unable to successfully anticipate and respond to changing economic and market conditions in
the future, our business, financial condition and prospects may be adversely affected.
9. We do not, typically, have long term exclusive arrangements with content developers for our test prep
and publication and content development businesses.
While we have an in-house content development team, wherein we own all intellectual property rights in
relation to content generated in-house, we also enter into arrangements with independent content developers on
a job work basis, for our test prep and publication and content development businesses.
Our arrangements with such independent content developers are typically short term and non-exclusive in
nature. Therefore, we may not be able to restrict such content developers from providing their content
development skills and services to our competitors, whether concurrently with their engagement with us or
subsequent to their arrangements with us having been concluded or terminated. Moreover, we may not be able
to effectively enforce against such independent content developers any indemnity or any other form of legal,
contractual or equitable protection from any actual or perceived misuse of skills, experience and materials
acquired by such content developers during their engagement with us, for the benefit of any of our competitors.
In the event that we are required to initiate or defend legal claims against any such content developers, the time
and cost involved in such legal proceedings may be substantial and there is no assurance that any such legal
proceedings will be determined in our favor.
10. Our publication and content development business is subject to several risks, including in relation to
distribution and content development. If any such risks materialize, our business and prospects may be
adversely affected.
16
Pursuant to our acquisition of GK Publications brand, distribution network and content in November 2011, we
publish niche test preparation books, guides, mock test papers and question banks for popular professional and
entrance examinations, particularly in Engineering, GATE, Civil Services and Bank entrances. During the year
ended March 31, 2014, we released 945 titles and had sold over 1.1 million copies under the GK Publications
brand. We have an in-house content development team as well as long term arrangements in place with qualified
content creators with subject expertise (including professors and successful students). Our revenues from our
publication business constituted approximately 8.27%, 7.52% and 3.34% of our consolidated operating revenues
in fiscal 2014, 2013 and 2012, respectively. The publication business exposes us to certain risks inherent to such
business, including as described below:
x We rely on an extensive network of distributors and direct dealers for the sale and circulation of our
publications and as on March 31, 2014, we had a network of over 1,000 dealers and distributors across
various States in India, and our top 10 distributors contributed to 40.19% of our consolidated revenue
from this segment in fiscal 2014. We supply our titles to the distributors and direct dealers as per their
demands, who in turn distribute our publications through a network of book stores who further sell them
to the final customers. Our inability or delay in providing books to distributors and direct dealers could
result in delay or inability to sell our titles to the final retail customers, i.e., to students, thereby
increasing sales returns and inventory.
x Our distributors and direct dealers are retained on a non-exclusive basis and they also distribute
publications for our competitors. If our competitors provide better commissions or incentives to our
distributors and direct dealers, it may result in them favoring our competitors over us. Additionally, in the
event that we are unable to engage distributors and direct dealers on mutually agreeable terms to
distribute and sell our publications, it may significantly disrupt the supply of our publications to our
customers which may in turn lead to a decline in the reach of our publications and adversely affect our
business and financial condition.
x Our readership depends on the quality and price of our publications. We compete in a market
characterized by continual updates in examination and course syllabi and curricula, changes in consumer
demands, product and service introductions and evolving industry standards. Our ability to continue to
successfully develop content is subject to numerous uncertainties, including our ability to anticipate and
successfully respond to such changes in the education sector, as well as to fund new content development
aQG VXFFHVVIXOO\ H[SDQG LQWR QHZ SODWIRUPV $Q\ IDLOXUH WR PHHW RXU FXVWRPHUV¶ UHTXLUHPHQWV
preferences and standards may have an adverse affect on our readership and sales. Further, even despite
high or rising demand for titles such as those published under our GK Publications brand, and
notwithstanding our endeavors to update and enhance the content and quality of our content and
SXEOLFDWLRQV ZH PD\EH VLJQLILFDQWO\LPSDFWHGE\ VWXGHQWV¶SULFH-sensitivity as well as any significant
price competition from our competitors.
x We source paper in relation to our publication business through short term agreements and on a spot basis.
Any escalation in the cost of paper could result in higher costs of raw material and components consumed
by us and adversely affect our financial condition.
x While our publication business is carried out from premises located in Roorkee in the State of
Uttarakhand, we outsource certain printing activities to various third party printers from time to time, on
a job work basis. Any disruption in the operations of these third parties could adversely affect our
business and profitability.
x We generate revenues from advertisements placed in our publications. Ad-spend by our advertisers and
our ability to attract new advertisers is influenced largely by the circulation and readership, the
geographical reach and the preference of advertisers for one media over another. We compete with other
publishers for the share of revenues from advertisers. Changes in market trends could result in our
advertisers demanding price reductions, or changing certain terms of their contracts with us, which may
adversely impact our revenues.
In the event that any of the risks described above, or any other unforeseen risks, should materialize, our
business, results of operations and prospects may be adversely affected, at least to the extent of our exposure
and involvement in the publication and content development business.
17
11. While we are presently not subject to extensive Governmental regulation, due to the increasing
number of institutions, growing market and any negative publicity or otherwise, the Government may
introduce a regulatory framework in the future. Any such Government regulation may adversely affect
our business.
At present, the test prep business and publishing business is not subject to extensive Government regulation, and
providing educational services to K-12 schools in India is regulated through the respective school boards. We
are not in a position to predict whether any legislation will be passed by the governments to regulate these
activities. Any regulation or legislation providing mandatory guidelines regarding functioning, operation,
opening of test prep centres, providing educational services, enrolment of students and chargeable fee may be
introduced. Such guidelines would affect us in the following manner:
(a) Functioning of test prep centres: We may be subject to certain standards for functioning of our test prep
centres which may impose requirements like minimum area for classrooms, basic infrastructure
requirements, non-operation of centres during school timings and inclusion of additional facilities like
medical aid, cafeteria, recreation facility etc. In such circumstances, we may have to either relocate our
centres or we may have to add these facilities by incurring additional cost. These factors may reduce our
ability to operate test prep centres at a location of our choice and may adversely affect our revenues.
(b) Educational services to K-12 schools: We may be required to register our Company with a State
Government for providing educational services. Further, the Government may specifically prescribe the
services that may be outsourced by K-12 schools to companies such as us.
(c) Enrolment of students: We may be subject to restrictions in terms of student enrolments per class. Though
we believe we maintain a healthy student teacher classroom ratio, any further decline in number of
enrolments per classroom would affect our ability to further enrol students, forcing us to add additional
classrooms and faculty to adhere to such requirements.
(d) Fees: We may be subject to restrictions on the fees to be charged from the students.
Such restrictions may adversely affect our business, growth and results of operations.
12. There are several risks associated with the K-12 school business, including in relation to the
regulatory framework and our dependence on third parties. If any of these risks materialize, the K-12
schools business may be adversely affected.
We provide infrastructure, educational services and license our brand name to K-12 schools operating under the
µ,QGXV:RUOG6FKRROV¶EUDQGThe revenue from providing services to K-12 schools accounted for 2.78%, 2.66%
and 5.54% of our consolidated operating revenues as on fiscal 2014, 2013 and 2012, respectively. Certain K-12
schools have received provisional affiliations and certain applications for affiliation are pending with relevant
school boards. The requirements under the Indian industry and regulatory framework including CBSE affiliation
byelaws, has certain implications on the manner in which the K-12 business is structured, which exposes us to
certain risks inherent to such business, including as described below.
Under the current Indian industry and regulatory framework, schools that are affiliated with one of the school
boards are required to be run by a registered society or trust and any profits generated by such schools are
required to be utilized for the operation and promotion of the schools. Accordingly, the Indus World Schools
include two VFKRROVXQGHUWKHµ2ZQHG-InfrastrXFWXUH¶PRGHORSHUDWHGE\WKH1DODQGD)RXQGDWLRQsix schools
XQGHUWKHµ,QIUDVWUXFWXUH3DUWQHUVKLS¶PRGHORSHUDWHGE\WKH1DODQGD)RXQGDWLRQ, other than the Indus World
School in Gurgaon, Haryana, which is a play school and not currently affiliated with any school board, and
therefore operated by certain individualsDQGWZRVFKRROVRSHUDWHGXQGHUWKHµ(GXFDWLRQDO3DUWQHUVKLS¶PRGHO
(operated through the respective school trusts). We do not have control over the functioning of such school
trusts. Therefore, the future success of the K-12 schools business depends on our ability to maintain our strong
relationships and favorable commercial arrangements with, as well as satisfactory performance and compliance
with contractual obligations by, our business partners operating the Indus World Schools under the µ2ZQHG
,QIUDVWUXFWXUH¶µ,QIUDVWUXFWXUH3DUWQHUVKLS¶DQGµ(GXFDWLRQDO3DUWQHUVKLS¶PRGHOV7here are a number of factors
outside our control, which may result in default by a business partner under our agreements with them, including
non-payment of dues. For instance, since fiscal 2012, the two Indus World Schools operated under the
18
µ(GXFDWLRQ 3DUWQHUVKLS¶ PRGHO DW 0DQGL DQG $KPHGQDJDU KDYH QRW EHHQ VKDULQJ FHUWDLQ LQIRUPDWLRQ ZLWK
CLEIS in accordance with their agreements, including updated student lists. As a result, we are unable to verify
the actual amount of fees collected at these schools and, consequently, the revenue payable to CLEIS. To that
extent, we may generate lower levels of income from the services provided to these schools or may not be able
to recover due amounts of income from them. Further, the education partner at Mandi has defaulted on the
specified payment schedule since fiscal 2012, and we may not be able to recover such outstanding amounts from
this school in the future. )RU PRUH LQIRUPDWLRQ VHH ³Outstanding Litigation and Other Material
Developments´RQSDJH393.
8QGHU WKH µ2ZQHG-,QIUDVWUXFWXUH¶ DQG µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ PRGHOV the agreements for providing
educational services, entered into between CLEIS and Nalanda Foundation are for a term of 10 years and can be
terminated mutually by either party giving VL[ PRQWKV¶ notice. These agreements are also terminable at the
option of the non-defaulting party in case there is any material or persistent breach by the other party which is
not rectified within 15 days. Further, the agreements for providing infrastructure, entered into between CLIP and
Nalanda Foundation are for a term of 30 years and can, after the expiry of the term, be terminated by either party
by giving a 30 day notice. These agreements are also terminable at the option of the non-defaulting party in case
there is any material or persistent breach by the other party which is not rectified within 30 days. In relation to
the the Indus World School in Gurgaon, Haryana, the agreement is for a period of 22 and half years, and is
terminable at the option of the non-defaulting party in case there is any material default.
3XUVXDQWWRWKHµ(GXFDWLRQDO3DUWQHUVKLS¶ model, the agreements entered into between CLEIS and the respective
school trust, for licensing of our trademark and brand is for a period of 10 academic years and cannot be
terminated prior to the expiry of such period. However, these agreements may be terminated by either party after
providing a notice of one month in case (i) there is a material breach of the agreement and such breach is not
remedied within 15 days, (ii) the other party becomes incapable of performing its obligations under the
agreement for a period of three months, and (iii) the other becomes insolvent.
Any termination or inability to renew these agreements, may adversely affect our cash flows, financial condition
and results of operation.
Moreover, while our contracts with business partners include safeguards such as indemnities in the event that
any of our business partners terminates its relationship with us and starts any competing businesses or leverages
its experience gained while working in partnership with us or in case of any other contractual breach or a failure
by any of our partners in honoring contractual obligations towards us, the K-12 schools business and prospects
may be adversely affected. Further, there can be no assurance that there will not be any future change in the
Indian industry, policy and regulatory framework, pursuant to which the manner in which the trust structures
through which the K-12 schools business are presently operated may be required to be significantly modified.
We may be forced to incur significant additional costs to enter into arrangements with new business partners so
as to continue to comply with the Indian industry and regulatory framework and/or to initiate or defend our
claims in legal or arbitration proceedings that we may become involved with, with any erstwhile business
partners in relation to the Indus World Schools.
K-12 schools are also required, among other things, to have a certain minimum land area and infrastructure, and
teaching and non-teaching staff as per prescribed criteria, due to which the operation of schools in India is an
inherently capital intensive and asset-heavy business. The infrastructure for the Indus World Schools (including
land, building, furniture, fixtures, computers, laboratory equipment, etc.) is provided to the trust operating the
schools by our Subsidiary, &DUHHU/DXQFKHU,QIUDVWUXFWXUH3ULYDWH/LPLWHG³CLIP´, for schools operated under
WKHµ2ZQHG-,QIUDVWUXFWXUH¶PRGHO)RUVFKRROV RSHUDWHGWKURXJKWKHµ,QIUDVWUXFWXUH3DUWQHUVKLS¶PRGHOODQGDQG
building is leased from our infrastructure partner while we provide the other infrastructure (furniture, fixtures,
computers, laboratory equipment, etc.) by the trusts operating the schools, other than the Indus World School in
Gurgaon, Haryana, which is operated by certain individuals )RU VFKRROV RSHUDWHG WKURXJK WKH µ(GXFDWLRQDO
3DUWQHUVKLS¶PRGHOWKHVFKRROODQGDQGLQIUDVWUXFWXUHLVRZQHGRUOHDVHGE\WKHUHVSHFWLYHWKLUG-party trusts and
is not under our direct control. To the extent that we, through our Subsidiaries, are responsible for providing the
land and/or infrastructure, we have significant working capital requirements as well as face associated risks and
uncertainties in relation to the acquisition, maintenance and disposition of such assets.
K-12 schools are required to provide free and compulsory education to children in India of the ages six to 14
years pursuant to the Right of Children to Free and Compulsory Education Act ³Right to Education
Act´The schools are required to admit, to the extent of at least 25% of the strength of the class, children from
19
the weaker and disadvantaged section of society in the neighborhood, and to provide free and compulsory
elementary education to such students. Under the current regulatory framework in India costs in relation to such
students, are required to be reimbursed by the relevant Governmental authorities. However, the K-12 schools
operating under the Indus World Schools brand, have not yet been able to recover any such dues from the
relevant Government authorities in the past. In the event that the Indus World Schools are not able to recover
costs in this regard, or in the event of any significant increase in the number of students required to be enrolled
pursuant to the Right to Education Act, the trusts operating the Indus World Schools may not be able to increase
school fees to cover such increased costs of running the Indus World Schools.
The success of the Indus World Schools will depend on the success record of the students. The satisfactory
SHUIRUPDQFH RI ,QGXV :RUOG 6FKRRO VWXGHQWV LQ WKH µ$OO ,QGLD 6HFRQGDU\ 6FKRRO ([DPLQDWLRQ¶ IRU *UDGH ;
HTXLYDOHQWWRµ2¶OHYHOLQRWKHUMXULVGLFWLRQVWKHµ$OO,QGLD6HQLRU6FKRRO &HUWLILFDWH([DPLQDWLRQ¶IRU*UDGH
;,,HTXLYDOHQWWRµ$¶OHYHOLQRWKHUMXULVGLFWLRQVDQGWKHLUVXEVHTXHQWHQUROPHQWLQUHSXWHGKLJKHUHGXFDWLRQDO
institutions will be critical to the brand image and market reputation of the Indus World Schools.
In the event that any of the risks described above, or any other unforeseen risks, should materialize, our
business, results of operations and prospects may be adversely affected, to the extent of our exposure and
involvement in the K-12 schools segment.
13. We are currently involved in litigation with a former business partner, in relation to a school formerly
operated under the brand Indus World Schools, which, if determined against us, may have a material
adverse effect on our reputation, business and prospects.
We, through our Subsidiary &DUHHU /DXQFKHU (GXFDWLRQ ,QIUDVWUXFWXUH DQG 6HUYLFHV /LPLWHG ³CLEIS´, are
currently involved in a civil suit in the court of the III Additional District and Sessions Judge at Ranga Reddy
District at L.B. Nagar, Andhra Pradesh, wherein Sri Lakshmi Saraswathi Educational Society has sought, among
other things, to restrain interference by us in their use of the brand name Indus World School. In our
counterclaim, CLEIS has sought, among other things, payment of a sum of ` 13.29 million with interest until the
date of payment as well as rendering of true and correct accounts for the school for fiscal 2014, in relation to
which the court may direct any further payment due to be made to us. The plaintiff is a charitable society with
which CLEF ± AP had entered into an agreement in April 2007 to transfer the assets and liabilities of the school
from CLEF - AP Trust to the plaintiff, and CLEIS had entered into an agreement granting the plaintiff a five-
year non-exclusive licence to use the Indus World School trademark and our educational soft skills, to operate
the school under the Indus World School brand for this period. In relation to the expiration of the licence period
in April 2012, we had sent several communications to the plaintiff, requesting, among other things, renewal of
the licence agreement and settlement of unpaid royalties and other dues for services provided to the plaintiff by
CLEIS under the licence agreement. During the ongoing communication between the parties in relation to the
amount due to CLEIS, the plaintiff initiated this legal proceeding, which we are continuing to contest as on the
date of this Draft Red Herring Prospectus. CLEIS had also filed an interim application, challenging the
jurisdiction of the III Additional District and Sessions Judge, Ranga Reddy District at L. B, Nagar, Andhra
Pradesh to try this suit. The III Additional District and Sessions Judge dismissed this application in November
2013. CLEIS has filed a revision petition in the High Court of Andhra Pradesh, seeking stay on further
proceedings in this civil suit.
In the event of adverse rulings LQWKHVHSURFHHGLQJV ZH PD\EH UHVWUDLQHGIURPXVLQJWKH EUDQGQDPH µ,QGXV
:RUOG6FKRRO¶XQDEOHWRUHFRYHURXUGXHVLQUHODWLRQWRWKLV school and our reputation, business and prospects
may be adversely affected.
14. The use of the Indus World School name and logo has been challenged by certain third parties. Any
inability on the part of our licensees to continue to use this brand, including due to competing claims
by other parties in this relation, may adversely affect our business and prospects.
Typically, the registration of a trademark or other intellectual property right in India involves a certain period of
time, which may be lengthened or made difficult or impossible to predict with any degree of certainty, in the
event of oppositions being filed by third parties in relation to our use of, and right to, such trademarks or other
intellectual property. For instance, our Subsidiary CLIP had filed an application in August 2006, which is
pending as on the date of filing this Draft Red Herring Prospectus, with the Trademark Registry for registration
of the Indus World School name and logo (to which certain third parties have filed objections).
20
There can be no assurance that the registration of trademarks applied for by us will be granted in our name,
within a reasonable time or at all. Moreover, there can be no assurance that any other third parties in competing
or similar businesses will not also challenge our use of the brand Indus World Schools in the future, or that any
such legal or administrative proceedings that we may become involved in, in relation to defending or enforcing
our claims, will be determined in our favor, within a reasonable time or at all. In the event that such proceedings
are not finally determined in our favor, or if the final determination of such proceedings takes a significant
period of time (particularly, if we are not granted any injunctive relief or other interim relief that may be sought
by us, pending final determination of such matters), our ability to use the Indus World School brand may be
impaired and may consequently affect our business and prospects. We may also incur significant legal and
administrative costs to defend and process our claims in this relation, and we may not be able to recover from
any third parties all or any part of the sums that we have claimed, or that we may claim, are due to us.
)RU PRUH LQIRUPDWLRQ VHH ³Government and Other Approvals´ DQG ³Outstanding Litigation and Material
Developments´RQSDJHV406 and 393, respectively.
15. Our vocational training business is subject to several risks, including being fixed price contracts,
which could result in cost overruns and payment delays from our partnerships with the Central and
State Governments, which may adversely affect our business, financial condition and results of
operations.
Our vocational training business is conducted through partnerships with the Central and State Governments to
implement placement-linked vocational training and livelihood skills programs, under project tenders, for
employment in sectors and areas including retail and sales management, data entry, hospitality, computer
hardware, automotive repair, refrigeration and air conditioning, as well as recruitment, training and event
management services for corporates. Revenue from our vocational training programs as well as recruitment,
training and event management services for corporates, aggregated to ` 896.70 million, ` 773.94 million and `
674.78 million, for fiscal 2014, 2013 and 2012, respectively. In the vocational training segment, we had an
aggregate of 8,233 enrolments in our vocational training programs implemented by us under project tenders
issued by the Central and various State Governments, during fiscal 2014, across the States of Gujarat, Rajasthan,
Jharkhand, Chhattisgarh, Madhya Pradesh and Uttar Pradesh. The training programs are funded by grants-in-aid
by the relevant Central or State Governments and a separate Government nominated agency is made responsible
for program coordination, including ensuring that project funds released by the Government are used only for
the sanctioned project. We, as the implementation agency, are reimbursed for costs and expenses incurred by us
in relation to the implementation of such projects, typically in a phased manner, subject to our meeting certain
specified training and placement targets. While this business is carried out by implementation agencies on a cost
basis, the administrative costs of the projects are permitted to be shared. Payments from the Central and State
Governments may be, and have been, subject to several delays, and have been received after a period of between
9-12 months, due to regulatory scrutiny and long procedural formalities, including any audit by the Comptroller
and Auditor General of India. If payments under our contracts with Central and State Governments in the
vocational training segment are delayed, our working capital requirements would be adversely affected,
resulting in additional finance costs and increase in our realization cycle. Further, any change in Central or State
Governments may result in a change in policy and reassessment of the existing contracts. Any change in the
terms of conditions of existing or future contract may result in rendering all or some projects unviable, which
may, in turn, result in reduction of our revenues from this segment. The agreements with the Central and State
Governments and various government agencies generally require us to ensure that a certain number of students
are provided employment pursuant to our livelihood skills training. In the event that we fail to ensure placement
or employment of students enrolled in our vocational training programs, the relevant Government agencies may
be entitled to not pay us the balance amount payable to us under such contracts. Further, poor placement ratios
of students of our vocational training programs may have an adverse impact on our reputation, which, in turn,
may hinder us in our efforts to increase partnerships with Central and State Governments in order to expand our
vocational training business.
We also provide vocational training for private enterprises and provide pre-hire training of employees based on
the recruitment requirements of private enterprises through Kestone, which we believe, enables us to build
relationships with corporates and drives our placement programs for our vocational training students. The
programs are typically reassessed on a periodic basis and such private enterprises may choose to discontinue or
reduce the scale of such recruitment programs in the future. Further, poor performances of such students in our
pre-hire skills programs may result in them not obtaining employment with these private entities, which, in turn
may have an adverse impact on our reputation, business and financial condition.
21
16. Our sustained growth depends on our ability to retain core members of our management team as well
as qualified and experienced faculty members. Our inability to continue to retain, recruit and train
suitable personnel may adversely affect our business.
We believe that we operate in an industry where the quality of our people is a critical asset. We believe that we
benefit significantly from the vision, strategic guidance, experience and skills of several key members of our
management team, including our individual Promoters and Founders, Satya Narayanan .R, Gautam Puri, Nikhil
Mahajan, R. Shiva Kumar, Sreenivasan .R, and Sujit Bhattacharyya. As on March 31, 2014, our Company had
362 employees, of whom 358 employees are postgraduates or professionals such as chartered accountants and
company secretaries or who have obtained educational degrees; and including a large pool of faculty of 84
instructors for our test prep business. We also have an in-house content development team of 60 members with
domain and subject expertise of which 56 are employees of CL Media. Our success has been dependent, and
will continue to depend, largely on the skills, efforts, expertise, continued performance and motivation of our
individual Promoters, some of who are also our whole-time directors, our management, faculty, content
developers and experts who have significant experience within our industry. In the event that any of our
individual Promoters, whole-time directors, senior management and key personnel ceases to be associated with
our Company and we fail to recruit suitable replacements in a timely manner or at all, our ability to manage our
growth and our business and operations may be adversely affected. For more information VHH ³Our
Management´RQSDJH144.
Further, our sustained growth depends on our ability to attract and retain highly-qualified professionals in the
education sector, including faculty, content developers for our publications business, trainers for our vocational
training business and senior management. We face significant competition in attracting and retaining personnel
who possess the skill sets that we seek. In addition, our personnel may join competing businesses. Our faculty
members and subject experts may also enter into competing businesses. There have been instances in the past
where our disassociated faculty members have started competing businesses under independent labels that are in
direct competition to our business.
We also conduct continuous training programmes including refresher guidance programmes for our faculty
members throughout the year on teaching subjects as well as personality development, attitude development and
soft skills such as presentation and communication skills, leadership skills and time management. These training
sessions also involve training on teaching methodologies and communication skills in order to equip our faculty
PHPEHUV WR DGDSW WR RXU VWXGHQWV¶ FKDQJLQJ QHHGV LQ WKH FRPSHWLWLYH HQYLURQPHQW DQG FKDQJLQJ H[DPLQDWLRQ
trends, academic syllabi and increasing career options. We incur significant costs towards these training
programmes, and our inability to provide adequate training in a cost effective manner, could adversely affect our
business.
Our inability to recruit and retain skilled personnel on a long-term basis may affect our business and
profitability.
17. A failure to comply with financial and other restrictive covenants imposed on us under our financing
agreements may cause us to default on these agreements, which may adversely affect our ability to
conduct our business and operations.
As on August 31, 2014, our total borrowings amounted to ` 572.45 million, on a consolidated basis.
x a portion of our cash flow will be used towards repayment of debt, which will reduce the availability of cash
to fund working capital requirements, capital expenditures and other general corporate purposes;
x our borrowing cost and the existence of encumbrances on a significant portion of our immovable properties
may constrain our ability to raise incremental financing in the future, at commercially reasonable terms. For
instance, certain of our properties, including the property where our corporate office premises are located,
are mortgaged in favor of one of our lenders, in connection with our secured borrowings. In the event of
enforcement of an event of default in connection with such secured borrowings (which is not waived or
cured), our ability to continue to operate our business at such locations may be restricted; and
22
x fluctuations in interest rates may affect our cost of borrowing, as all or a substantial part of our borrowings is
at floating rates of interest.
In particular, our financing agreements require us to obtain the consent of, or to intimate, our lenders for certain
actions including effecting any change in shareholding or directorship of our Company, raising further loans or
implementing a new scheme of expansion or taking up an allied line of business or manufacture, issuance of
guarantees, extending loans to our Subsidiaries when money remains due to the lenders, and for certain
corporate actions including making any alterations to our Memorandum and Articles of Association.
Our failure to comply with financial or restrictive covenants or periodic reporting requirements or to obtain our
OHQGHUV¶FRQVHQWWRWDNHUHVWULFWHGDFWLRQVLQDWLPHO\PDQQHURUDWDOOPD\UHVXOWLQWKHGHFODUDWLRQRIDQHYHQWof
default by one or more of our current or future lenders, which may accelerate repayment of the relevant loans or
increase applicable interest rates or trigger cross-defaults under other financing agreements. An event of default
may also affect our ability to raise additional funds or renew maturing borrowings to finance our existing
operations and pursue our growth initiatives. The termination of, or declaration or enforcement of default under,
any current or future financing agreement (if not waived or cured) may have an adverse effect on our business,
financial condition, results of operations and prospects.
18. We, our Directors, and Promoters are involved in certain legal proceedings, which, if determined
adversely, may adversely affect our business and financial condition.
We, our Directors, and Promoters are involved in certain legal proceedings (including income, sales and service
tax and commercial disputes) at different levels of adjudication before various courts, tribunals and appellate
authorities. In the event of adverse rulings in these proceedings or consequent levy of penalties by other
statutory authorities, we, our Directors, or Promoters may need to make payments or make provisions for future
payments, which may increase expenses and current or contingent liabilities and also adversely affect our
reputation.
A summary of the proceedings involving our Company, Directors, Subsidiaries and Promoters including the
aggregate approximate amount involved to the extent ascertainable, is provided below:
(` in million)
No. of outstanding Aggregate approximate amount
S. No. Nature of the litigation
litigation involved
Litigation against our Company
1. Direct tax 12 852.23
2. Indirect tax 6 276.54
3. Civil proceedings 3 1.57
4. Consumer complaints 1 0.13
(` in million)
No. of outstanding Aggregate approximate amount
S. No. Nature of the litigation
litigation involved
Litigation by our Subsidiaries
1. Civil proceedings 3 1.73
2. Criminal proceedings 1 0.05
23
Litigation involving our Directors
(` in million)
No. of outstanding Aggregate approximate amount
S. No. Nature of the litigation
litigation involved
Litigation against Mr. Satya Narayanan .R
1. Civil proceedings 1 0.08
2. Consumer complaint 1 0.08
Litigation against Mr. Nikhil Mahajan
1. Civil proceedings 1 1.46
Litigation against Mr. Gautam Puri
1. Criminal proceedings 1 Not ascertainable
2. Consumer Complaints 1 0.62
Other than as stated above, none of our Promoters are involved in any litigation.
19. We have entered, and expect to continue to enter, into related party transactions, which may involve
conflicts of interest.
We have in the past entered, and expect to continue to enter, into transactions with certain related parties in the
ordinary course of our business, including due to the industry and regulatory framework in which we operate
(which, for instance, requires the Indus World Schools to be operated through the respective school trusts).
While, in our view, all such related party transactions that we have entered into are legitimate business
transactiRQVFRQGXFWHGRQDQDUPV¶OHQJWKEDVLVDQGJRLQJIRUZDUGDOOUHODWHGSDUW\WUDQVDFWLRQVWKDWZHPD\
enter into will be subject to board or shareholder approval, as necessary under the Companies Act, 2013 and the
Equity Listing Agreements that we will enter into with the Stock Exchanges, we cannot assure you that our
historic or any future related party transactions that we may enter into, individually or in the aggregate, will not
have an adverse effect on our business, financial condition, results of operations and prospects. For instance, in
fiscal 2014, our Company extended short term loans and advances to Career Launcher Education Foundation
and Nalanda Foundation of ` 132.11 million and ` 273.08 million, respectively and received interest on loans
and advances from Nalanda Foundation of ` 32.28 million. In the event such loans and advances are not repaid
to us, our business and financial condition may be adversely affected.
Further, in the past, we have been required to create provisions for, and write off balances due, in the nature of
short term loans and advances recoverable from CLEF, including on account of the cessation of operations of
the Indus World School of Business in the calendar year 2012, in view of the discontinuation of the affiliation of
this business school with the Pondicherry University. As on March 31, 2014, our Company had written off
accumulated interest on loan granted to CLEF, aggregating to ` 15.49 million in relation to the infrastructure fee
payable to us.
20. Our business is linked to the academic cycle and is, therefore, cyclical in nature. Accordingly, quarter-
to-quarter comparisons of our enrolments and cash flows may not be meaningful.
Our test prep as well as publication and content development businesses are closely linked to the academic cycle
and the timing of competitive entrance examinations for admission to various professional institutions. For
instance, the Common Admission Test ³CAT´ IRU HQWUDQFH WR ,,0V LV W\SLFDOO\ KHOG GXULQJ 2FWREHU DQG
November of each year, and the Common Law Admission Test is typically held in the month of April or May of
each year. Accordingly, our enrolments and cash flows during the third fiscal quarter have typically been lower,
compared to other fiscal quarters. As a result of such factors, our quarter-on-quarter data regarding enrolments
and cash flows may not be comparable or provide a meaningful indicator of our enrolments and revenues for
any other or future fiscal quarters or periods.
21. The study material prepared by us may be plagiarized which may have an adverse effect on our
business.
24
The study material provided to our students is prepared after resource consuming analysis and research by our
in-house content development team. This material is available to our students and we neither have any system
nor mechanism to track the sale of such study materials in open markets nor can we effectively restrict
duplication of the material. As a result, the study material may be easily availed, copied and distributed by third
parties which may adversely affect our business and profitability.
22. Our management will have broad discretion in how we apply the Net Proceeds, including interim use
of the Net Proceeds, and there is no assurance that the Objects of the Offer will be achieved within the
time frame expected or at all, or that the deployment of the Net Proceeds in the manner intended by us
will result in any increase in the value of your investment.
:H LQWHQG WR XVH WKH 1HW 3URFHHGV IRU WKH SXUSRVHV GHVFULEHG XQGHU ³Objects of the Offer´ RQ SDJH 81. The
Objects of the Offer include funding expansion of certain Indus World Schools, repayment of a debt facility
availed of by CLIP, funding working capital requirements, investment in GKP for meeting working capital, and
funding expenditure for general corporate purposes. Our funding requirements and the deployment of the Net
Proceeds are based on management estimates and have not been independently appraised and will not be
monitored by any bank, financial institution or other independent agency. Further, we have not entered into any
definitive agreements or arrangements in relation to funding expansion of certain Indus World Schools or for
general corporate purposes.
In response to the dynamic nature of our business, our management will have broad discretion to revise our
business plans, estimates and budgets from time to time. Consequently, our funding requirements and
deployment of funds may change, which may result in rescheduling of the proposed utilization of the Net
Proceeds and increasing or decreasing expenditure for a particular activity, subject to compliance with
applicable law and the investment policies approved by our management, including Section 27 of the
Companies Act, 2013, pursuant to which, any variation in the objects would require a special resolution of the
shareholders and the promoter or controlling shareholders will be required to provide an exit opportunity to the
shareholders who do not agree to such proposal to vary the Objects in accordance with the Articles of
Association of the Company and as may otherwise be prescribed by SEBI.
In the case of increase in actual expenses or shortfall in requisite funds, additional funds for a particular activity
will be met by means available to us, including internal accruals and additional equity and/or debt arrangements.
If actual utilization towards the Objects is lower than the proposed deployment, such balance will be used for
future growth opportunities, including funding other existing Objects, if required, and general corporate
purposes. If estimated utilization of the Net Proceeds is not completely met in a fiscal year, it shall be carried
forward.
Further, our management will have significant flexibility in temporarily investing the Net Proceeds and there
can be no assurance that we will earn significant interest income on, or that we will not suffer unanticipated
diminution in the value of, such temporary investments.
23. We may not be able to adequately protect our intellectual property and proprietary information.
The content and study material we provide to our test prep students, as well as titles published under the GK
Publications brand, are prepared after research and analysis by our in-house content development team.
However, due to the standardized nature of study material for standardized tests as well as annual or periodic
revisions in test patterns and curricula, it may not be possible or feasible in many instances for us to obtain
copyright registration for such content. While registration is not mandatory in India for protection of intellectual
property, registration is prima facie evidence for the subsistence of intellectual property rights, and we currently
rely on common law copyright protection rather than registration for our copyrights. Furthermore, we do not
have a system or mechanism to effectively track the sale of study material in the open market, nor can we
effectively restrict duplication or plagiarism of our content.
In the event that a dispute arises in the future with respect to any of our intellectual property rights or proprietary
information, we will be required to produce evidence to defend or enforce our claims. Our efforts to protect our
intellectual property or proprietary information may not be adequate to detect or prevent infringement,
misappropriation, or unauthorized use, or to take appropriate steps to enforce our rights. The misappropriation
or duplication of our intellectual property may disrupt our business, distract management and employees, reduce
revenues and increase expenses, or we may be subject to infringement claims. In the future, litigation may be
25
necessary to defend or enforce our rights or to determine the scope and validity and scope of rights of others.
Even if claims against us are not meritorious, any such legal, arbitral or administrative proceedings may be time-
consuming and costly, and there is no assurance that such proceedings will be ultimately determined in our
favor.
24. The success of our online and offline technology-enhanced delivery modes significantly depends on
the usability and acceptability of such technology platforms and applications, particularly among
students in the test prep segment, and our ability to continue to successfully implement and adapt to
technological advances.
In our test prep business, we supplement our classroom teaching with modern scalable technology including
content and interfaces accessible through our website, as well as teaching conducted through video conferencing
or through remote satellite technologies such as voice/video over internet protocol technolog\³VOIP´92,3
enables students to participate in live classroom sessions from remote locations through two-way video and
voice technology. We intend to continue to develop and use innovative and technology-enhanced platforms as
well as new media initiatives to target students from the growing and increasingly mobile Indian middle class
with rising household incomes, and, accordingly, to cross-leverage our online and offline delivery modes to
increase capacity utilization at each of our individual centers, including centers that have been recently set up or
that have recently expanded their portfolio of course offerings.
The success of our online and technology-HQKDQFHG GHOLYHU\ PRGHV LV VLJQLILFDQWO\ GHSHQGHQW RQ VWXGHQWV¶
access to internet and the accessibility of our technology platforms and applications. Internet penetration in
India is relatively low, and there can be no assurance that internet penetration will increase significantly in the
immediate future, which may diminish the impact of our online and technology-enhanced delivery platforms
and applications, and exacerbate our reliance on traditional classroom teaching methods.
Further, information technology is characterized by rapidity in new product and service introductions, evolving
industry standards and user preferences, and consequent obsolescence of current technology. We may not be
able to maintain or replace our existing systems or to introduce new technologies and systems as quickly as our
competitors in a cost effective manner, or at all. If we face material delays in introducing new technology-
enhanced solutions, our students may forego our courses and services in favor of those of our competitors. The
costs of acquiring, developing and maintaining new technologies and systems in the future may also be
significant.
25. We rely on information technology to operate our business. Any disruption in our information
technology systems may adversely affect our business.
We rely on information technology systems to operate significant aspects of our business. We rely heavily on
our information technology systems in connection with student enrollments and identification, accounting,
distribution in our publication and content development business and the general running of our day-to-day
business. As our operations grow, both in size and scope, we must continuously improve and upgrade our
systems and infrastructure, while maintaining the reliability and integrity of our systems and infrastructure in a
cost-effective manner.
While we have backup systems and contingency plans for critical aspects of our operations or business
processes, certain other non-critical systems are not fully redundant and our disaster recovery or business
continuity planning may not be sufficient. Fires, floods, power outages, telecommunications failures,
earthquakes, acts of war or terrorism, acts of God, computer viruses, sabotage, break-ins and electronic intrusion
attempts from both external and internal sources and similar events or disruptions may damage, impact or
interrupt our computer or communications systems, business processes or infrastructure at any time. Although
we have put measures in place to protect certain portions of our information technology, any of these events
may cause system interruptions, delays and loss of critical data, and may prevent us from operating some or all
our business for a significant period of time. Remediation may be costly and we may not have adequate
insurance to cover such costs.
26
Our ability to disseminate data using the internet in a secure and efficient manner is dependent on our
information technology systems. Technical failure of our hardware or software, breakdowns in the services on
ZKLFK RXU ZHEVLWH LV KRVWHG FKDQJHV LQ RXU WHFKQLFDO V\VWHPV GLIILFXOWLHV LQ OLQNDJHV ZLWK RXU VWXGHQWV¶
systems, any corruption or loss of our electronically stored data, presence of computer viruses or disruption in
internet infrastructure or internet access including due to adverse weather conditions, may lead to interruptions
in the functioning of our website and may result in corruption of our data or security breaches. Disruptions in
telecommunications and in the functioning of network service providers for this aspect of our business may lead
WRVWXGHQWV¶GLVVDWLVIDFWLRQDQGGDPDJHRXUUHSXWDWLRQ$Q\IDLOXUHLQRXULQIRUPDWLRQWHFKQRORJ\V\VWHPVFRXOG
result in business interruption, adversely impacting our reputation and could have an adverse effect on our
financial condition and results of operations.
26. Our net income would decrease if we are unable to avail of certain tax benefits in the future.
We print and publish books, guides and question banks under the GK Publications brand, through our
6XEVLGLDU\ &/ 0HGLD 3ULYDWH /LPLWHG ³CL Media´ IURP SUHPLVHV ORFDWHG LQ 5RRUNHH LQ WKH 6WDWH RI
Uttarakhand. In accordance with and subject to the condition specified in Section 80-IC of the Income Tax Act,
³IT Act´RXUSXEOLFDWLRQEXVLQHVVZRXOGZLWKUHVSHFWWRWKHFRPSXWDWLRQRIJURVVWRWDOLQFRPHVXEMHFW
to be taxed, be entitled to deduction of 100% of profits derived from the printing and publication for the first
five consecutive assessment years and 30% for the next five assessment years, beginning from the year in which
we commenced such business, being fiscal 2012. If such tax benefits become unavailable, our business,
financial condition and results of operations could be materially and adversely affected.
27. Most of the immovable properties used by us directly or through our business partners are leased. If
we or our business partners are unable to renew existing leases or relocate operations on
commercially reasonable terms, there may be an adverse effect on our business, financial condition
and operations.
We, as well as our business partners, do not own all the premises from where we operate. We typically enter
into short-term leases which are renewable every year. Periodic renewals of short-term leases may increase our
costs, since they are subject to rent escalation.
We have a network of 164 test prep centers in 73 cities in India as on March 31, 2014, with 76 owned centers
RIZKLFKDUHWHPSRUDU\µ6PDUW&DUHHU&HQWHUV¶, of which most are operated from leased premises; and 88
are operated under a partnership model, where our respective business partners are responsible for leasing,
licensing or otherwise obtaining the right to enter on and use such premises. Further, pursuant to Indian
regulatory requirements and industry norms, the K-12 schools are operated by the respective school trusts and,
LQ WKH FDVH RI WKH ,QGXV :RUOG 6FKRROV RSHUDWHG XQGHU WKH µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ DQG µ(GXFDWLRQDO
3DUWQHUVKLS¶ PRGHOV WKH VFKRRO ODQG DQG EXLOGLQJV Dre provided for by our respective partners. In addition,
norms regulating the affiliation of K-12 schools with various educational boards in India, such as the CBSE,
require that in the event that school premises are leasehold, such leases must remain valid for a prescribed
minimum period, typically for thirty years.
Certain of our premises, including our Registered Office are leased by us. If we are unable to renew the
agreements pursuant to which we occupy the premises on terms and conditions that are acceptable to us, or at
all, we may have to relocate our Registered Office.
Any failure or difficulty faced by us or by any of our business partners in renewing lease arrangements or any
disputes or other problems that we or our business partners may face in the future with the respective lessees
may adversely affect our distribution network, business and prospects, particularly in the event that any of the
trusts operating the Indus World Schools are unable to maintain CBSE or other relevant affiliation with the
relevant educational board, or in the event that any of our business partners are required to close down the test
prep centers being operated by them, or if we are required to resort to litigation or administrative proceedings to
enforce or defend our contractual claims under any lease agreements or agreements with business partners.
28. We have experienced negative cash flows from operating activities and investing activities in the past.
Any negative cash flows from operating activities and investing activities in the future could adversely
affect our results of operations and financial condition.
27
For fiscal 2012 we had a negative cash flow from operating activities of ` 193.01 million. Further, we had
negative cash flows from investing activities for fiscal 2014, 2013, 2012, 2011 and 2010 of ` 11.25 million, `
47.42 million, ` 50.70 million, ` 504.11 million and ` 228.56 million, respectively. Any negative cash flows
from operating and investing activities in future would adversely affect our results of operations and financial
condition.
6HH ³Management's Discussion and Analysis of Financial Condition and Results of Operations´ and
³Financial Information´RQSDJHV359 and 167, respectively.
29. Failure to obtain or renew necessary regulatory approvals by us, or by our business partners, may
adversely affect our business and financial condition.
We are required to obtain various regulatory and other approvals and registrations for our operations, including
VKRSV DQG FRPPHUFLDO HVWDEOLVKPHQWV¶ UHJLVWUDWLRQV IRU WHVW SUHS FHQWHUV RSHUDWHG E\ XV GLUHFWO\ DQG
registrations with the relevant tax and labour authorities, which are required to be renewed from time to time.
Further, we have registered trademarks in relation to our business with the Registrar of Trademarks.
As on the date of this Draft Red Herring Prospectus, we are yet to apply for registration of one owned test prep
center for shops and establishments, and the following applications in relation to registration of trademarks are
pending.
In addition, our Subsidiary, CLIP, has applied for registration of the WUDGHPDUNVµAnanda ± WKHMR\RIOHDUQLQJ¶
DQGµIndus World School ± know thyself¶LQFODVVHVDQGRQ$XJXVW
Under the terms of our agreements with our business partners for test prep centers, our business partners are
required to obtain necessary regulatory and other approvals and registrations, including shops and commercial
HVWDEOLVKPHQWV¶UHJLVWUDWLRQV8QGHU the terms of our agreements for K-12 schools, Nalanda Foundation and the
other trusts operating our schools are required to obtain and maintain regulatory and other approvals and
registrations, including affiliation with school boards such as the CBSE. Further, our dealers and distributors for
our publishing and content development business, conducted under the GK Publications brand, are required to
obtain necessary regulatory and other approvals and registrations, including shops and commercial
establishmHQWV¶ UHJLVWUDWLRQV ZKLOH WKH SULQWHUV WKURXJK ZKLFK RXU WLWOHV DUH SULQWHG IRU WKH *. 3XEOLFDWLRQV
brand are required to obtain necessary regulatory and other approvals and registrations to establish and operate
their printing presses and other facilities. While we obtain standard indemnities and other contractual protections
against any risks arising in relation to regulatory and other approvals required to be obtained by our respective
business partners, we do not have direct control over any such entities and we may not be able to ensure their
receipt of and compliance with any such required regulatory and other approvals and registrations.
28
Any failure by us, or by any of our business partners, to obtain and maintain any required approvals and
registrations may have an adverse effect on our business, financial condition, results of operations and
prospects, including on our brand image and reputation. A suspension, cancellation or refusal to extend required
approvals and registrations may require us to cease operations at some of our centers, schools or other facilities
or operations. Moreover, any actual or alleged breach or non-compliance with any specified conditions under
such approvals and registrations may result in investigation as well as the suspension, withdrawal or termination
of such approvals and registrations or the imposition of penalties by the relevant authorities which could have a
material adverse affect on our business and operations.
30. Any secured and unsecured loans drawn by our Company, Promoters, Group Entities and associates
in the future, may be recalled by the lenders at any time, which may lead to default in terms of such
financing agreements.
Our future secured working capital loans and our unsecured loans (as well as any future loans taken by our
Promoters, Group Entities or associates) may be recalled by the respective lenders at any time. Any failure to
service such indebtedness, comply with a requirement to obtain lender consent, or otherwise perform any
obligations under such financing agreements may lead to a termination of one or more of our credit facilities or
incur penalties and acceleration of payments under such credit facilities, which may adversely affect us or our
Promoters, Group Entities or associates, as the case may be.
31. Our insurance coverage may not adequately protect us from all material risks and liabilities.
Our business, including our office premises and owned test prep centers in particular, poses an inherent risk of
exposure to liability for property damage, personal injury or other damage. We maintain standard insurance
coverage for our corporate offices, K-12 schools under the owned infrastructure and infrastructure partnership
models and our employees, including vehicle insurance, standard firHDQGVSHFLDOSHULOVLQVXUDQFHGLUHFWRUV¶DQG
RIILFHUV¶OLDELOLW\LQVXUDQFHSXEOLFOLDELOLW\LQVXUDQFHPHGLFDOLQVXUDQFHDQGVSHFLDOFRQWLQJHQF\LQVXUDQFHIRU
burglary, theft and larceny as well as money insurance for cash in transit and cash in safe for our Company and
certain Subsidiaries. We also maintain professional indemnity insurance and commercial general liability
insurance for our Subsidiary, Kestone. In addition, our business partners for our test prep centers, as well as our
educational partners in the K-12 schools business, are obligated to maintain adequate insurance coverage for the
respective assets owned and operated by them at such locations, and we seek to obtain standard indemnities and
other contractual protections against any insurance-related risks arising in relation to business operations
conducted by us under the partnership model.
However, our insurance may not be adequate to cover all our risks and liabilities. There may also be certain
specific types of risks for which we are not covered. Further, there is no assurance that insurance will be
generally available in the future or, if available, that the premia will be commercially justifiable. If we incur
substantial liability that is not covered by insurance or exceeds policy limits, or any significant insurance claims
are not honored in the future for any reason, our business, financial condition, results of operations and
prospects may be adversely affected.
32. Our test prep operations and revenue are primarily concentrated in the northern region, and we are
significantly dependent on one of our business partners in Kolkata, for the operation of our test prep
centers in Kolkata. Inability to retain and grow our business in other regions and cities of India may
have an adverse effect on our business and prospects.
Our test prep operations and revenues are primarily concentrated in north India (Delhi, Haryana, Himachal
Pradesh, Jammu & Kashmir, Punjab, Rajasthan, Union Territory of Chandigarh, Uttar Pradesh and
Uttarakhand), where we had 91 test prep centers as of March 31, 2014 and an aggregate of 35,208 students
enrolled, representing 55.49% and 52.12% of our total test prep centers and enrolled students, respectively.
Further, we are significantly dependent on one of our business partners, for the operation of three test prep
centers in Kolkata, where we had an aggregate of 3,913 enrolments as of March 31 2014. Our significant
concentration in these regions exposes us to any adverse developments in these regions, due to local political,
administrative, infrastructural or other factors, whose effective resolution may require investment of significant
financial, management or other resources on our part, as well as increased competition from local or national
test prep course providers in these regions.
29
While our strategic objectives include geographical expansion as well as increasing our penetration across India,
in the event of a significant drop in enrolments from the Delhi NCR or Kolkata regions or any factors requiring
us or our business partners to close down existing centers or otherwise scale down operations in these regions,
or the emergence of a strong pan-India education company (or an aggregation of several strong regional players)
competing in the areas in which we operate, our business and prospects may be adversely affected.
33. We have contingent liabilities of ` 689.92 million as of March 31, 2014, on a consolidated basis, and
our profitability could be adversely affected if any of these contingent liabilities materialise.
As on March 31, 2014, we had the following contingent liabilities not provided for, as disclosed in the notes to
our restated consolidated financial statements.
(in ` million)
Particulars As on March 31, 2014
Claims against the group not acknowledged as debt 319.92
Corporate guarantees for loans taken by others 370.00
Total 689.92
If these contingent liabilities materialize, fully or partly, our financial condition may be adversely affected.
34. 7KH H[DPLQDWLRQ UHSRUW RQ RXU &RPSDQ\¶V UHVWDWHG VWDQGDORQH ILQDQFLDO VWDWHPHQWV FRQWDLQ FHUWDLQ
qualifications.
2XU&RPSDQ\¶Vexamination report contains certain qualifications for the last five fiscals. There is no assurance
that our audit reports for any future fiscal periods will not contain qualifications or that any such qualifications
will not require any adjustment in our financial statements for such future fiscal periods or otherwise impact our
financial condition and results of operations in such future fiscal periods. )RUGHWDLOVVHH³Summary Financial
Information´DQG³Financial Statements´RQSDJHV43 and 167, respectively.
35. Grants of stock options under our employee stock option plan may result in a charge to our profit and
loss account and, to that extent, reduce our profitability and financial condition.
As on the date of this Draft Red Herring Prospectus, 61,747 stock options are remaining to be granted to eligible
employees under Employee Stock Option Plan-³ESOP 2008´
8QGHU,QGLDQ*$$3WKHJUDQWRIHPSOR\HHVWRFNRSWLRQVUHVXOWVLQDFKDUJHWRRXU&RPSDQ\¶VSURILWDQGORVV
account equal to the intrinsic value (which will amortize over the vesting period of these stock options) based on
the difference between the fair value of our Equity Shares determined at the date of grant and the exercise price.
Our employee stock compensation expense amounted to ` 0.85 million for fiscal 2014. In addition to the impact
on the profit and loss account, the exercise of vested stock options will dilute the interests of Equity
Shareholders (as in the case of any issuance of Equity Shares).
Our Company intends to utilize a portion of the Net Proceeds of the Fresh Issue for funding expansion of two
Indus World Schools through our Subsidiaries CLEIS and CLIP aggregating ` 209.03 million, repayment of
debt facilities of our Subsidiary CLIP aggregating ` 210.05 million and investment in GKP for funding working
capital aggregating ` 171.72 million. Such investments, or a portion thereof, may not create any assets for our
Company and would instead be utilized for the purposes of inter alia, meeting their respective working capital
shortfalls and repayment of financing facilities. Our Company may, therefore, not receive any immediate benefit
IURPVXFKLQYHVWPHQWVLQWKHVH6XEVLGLDULHV)RUGHWDLOVVHH³Objects of the Offer´RQSDJH81.
37. We will not receive any proceeds of the Offer for Sale.
The Offer includes an Offer for Sale of upto 1,982,522 Equity Shares by the Selling Shareholders. The entire
proceeds of the Offer for Sale will be transferred to the Selling Shareholders and will not result in any creation
of value for us or in respect of your investment in our Company.
30
38. We do not have access to records and data pertaining to certain limited historical secretarial
information and have delayed filing certain records with regulatory authorities in the past.
Our Company does not have access to documentation pertaining to certain limited historical secretarial
information including in relation to filings with the Registrar of Companies, National Capital Territory of Delhi
and Haryana and the Reserve Bank of India. Further, there have been delays in filing certain forms with the
Reserve Bank of India in the past in relation to certain filings and we are in the process of filing forms and
UHSRUWLQJ WKH VDOH DQG WUDQVIHU RI RXU &RPSDQ\¶V HQWLUH VKDUHKROGLQJ LQ RXU HUVWZKLOH VXEVLGLDU\ &DUHHU
Launcher USA Inc., and in relation to WKHWUDQVIHURIRXU&RPSDQ\¶VVKDUHKROGLQJLQKestone Asia Hub Pte. Ltd.
to our Subsidiary, Kestone. While we believe that there have been no material non compliance in the past, and
that material information required for investors to make their investment decision in this Offer has been
disclosed in this Draft Red Herring Prospectus, we cannot assure you that we will not be penalized for delay in
regulatory filings in the future.
39. Our Company has issued Equity Shares during the preceding one year at a price that may be below
the Offer Price.
In the 12 months preceding the filing of this Draft Red Herring Prospectus, our Company has issued Equity
Shares at a price that may be lower than the Offer Price. The price at which Equity Shares have been issued by
our Company in the preceding one year is not indicative of the price at which they will be issued or traded.
40. Political, economic or other factors that are beyond our control may have an adverse impact on our
business, financial condition, results of operations and prospects.
The following external risks may have an adverse impact on our business, financial condition, results of
operations and prospects, should any of them materialize:
x the lingering effects of the recent global economic slowdown have generally dampened business confidence
and made the credit markets more volatile, as well as negatively impacting other industry players, including
companies participating in placement programs;
x increase in interest rates may adversely impact our access to capital and increase our borrowing costs, which
may constrain our ability to grow our business and operate profitably;
x the Indian economy has had sustained periods of high inflation in the recent past. High rates of inflation may
increase our employee costs and decrease demand for our courses and services, which may have an adverse
effect on our profitability and competitive advantage, to the extent that we are unable to pass on increased
employee costs by increasing cost of our courses and services;
x a downgrade of India's sovereign rating by international credit rating agencies may adversely impact our
access to capital and increase our borrowing costs, which may constrain our ability to grow our business and
operate profitably;
x DGHFOLQHLQ,QGLD¶VIRUHLJQH[FKDQJHUHVHUYHV may affect liquidity and interest rates in the Indian economy
as well as the valuation of the Indian Rupee, which may adversely impact our financial condition;
x political instability, resulting from a change in government or in economic and fiscal policies, may adversely
affect economic conditions in India;
x civil unrest, acts of violence, terrorist attacks, regional conflicts or situations or war may adversely affect the
financial markets, which may impact our business, financial condition, results of operations and prospects;
and
x India has experienced natural calamities such as earthquakes, tsunamis, floods and drought in recent years.
The extent and severity of these natural disasters determines their effect on the economy. If any of our
facilities were to be damaged as a result of an earthquake or other natural calamities, or if such events should
otherwise impact the national or any regional economies, our business operations, financial condition and
results of operations may be adversely affected.
31
41. Changing laws, rules and regulations and legal uncertainties, including adverse application of
corporate and tax laws, may adversely affect our business, financial condition, results of operations
and prospects.
The regulatory and policy environment in which we operate is evolving and subject to change. Such changes,
including the instances mentioned below, may adversely affect our business, financial condition, results of
operations and prospects, to the extent that we are unable to suitably respond to and comply with any such
changes in applicable law and policy.
x The Government of India proposes to revamp the implementation of direct taxes by way of the introduction
of the Direct Taxes Code ³DTC´ 7KH '7& SURSRVHV WR FRQVROLGDWH DQG DPHQG ODZV UHODWLQJ WR
income tax and wealth tax. The DTC, has, among things, specified the manner of aggregation and
computation of income, minimum alternate tax, wealth tax, dividend distribution tax, provided for certain tax
incentives and has specified penalties in the event of contravention of the provisions of the DTC. The DTC
has specified that dividend distribution tax is payable at the rate of an effective rate of 16.99% by a domestic
company, including applicable cess and surcharge. Further, the DTC has specific rates for taxation, including
for non-residents. For instance, withholding tax at the rate of 25%, plus effective cess and surcharge, will be
applicable for interest (other than specified interest) on any dividends not subject to distribution tax. If the
DTC is passed in its present form by both houses of the Indian Parliament and approved by the President of
India and then notified in the Gazette of India, the tax impact discussed in this Draft Red Herring Prospectus
will be altered by the DTC.
x 7KH *RYHUQPHQW RI ,QGLD KDV SURSRVHG D FRPSUHKHQVLYH QDWLRQDO JRRGV DQG VHUYLFHV WD[ ³GST´ UHJLPH
that will combine taxes and levies by the Central and State Governments into a unified rate structure. While
the Government of India and other state governments have announced that all committed incentives will be
protected following the implementation of the GST, given the limited availability of information in the
public domain concerning the GST, we are unable to provide any assurance as to this or any other aspect of
the tax regime following implementation of the GST. The implementation of this rationalized tax structure
may be affected by any disagreement between certain state governments, which may create uncertainty. Any
such future increases or amendments may affect the overall tax efficiency of companies operating in India
and may result in significant additional taxes becoming payable.
We have not determined the impact of these recent and proposed legislations on our business. Uncertainty in the
applicability, interpretation or implementation of any amendment to, or change in, governing law, regulation or
policy in the jurisdictions in which we operate, including by reason of an absence, or a limited body, of
administrative or judicial precedent may be time consuming as well as costly for us to resolve and may impact
the viability of our current business or restrict our ability to grow our business in the future.
42. Significant differences exist between Indian GAAP and other accounting principles, such as IFRS,
ZKLFKPD\EHPDWHULDOWRLQYHVWRUV¶DVVHVVPHQWRIRXUILQDQFLDOFRQGLWLRQ2XUIDLOXUHWRVXFFHVVIXOO\
adopt IND (AS) may have an adverse effect on the price of our Equity Shares.
The financial data included in this Draft Red Herring Prospectus has been prepared in accordance with Indian
GAAP. There are significant differences between Indian GAAP and IFRS. We have not attempted to explain
those differences or quantify their impact on the financial data included herein and we urge you to consult your
own advisors regarding such differences and their impact on our financial data. Accordingly, the degree to
which the Indian GAAP financial statements included in this Draft Red Herring Prospectus will provide
PHDQLQJIXO LQIRUPDWLRQ LV HQWLUHO\ GHSHQGHQW RQ WKH UHDGHU¶V OHYHO RI IDPLOLDULW\ ZLWK ,QGLDQ DFFRXQWLQJ
32
practices. Any reliance by persons not familiar with Indian accounting practices on the financial disclosures
presented in this Draft Red Herring Prospectus should accordingly be limited.
,QGLD KDV GHFLGHG WR DGRSW WKH ³&RQYHUJHQFH RI LWV H[LVWLQJ VWDQGDUGV ZLWK ,)56´ DQG QRW WKH ³,QWHUQDWLRQDO
)LQDQFLDO 5HSRUWLQJ 6WDQGDUGV´ ³IFRS´ 7KHVH ³,)56 EDVHG V\QFKURQL]HG $FFRXQWLQJ 6WDQGDUGV´ DUH
referred to in India as IND (AS). Public companies in India, including our Company, may be required to prepare
annual and interim financial statements under IND (AS) in accordance with the roadmap for the convergence
with IFRS announced by the 0LQLVWU\RI&RUSRUDWH$IIDLUV*RYHUQPHQWRI,QGLD³MCA´WKURXJKWKHSUHVV
note dated January 22, 2010. The MCA, through a press release dated February 25, 2011, announced that it will
implement the converged accounting standards in a phased manner after various issues, including tax related
issues, are resolved. Further, the Finance Minister, during the Union Budget speech, 2014, proposed the
adoption of IND (AS) by Indian companies from fiscal 2016 on a voluntary basis, and from fiscal 2017 on a
mandatory basis. Accordingly, it is not possible to quantify whether our financial results will vary significantly
due to the convergence to IND (AS), given that the accounting principles laid down in the IND (AS) are to be
applied to transactions and balances carried in books of accounts as on the date of the applicability of IND (AS)
and for future periods.
Further, we have made no attempt to quantify or identify the impact of the differences between Indian GAAP
and IND (AS) as applied to our financial statements. There can be no assurance that the adoption of IND (AS)
will not affect our reported results of operations or financial condition. Any failure to successfully adopt IND
(AS) may have an adverse effect on the trading price of our Equity Shares.
Moreover, our transition to IFRS or IFRS-converged reporting may be hampered by increasing competition and
increased costs for the relatively small number of IFRS-experienced accounting personnel available as more
Indian companies begin to prepare IFRS or IFRS-converged financial statements. Any of these factors relating
to the use of IFRS-converged Indian Accounting Standards may adversely affect our financial condition.
43. The requirements of being a listed company may strain our resources.
We are not a listed company and have not, historically, been subjected to the increased scrutiny of our affairs by
shareholders, regulators and the public at large that is associated with being a listed company. As a listed
company, we will incur significant legal, accounting, corporate governance and other expenses that we did not
incur as an unlisted company. We will be subject to the listing agreements with the Stock Exchanges which will
require us to file audited annual and unaudited quarterly reports with respect to our business and financial
condition. If we experience any delays, we may fail to satisfy our reporting obligations and/or we may not be
able to readily determine and accordingly report any changes in our results of operations as promptly as other
listed companies.
Further, as a listed company, we will need to maintain and improve the effectiveness of our disclosure controls
and procedures and internal control over financial reporting, including keeping adequate records of daily
transactions to support the existence of effective disclosure controls and procedures and internal control over
financial reporting. In order to maintain and improve the effectiveness of our disclosure controls and procedures
and internal control over financial reporting, significant resources and management attention will be required.
$V D UHVXOW RXU PDQDJHPHQW¶V DWWHQWLRQ PD\ EH GLYHUWHG IURP RWKHU EXVLQHVV FRQFHUQV ZKLFK PD\ DGYHUVHO\
affect our business, prospects, financial condition and results of operations. In addition, we may need to hire
additional legal and accounting staff with appropriate listed company experience and technical accounting
knowledge, but we cannot assure you that we will be able to do so in a timely and efficient manner.
On March 4, 2011, the Government of India notified the provisions under the Competition Act in relation to
FRPELQDWLRQV ³Combination Regulations´ ZLWK HIIHFW IURP -XQH 7KH &RPELQDWLRQ 5HJXODWLRQV
require that acquisition of shares, voting rights, assets or control or mergers or amalgamations, which cross the
prescribed asset and turnover based thresholds, shall be mandatorily notified to and pre-approved by the CCI. In
addition, on May 11, 2011, the CCI issued the Competition Commission of India (Procedure in regard to the
transaction of business relating to combinations) Regulations, 2011, which sets out the mechanism for
implementation of the Combination Regulations under the Competition Act. The manner in which the
Competition Act and the CCI affect the business environment in India may adversely affect our business,
financial condition and results of operations.
45. Our Promoters and Promoter Group will retain majority shareholding in our Company following the
Offer, which will allow them to exercise significant influence over us and may cause us to take actions
that are not in our or your best interest.
After the completion of this Offer, our Promoters and Promoter Group will collectively hold approximately
51.75% of our Company's issued and outstanding Equity Shares. So long as our Promoters and Promoter Group
own a significant portion of our Equity Shares, they will be able to significantly influence the election of our
Directors and control most matters affecting our Company, including our business strategies and policies,
decisions with respect to mergers, business combinations, acquisitions or dispositions of assets, dividend
policies, capital structure and financing, and may also delay or prevent a change of management or control, even
if such a transaction may be beneficial to other shareholders of our Company. The interests of our Promoters
and Promoter Group, as the controlling shareholders of our Company, may also conflict with our interests or the
interests of our Company's other shareholders. As a result, our Promoters and Promoter Group may take actions
that conflict with our interests or the interests of other shareholders of our Company.
46. There is no guarantee that our Equity Shares will be listed on the Stock Exchanges in a timely manner
or at all, which may restrict your ability to dispose of our Equity Shares.
In accordance with Indian law and practice, permission for listing and trading of our Equity Shares will not be
granted until after certain actions have been completed in relation to this Offer and until Allotment of Equity
Shares pursuant to this Offer. Trading in our Equity Shares is expected to commence within 12 Working Days
from the Bid/Offer Closing Date. However, we cannot assure you that the trading in our Equity Shares will
commence in a timely manner or at all. Any failure or delay in obtaining final listing and trading approvals may
restrict your ability to dispose of your Equity Shares.
47. Our Equity Shares have not been publicly traded prior to this Offer. After this Offer, our Equity
Shares may experience price and volume fluctuations and an active trading market for our Equity
Shares may not develop. Further, the price of our Equity Shares may be volatile, and you may be
unable to resell your Equity Shares at or above the Offer Price, or at all.
Prior to this Offer, there has been no public market for our Equity Shares. An active trading market on the Stock
Exchanges may not develop or be sustained after this Offer. Moreover, the Offer Price is intended to be
determined through a book-building process and may not be indicative of the price of our Equity Shares at the
time of commencement of trading of our Equity Shares or at any time thereafter.
The trading price of our Equity Shares after this Offer may be subject to significant fluctuations in response to,
among other factors, general economic, political and social factors, developments in India's fiscal regime,
variations in our operating results, market conditions specific to the industry that we operate in, developments
relating to India (as well as other jurisdictions in which we operate) and volatility in the Indian and global
securities market, developments in our business as well as our industry and the perception in the market about
34
investments in our business, changes in the estimates of our performance or recommendations by financial
analysts and announcements by us or others regarding contracts, acquisitions, strategic partnerships, joint
ventures, or capital commitments. The trading price of our Equity Shares might also decline in reaction to events
that affect the entire market and/or other companies in our industry even if these events do not directly affect us
and/or are unrelated to our business, financial condition or operating results.
48. Fluctuation in the exchange rate between the Indian Rupee and other foreign currencies may have an
adverse effect on the value of our Equity Shares, independent of our operating results.
On listing, our Equity Shares will be quoted in Indian Rupees on the Stock Exchanges. Any dividends in respect
of our Equity Shares will also be paid in Indian Rupees and subsequently converted into the relevant foreign
currency for repatriation, if required. Any adverse movement in currency exchange rates during the time that it
takes to undertake such conversion may reduce the net dividend to foreign investors. In addition, any adverse
movement in currency exchange rates during a delay in repatriating outside India the proceeds from a sale of
Equity Shares, for example, because of a delay in regulatory approvals that may be required for the sale of
Equity Shares may reduce the proceeds received by Equity Shareholders.
For example, the exchange rate between the Rupee and the U.S. dollar has fluctuated substantially in recent
years and may continue to fluctuate substantially in the future, which may have an adverse effect on the trading
price of our Equity Shares and returns on our Equity Shares, independent of our operating results.
49. You may be subject to Indian taxes arising out of capital gains on the sale of our Equity Shares.
Under current Indian tax laws, capital gains arising from the sale of equity shares within 12 months in an Indian
company are generally taxable in India. Any gain realized on the sale of listed equity shares on a stock exchange
held for more than 12 months will not be subject to capital gains tax in India if Securities Transaction Tax
³STT´ LV SDLG RQ WKH WUDQVDFWLRQ 677 LV OHYLHG RQ DQG FROOHFWHG E\ D GRPHVWLF VWRFN H[FKDQJH RQ ZKLFK
equity shares are sold. Any gain realized on the sale of equity shares held for more than 12 months to an Indian
resident, which are sold other than on a recognized stock exchange and on which no STT has been paid, is
subject to long term capital gains tax in India. Further, any gain realized on the sale of listed equity shares held
for a period of 12 months or less will be subject to short term capital gains tax in India. Capital gains arising
from the sale of equity shares is exempt from taxation in India where an exemption from taxation in India is
provided under a treaty between India and the country of which the seller is resident. Generally, Indian tax
WUHDWLHVGRQRWOLPLW,QGLD¶VDELOLW\WRLPSRVHWD[RQFDSLWDOJDLQV$VDUHVXOWUHVLGHQWVRIRWKHUFRXQWULHVPD\EH
liable to pay tax in India as well as in their own jurisdiction on a gain on the sale of equity shares.
50. 2XU&RPSDQ\¶VDbility to pay dividends in the future will depend on our future cash flows, working
capital requirements, capital expenditures and financial condition.
The amount of our future dividend payments, if any, will depend on our future earnings, cash flows, financial
condition, working capital requirements, capital expenditures, applicable Indian legal restrictions and other
factors. There can be no assurance that we will pay dividends. We may decide to retain all of our earnings to
finance the development and expansion of our business and, therefore, may not declare dividends on our Equity
Shares. Additionally, in the future, we may be restricted by the terms of our financing agreements in making
dividend payments unless otherwise agreed with our lenders.
51. The trading price of our Equity Shares may fluctuate due to volatility of the Indian and global
securities markets.
Stock exchanges in India have in recent years, in line with global developments, experienced substantial
fluctuations in the prices of listed securities. The SENSEX, BSE's benchmark index, reduced by approximately
25%, representing approximately 5,000 points, in the calendar year 2011, subsequently increased by
approximately 26%, representing approximately 4,000 points in the calendar year 2012 and thereafter increased
by approximately 8.1%, representing approximately 1,590 points in the calendar year 2013. Indian stock
exchanges have also, in the past, experienced temporary closures, broker defaults, settlement delays and strikes
by brokerage firm employees. In addition, Indian stock exchanges have, from time to time, imposed restrictions
on trading in certain securities, limitations on price movements and margin requirements.
35
52. There will be restrictions on daily movements in the price of our Equity Shares, which may adversely
affect your ability to sell, or the price at which you can sell, Equity Shares at a particular point in time.
Subsequent to listing, our Equity Shares will be subject to a daily circuit breaker imposed by the Stock
Exchanges on listed companies which will not allow transactions beyond certain volatility in the trading price of
our Equity Shares, as well as an index-based market-wide circuit breaker. The percentage limit on our
Company's circuit breaker shall be set by the Stock Exchanges based on historic volatility in the price and
trading volumes of our Equity Shares and the index-based market-wide circuit breaker shall be set by the Stock
Exchanges based on market-wide index variation of 10%, 15% and 20% based on the previoXV GD\¶V FORVLQJ
level of the relevant index. The Stock Exchanges are not required to inform our Company of the percentage
limit of the circuit breaker on our Equity Shares from time to time, and may change it without our knowledge.
These circuit breakers will effectively limit upward and downward movements in the price of our Equity Shares.
As a result, there can be no assurance regarding your ability to sell your Equity Shares over the Stock
Exchanges or the price at which you may be able to sell your Equity Shares.
53. Under Indian law, foreign investors are subject to investment restrictions that limit our ability to
attract foreign investors, which may adversely impact the trading price of our Equity Shares.
Under foreign exchange regulations currently in force in India, transfers of shares between non-residents and
residents are freely permitted (subject to certain exceptions) if they comply with the pricing and reporting
requirements specified by the RBI. If a transfer of shares is not in compliance with such pricing or reporting
UHTXLUHPHQWVDQGGRHVQRWIDOOXQGHUDQ\RIWKHH[FHSWLRQVVSHFLILHGE\WKH5%,WKHQWKH5%,¶VSULRUDSSURYDOLV
required. Additionally, shareholders who seek to convert Rupee proceeds from a sale of shares in India into
foreign currency and repatriate that foreign currency from India require a no-objection or a tax clearance
certificate from the Indian income tax authorities. We cannot assure you that any required approval from the
RBI or any other Government agency can be obtained on any particular terms or at all.
54. Any future issuance of Equity Shares may dilute your shareholding, and significant sales of Equity
Shares by our major shareholders, may adversely affect the trading price of our Equity Shares.
Future issuances of equity shares by our Company or significant sales of Equity Shares after this Offer will
dilute investors' holdings in our Company. In addition, the perception that such issuance or sales may occur may
adversely affect the trading price of our Equity Shares and impair our future ability to raise capital through
offerings of Equity Shares. We cannot predict the effect that significant sales of Equity Shares by major Equity
Shareholders or the availability of significant numbers of our Equity Shares for future sale may have on the
trading price of our Equity Shares.
55. Holders of Equity Shares may be restricted in their ability to exercise pre-emptive rights under Indian
law and thereby suffer future dilution of their ownership position.
Under the Companies Act, a company incorporated in India must offer its equity shareholders pre-emptive
rights to subscribe and pay for a proportionate number of equity shares to maintain their existing ownership
percentages prior to issuance of any new equity shares, unless the pre-emptive rights have been waived by the
adoption of a special resolution by holders of three-fourths of the equity shares voting on such resolution.
However, if the law of the jurisdiction that you are in does not permit the exercise of such pre-emptive rights
without our filing an offering document or registration statement with the applicable authority in such
jurisdiction, you will be unable to exercise such pre-emptive rights, unless we make such a filing. If we elect not
to file a registration statement, the new securities may be issued to a custodian, who may sell the securities for
your benefit. The value such custodian receives on the sale of any such securities and the related transaction
costs cannot be predicted. To the extent that you are unable to exercise pre-emptive rights granted in respect of
our Equity Shares, your proportional interests in our Company may be reduced.
56. Rights of shareholders under Indian laws may be more limited than under the laws of other
jurisdictions.
Indian legal principles related to corporate procedures, directors' fiduciary duties and liabilities, and
shareholders' rights may differ from those that would apply to a company in another jurisdiction. Shareholders'
rights under Indian law may not be as extensive as shareholders' rights under the laws of other countries or
36
jurisdictions. Investors may have more difficulty in asserting their rights as shareholder in an Indian company
than as shareholder of a corporation in another jurisdiction.
Prominent Notes:
x Initial public offering of upto 4,000,000 Equity Shares of face value ൕ 10 each of our Company, for
cash at a price of ൕ >Ɣ@SHU(TXLW\6KDUHDJJUHJDWLQJXSWRൕ >Ɣ@PLOOLRQFRQVLVWLQJRID)UHVK,VVXHRI
2,017,478 Equity Shares by our Company aggregating up to ൕ >Ɣ@PLOOLRQDQGDQ2IIHUIRU6DOHE\WKH
Selling Shareholders of upto 1,982,522 Equity Shares aggregating up to ൕ >Ɣ@ million. The Offer is
being made for at least 25% of the post-Offer paid-up Equity Share capital of our Company.
x The net worth of our Company as on March 31, 2014 as per our restated consolidated financial
statements and restated standalone financial statements included in this Draft Red Herring Prospectus is
` 1,493.58 million and ` 1,130.46 million, respectively. SHH³Financial Statements´RQSDJH167.
x The net asset value per Equity Share as on March 31, 2014 as per our restated consolidated financial
statements and restated standalone financial statements included in this Draft Red Herring Prospectus is
` 150.60 and ` 120.03, respectively.
x The average cost of acquisition per Equity Share by our Promoters as on date of this Draft Red Herring
Prospectus is:
x There has been no financing arrangement whereby the Promoter Group, our Directors, or any of their
respective relatives have financed the purchase by any other person of securities of our Company other
than in the ordinary course of the business of the financing entity during the six months preceding the
date of this Draft Red Herring Prospectus.
x For details of transactions by our Company with our Group Entities during the last financial year
including the nature and cumulative value of the transactions, VHH³Financial Statements´RQSDJH167.
x For more information on Group Entities that have business or other interests in our Company, see
³Promoters and Group Entities´DQG³Financial Statements´RQSDJHV160 and 167, respectively
x Investors may contact the BRLM that has submitted the due diligence certificate to SEBI or the
Registrar to the Offer, for any complaints pertaining to the Offer.
37
SECTION III ± INTRODUCTION
SUMMARY OF INDUSTRY
Unless otherwise stated, the information in this section has been extracted from the CRISIL Research Report
GDWHG0D\RQµ$VVHVVPHQWIRU7HVW3UHSDUDWLRQ.9RFDWLRQDO7UDLQLQJDQG3XEOLVKLQJ,QGXVWULHV¶
WKH³CRISIL Report´7KLVUHSRUWDVZHOODVWKHSXEOLFO\DYDLODEOHGRFXPHQWVDVcited below in this section)
have not been prepared or independently verified by us or the Book Running Lead Manager or any of our or its
respective affiliates or advisors. This information may not be consistent with other information compiled by
third parties within or outside India. Industry sources and publications referred to by us generally state that the
information contained therein has been obtained from sources generally believed to be reliable, but their
accuracy, completeness and underlying assumptions are not guaranteed and their reliability cannot be assured.
Industry and Government publications are also prepared based on information as of specific dates, which may
no longer be relevant or reflect current trends. Accordingly, investment decisions should not be based on such
LQIRUPDWLRQ 6WDWHPHQWV LQ WKLV VHFWLRQ WKDW DUH QRW VWDWHPHQWV RI KLVWRULFDO IDFW FRQVWLWXWH ³IRUZDUG-looking
VWDWHPHQWV´ 6XFKIRUZDUG-looking statements are subject to various risks, assumptions and uncertainties and
certain factors could cause actual results or outcomes to differ materially.
Indian Economy
India is the world's largest democracy in terms of population (approximately 1,236.3 million people, July 2014
estimate) with an estimated GDP (by purchasing powering parity valuation of country GDP) of approximately
US$ 4.99 trillion in 2013 (Source: CIA World Factbook). This makes it the third largest economy in the world in
terms of GDP after the United States of America and China in 2013 (Source: International Monetary Fund
(IMF), World Economic Outlook Database, April 2014).
Despite the global economic decline in fiscal 2008, India continues to be one of the fastest growing countries in
the world. India has been growing faster than the emerging and developing economies in the period in the period
2009- DQG KDV JHQHUDOO\ EHHQ DW SDU VXEVHTXHQW WR ILVFDO )XUWKHU ,QGLD¶V JURZWK KDV JHQHUDOO\
outperformed the advanced economies and the world GDP growth rate since fiscal 2009. (Advanced economies
include 36 countries such as Australia, Canada, France, Japan, United Kingdom, United States and others; and
Emerging and Developing economies include over 153 countries such as Argentina, Brazil, China, Russia,
South Africa, Turkey and others, as defined by IMF;
https://www.imf.org/external/pubs/ft/weo/2014/01/weodata/groups.htm)
The following table sets forth the key indicators of the Indian economy for the past five fiscals.
After achieving growth of over 9% for three successive years between fiscal 2006 and fiscal 2008 and
recovering swiftly from the global financial crisis of 2008-09, the Indian economy has been going through
challenging times that have resulted in lower than 5% growth of GDP for the last two years, i.e., fiscal 2014 and
fiscal 2013. Persistent uncertainty in the global outlook, caused by the crisis in Europe and general slowdown in
the global economy, compounded by domestic structural constraints and inflationary pressures, resulted in a
protracted slowdown. The slowdown is broadly in sync with trends in other emerging and developing
HFRQRPLHV,QGLD¶VJURZWKGHFOLQHGIURPDQDYHUDJHRISHUDQQXPGXULQJILVFDOWRILVFDOWRDQ
average of 4.6% during fiscal 2013 to fiscal 2014. In comparison, average growth in the emerging markets and
developing economies including China declined from 6.8% to 4.9% in this period (calendar-year basis) (Source:
Indian Economic Survey 2013-14, Ministry of Finance, Government of India).
38
The education sector in India can be broadly classified into the formal and non-formal categories. The formal
category comprises K+12 and higher education, up to post-graduation, and is subject to high levels of regulation
in India, both at the central and state government level.
$QRWKHUNH\IDFWRUJRYHUQLQJWKHIRUPDOHGXFDWLRQFDWHJRU\LVWKHµQRWIRUSURILW¶GLNWDW(GXFDWLRQDOLQVWLWXWLRQV
LQ,QGLDFDQQRWEHVHWXSRQDµIRUSURILW¶EDVLVDQGEXVLQHVVVWUXFWXUHVVXFKDVVXFKDVSDUWQHUVKLSVSULYDWHDQG
public companies, etc.are prohibited from setting up educational institutions in India. Educational institutions in
India are either set up by government entities or by private sector entities such as a society registered under the
Societies Registration Act, 1860, a public trust registered under the Indian Trust Act, 1882, or under
FRUUHVSRQGLQJVWDWHODZVVXFKDVWKH%RPED\3XEOLF7UXVW$FWRUDµQRWIRUSURILW¶FRPSDQ\VHWXSXQGHU
the Companies Act. The key common feature among all these entities is that profits cannot be distributed to the
provider of capital, either as dividend or otherwise. This generally serves as a disincentive to private players,
thereby restricting private investments in the education sector.
On the other hand, the non-formal category largely comprises segments like pre-schooling, coaching (also
known as test prep), vocational training, online education and publishing, which enjoy a lesser degree of
regulation.
As education is on the concurrent list of the Indian constitution, the sector is governed by both the central and
state government. The Ministry of Human Resource Development plays a pivotal role in governing the
education sector, governing the education sector through its two nodal agencies:
x the Department of School Education and Literacy, which is responsible for disbursing central grants to
states for building educational infrastructure at the K+12 (kindergarten to grade 12) level in India; and
x the Department of Higher Education, which is responsible for governing higher education (graduation,
post-graduate and professional) in India.
The coaching sector in India, which is one of the most unregulated segments of the Indian education sector, can
be broadly classified into curriculum-based and test prep-based coaching.
x Curriculum-based coaching classes focus on coaching students appearing for K+12 examinations and
graduation courses, and are based on a fixed curriculum.
x Test prep-based coaching classes focus on coaching students appearing for entrance examinations at
the undergraduate and post-graduate level, and are typically aptitude-based.
Publishing Industry
Overview
Publishing is the activity that involves preparation and marketing of books. Publishers acquire content from
authors in the form of manuscripts. The content is then evaluated, edited and then sent for printing in the form of
a book. The books are then distributed through wholesalers and retailers to reach the end-user. Many publishers
also are in the book distribution business.
Vocational Education
Vocational education mainly refers to the training imparted to people to prepare them for specific trades in
various fields such as nursing and medicine, retail, automotive, banking and financial services, IT-ITeS, real
estate, and others.
K+12 Industry
The K+12 education structure in India can be broadly classified on the basis of the following factors:
x Management;
40
SUMMARY OF BUSINESS
This section should be read in conjunction with, and is qualified in its entirety by, the more detailed information
about us and our financial statements, including the notes thereto in the sections, "Risk Factors",
³0DQDJHPHQW¶V'LVFXVVLRQDQG$QDO\VLVRI)LQDQFLDO&RQGLWLRQDQG5HVXOWVRI2SHUDWLRQV´DQG³Financial
Statements´RQSDJHV11, 359 and 167, respectively.
Overview
We are a diversified provider of educational products, services, content and infrastructure in India, with a
presence across the education value chain. We commenced operations in 1996 as a provider of MBA test
preparation courses and since commencement of operations, we have diversified our operations across four
segments across the education value chain: test preparation and training, generally referred to as test prep,
conducted under the widely-UHFRJQL]HG EUDQG µ&DUHHU /DXQFKHU¶ SXEOLVKLQJ DQG FRQWHQW GHYHORSPHQW
FRQGXFWHGXQGHUWKHEUDQGµ*.3XEOLFDWLRQV¶.-VFKRROVRSHUDWHGXQGHUWKHEUDQGµ,QGXV:RUOG6FKRROV¶
with 10 schools across India; and vocational training programs implemented by us under Government schemes
in various States across India, as well as recruitment, training and event management services for corporates.
Under the umbrella of our Career Launcher test prep courses, we offer leading test prep courses for MBA, Civil
Services and Law, as well as courses for, among others, Engineering, Bank entrances, GATE and Staff Selection
&RPPLVVLRQ³SSC´368HQWUDQFH (Source: CRISIL Report). For fiscal 2014, we had 67,549 enrolments in
our test prep segment across a network of 164 test prep centers in 73 cities throughout India, with 76 owned
centers RIZKLFKDUHWHPSRUDU\µ6PDUW&DUHHU&HQWHUV¶and 88 centers operated under a partnership model.
Out of our total student enrolments, as on March 31, 2014, we had 32,286 enrolments in our MBA courses,
followed by 12,138 enrolments in our Civil Services courses, and 9,220 enrolments in our Law courses. Our
students have established a strong success record for us, across our test prep business. For instance, 67 of our
students secured ranks in the top 100 successful candidates in the CLAT examination held in May 2014, and
1,632 of our students received interview calls from at least one IIM in the CAT examination held in October
2013. Further, 742 of our students qualified for Civil Services Main Examinations, of which 176 of our students
were in the final merit list of Civil Services Main Examinations held in 2013.
With our acquisition of the GK Publications business in November 2011, we believe that we have an established
brand in the publishing and content development business, in particular, a brand that has built a reputation for
publishing niche test prep books, guides, mock test papers and question banks for popular professional and
entrance examinations in India, including titles for Engineering, GATE, Civil Services and Bank entrances.
During the year ended March 31, 2014, we had released 945 titles and had sold over 1.1 million copies under the
brand GK Publications. As on March 31, 2014, we had a network of over 1,000 dealers and distributors, across
several States in India.
We provide infrastructure, educational services and license our µ,QGXV:RUOG6FKRROV¶brand to 10 K-12 schools
across India, providing English-PHGLXP HGXFDWLRQ WKURXJK WZR VFKRROV XQGHU WKH µ2ZQHG-,QIUDVWUXFWXUH¶
PRGHO VL[ VFKRROV XQGHU WKH µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ PRGHO DQG WZR VFKRROV XQGHU WKH µ(GXFDWLRQDO
3DUWQHUVKLS¶ PRGHO 6HH ³-Our Business Operations ± K-12 Schools´ EHORZ $V RQ 0DUFK 2,612
students were enrolled in the Indus World Schools RSHUDWHGXQGHUWKHµ2ZQHG,QIUDVWUXFWXUH¶DQGµ,QIUDVWUXFWXUH
3DUWQHUVKLS¶PRGHOV, across the States of Punjab, Delhi NCR, Madhya Pradesh, Chhattisgarh, Maharashtra and
Haryana.
In the vocational training segment, we had an aggregate of 8,233 enrolments in our vocational training programs
implemented by us under project tenders issued by the Central and various State Governments, during fiscal
2014, across the States of Gujarat, Rajasthan, Jharkhand, Chhattisgarh, Madhya Pradesh and Uttar Pradesh.
With the Government of India and other State Governments promoting private participation in their drive for
VNLOO GHYHORSPHQW LQ ,QGLD LQFOXGLQJ WKURXJK WKH 3ULPH 0LQLVWHU¶V National Policy of Skill Development
seeking to train 500 million people in India by 2022, we believe that there is a significant growth opportunity in
the vocational training segment. In addition, we undertake certain recruitment, training and event management
services for corporates from time to time, through our Subsidiary, Kestone, which, we believe, enables us to
build relationships with corporates and drives our placement programs for enrolments in our vocational training
programs.
41
Our revenue from operations for fiscal 2014, 2013 and 2012 aggregated to ` 2,186.85 million, ` 1,989.72
million and ` 1,657.31 million, respectively, on a consolidated basis. Revenues from our test prep business
aggregated to ` 1,016.46 million, ` 985.67 million and ` 809.10 million, respectively; revenues from our
publishing and content development business, conducted under the brand GK Publications, aggregated to `
180.93 million, ` 149.60 million and ` 55.43 million, respectively; revenues from the K-12 schools operated
under the brand Indus World Schools, aggregated to ` 60.85 million, ` 52.83 million and ` 91.82 million,
respectively; revenues from our vocational training programs aggregated to ` 162.87 million, ` 146.11 million
and ` 70.67 million, respectively; and revenues from our recruitment, training and event management services
for corporates aggregated to ` 733.83 million, ` 627.83 million and ` 604.11 million, respectively; for fiscal
2014, 2013 and 2012. Our profit after tax for fiscal 2014, 2013 and 2012 aggregated to ` 163.24 million, `
147.43 million and ` (61.90) million, respectively, on a consolidated basis.
Strengths
x Diversified provider of educational products, services, content and infrastructure, with pan-India
presence.
x Professionally qualified, experienced and entrepreneurial management team, and quality human capital.
Strategies
Our aim is to strengthen our market position and brand recognition, by continuing to pursue the following
growth strategies:
x Expand our geographical footprint and increase center utilization across India, in our test prep business.
x Develop and derive synergies from our publishing and content development business.
42
SUMMARY FINANCIAL INFORMATION
The following tables set forth the summary financial statements derived from our restated consolidated financial
statements for and as of fiscals 2014, 2013, 2012, 2011 and 2010, and our restated standalone financial
statements for and as of fiscals 2014, 2013, 2012, 2011 and 2010. These financial statements have been prepared
in accordance with Indian GAAP and the Companies Act and restated in accordance with the SEBI ICDR
RHJXODWLRQV DQG DUH SUHVHQWHG LQ ³Financial Statementsdz on page 167. The summary financial statements
presented below should be read in conjunction with our restated financial statements, the notes and annexures
thereto and ³0DQDJHPHQW¶V Discussion and Analysis of Financial Condition and Results of Operationsdz on
page 359.
CL Educate Limited
Annexure I - Restated summary statement of assets and liabilities
` in Million
As at March 31
2014 2013 2012 2011 2010
EQUITY AND LIABILITIES
Shareholders’ funds
Share capital V 99.18 99.18 93.35 94.35 87.49
Reserves and surplus VI 1,031.28 1,005.95 805.21 751.87 548.21
1,130.46 1,105.13 898.56 846.22 635.70
Non-current liabilities
Long-term borrowings VIII 18.88 36.26 117.47 125.92 197.59
Deferred tax liabilities (net) IX 17.81 4.30 - 0.51 3.31
Long-term provisions X 13.58 8.35 7.04 8.51 6.16
50.27 48.91 124.51 134.94 207.06
Current liabilities
Short-term borrowings XI 240.66 234.45 163.17 19.81 88.88
Trade payables XII 112.15 55.27 97.24 96.01 42.83
Other current liabilities XIII 288.38 336.02 392.82 293.73 293.53
Short-term provisions X 0.46 1.47 1.15 - 0.36
641.65 627.21 654.38 409.55 425.60
Total Liabilities.. 1,836.24 1,781.25 1,706.90 1,491.02 1,268.36
ASSETS
Non-current assets
Fixed assets
- Tangible assets XIV 336.79 349.30 411.41 424.50 180.69
- Intangible assets XV 110.75 123.37 136.78 25.93 28.98
- Capital work-in-progress XVI - 0.09 - - 195.89
Non-current investments XVII 453.28 406.01 364.45 274.51 214.51
Deferred tax assets (net) IX - - 33.32 - -
Long-term loans and advances XVIII 82.99 91.01 70.43 71.22 83.16
Other non-current assets XIX 132.43 150.91 4.13 54.84 32.24
1,116.24 1,120.69 1,020.52 851.00 735.47
Current assets
Current investments XX - - - - -
Inventories XXI 33.65 24.28 12.50 - -
Trade receivables XXII 358.92 312.98 264.02 200.19 184.86
Cash and bank balances XXIII 44.66 65.29 157.98 129.79 127.69
Short-term loans and advances XXIV 204.91 189.07 233.79 295.82 200.44
Other current assets XXV 77.86 68.94 18.09 14.22 19.90
720.00 660.56 686.38 640.02 532.89
Total assets.. 1,836.24 1,781.25 1,706.90 1,491.02 1,268.36
Footnotes:
1) The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and loss
and cash flow.
2) Refer Annexure IV(2) for material adjustments.
43
CL Educate Limited
Annexure II - Restated summary statement of profit and loss
` in Million
For the year ending March 31
2014 2013 2012 2011 2010
Income
Revenue from operations XXVI 1,194.10 1,164.08 911.70 852.23 845.29
Other income XXVII 52.38 191.15 110.04 86.64 67.60
Total Revenue 1,246.48 1,355.23 1,021.74 938.87 912.89
Expenses
Purchases of traded goods XXVIII 117.41 103.34 52.56 28.52 37.20
(Increase) in inventory of traded goods XXIX (9.37) (11.78) (12.50) - -
Cost of services XXX 477.07 487.41 378.14 362.62 365.80
Employee benefits expense XXXI 220.58 196.41 184.68 141.94 149.62
Finance costs XXXII 44.13 59.07 40.61 31.41 16.08
Depreciation and amortisation expenses XXXIII 37.48 37.21 28.27 22.03 19.13
Other expenses XXXIV 305.70 380.70 245.19 209.15 232.33
Total expenses 1,193.00 1,252.36 916.95 795.67 820.16
Restated profit before exceptional expenses and tax 53.48 102.87 104.79 143.20 92.73
Exceptional expenses XLVIII 15.49 - 196.62 17.13 -
Restated profit/(loss) before tax 37.99 102.87 (91.83) 126.07 92.73
Income tax expense:
- Current tax 7.67 - 7.28 45.34 25.94
- Minimum alternate tax ('MAT') credit (7.67) - (7.28) - -
- Deferred tax charge/(benefit) IX 13.51 37.62 (33.82) (2.81) 7.53
Total tax expenses 13.51 37.62 (33.82) 42.53 33.47
Restated net profit/(loss) after tax 24.48 65.25 (58.01) 83.54 59.26
Footnotes:
1) The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and loss and
cash flow.
2) Refer Annexure IV(2) for material adjustments.
CL Educate Limited
Annexure III - Restated summary statement of cash flow
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Adjustments for:
Depreciation and amortisation on fixed assets 37.48 37.23 28.28 22.03 19.13
Depreciation and amortisation on Investments property 0.21 0.21 0.21 - -
Finance costs (except loan processing charges) 42.56 52.13 39.38 31.41 14.07
Loan processing charges 1.54 6.16 1.21 - 1.99
Interest income (28.59) (32.18) (47.51) (32.27) (16.11)
Loss/(Profit) on sale of fixed assets - (0.13) 0.13 (2.01) -
(Profit) on sale of investments - - - - (7.68)
Rent income on investments property (0.29) (0.60) (0.80) - (1.76)
Fixed assets written off 0.68 0.61 1.07 - 1.70
Advances written off 0.51 120.02 0.04 2.63 0.04
Bad debts written off 39.00 31.90 40.90 26.35 11.95
Deposits written off - 0.39 - - 0.21
Miscellaneous balances written off 1.62 2.40 1.41 0.11 0.67
Provision for doubtful advances 0.34 2.00 - - -
Provision for impairment of investment - 0.07 - - -
Provision no longer required written back - (112.88) - - -
Liability no longer required written back (16.64) (31.58) (16.29) (2.14) (8.97)
Bad debts recovered (0.81) (0.57) (0.72) (0.53) (0.27)
Transfer to stock options outstanding 0.85 3.44 4.23 (0.46) 2.13
Exceptional non cash items: - - - - -
-Provision for doubtful advances - - 135.92 17.13 -
- Advances written off 15.49 - 60.70 - -
- Provision for impairment of investment - - 0.38 - -
Unrealised foreign exchange gain (1.53) (0.35) (5.43) (0.10) 0.56
Realised foreign exchange gain on sale of investment (0.24) - - - -
Operating profit before working capital changes 130.16 181.13 151.24 188.22 110.40
Cash generated from/(used in) operations 111.56 61.66 (43.23) 111.70 270.18
Net cash generated from/(used in) operating activities 104.78 55.52 (25.41) 67.26 239.67
CL Educate Limited
Annexure III - Restated summary statement of cash flow
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Net cash generated from/(used in) investing activities 1.94 (90.04) (156.56) (154.36) (124.36)
Net cash generated/(used in) from financing activities (91.47) 34.08 159.99 75.49 (90.72)
Net increase/(decrease) in cash and cash equivalents 15.25 (0.44) (21.98) (11.61) 24.59
Cash and cash equivalents at beginning of the year 19.68 19.98 41.47 53.08 28.49
Cash and cash equivalents at end of the year 34.93 19.68 19.98 41.47 53.08
continued to next page….
CL Educate Limited
Annexure III - Restated summary statement of cash flow
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Add:
Fixed deposits shown under other Cash and bank
balances
– Deposits with original maturity for more than 3 months 6.00 45.56 - - -
but less than 12 months from the reporting date
Footnotes:
1) The above restated summary statement of cash flows has been prepared under the 'Indirect Method' as set out in the
Accounting Standard - 3 on 'Cash Flow Statements' [notified under the Companies Act, 1956 read with General Circular 15/2013
dated September 13, 2013, issued by the Ministry of Corporate Affairs, in respect of Section 133 of the Companies Act, 2013].
2) The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and
loss and cash flow.
3) The above restated summary statement of cash flows has been compiled from and is based on the restated summary
statement of assets and liabilities as at March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011 and March 31, 2010
and the related restated summary statement of profit and loss for the years ended on that date.
4) Refer Annexure IV(2) for material adjustments.
CL Educate Limited
Annexure I - Restated consolidated summary of assets and liabilities
(൘ in Million)
Annexure As at March 31
Particulars
2014 2013 2012 2011 2010
Non-current liabilities
Long-term borrowings VIII 235.02 258.40 329.64 335.53 357.69
Deferred tax liabilities (net) IX 18.57 15.54 23.68 30.10 4.68
Other long-term liabilities X 1.19 1.10 0.91 0.63 0.09
Long-term provisions XI 20.39 15.22 10.36 10.44 7.38
275.17 290.26 364.59 376.70 369.84
Current liabilities
Short-term borrowings XII 340.81 281.69 220.71 39.56 108.33
Trade payables XIII 169.85 120.84 96.00 88.34 44.50
Other current liabilities XIV 405.26 481.58 607.33 482.08 358.71
Short-term provisions XI 25.67 14.86 3.41 0.23 0.54
941.59 898.97 927.45 610.21 512.08
Total Liability.. 3,012.19 2,801.80 2,634.36 2,356.95 1,666.48
ASSETS
Non-current assets
Fixed assets
-Tangible assets XV 755.87 776.27 912.72 739.38 395.74
-Intangible assets XVI 110.25 124.45 142.56 30.46 38.56
-Capital work-in-progress XLVI 6.31 6.41 5.95 123.58 239.40
Goodwill on consolidation XLV 195.96 155.06 121.35 44.29 44.29
Non-current investments XVII 17.20 17.42 17.63 0.50 0.50
Deferred tax assets (net) IX 1.60 1.10 35.23 4.55 6.09
Long-term loans and advances XVIII 190.61 160.99 124.82 128.30 198.02
Other non-current assets XIX 132.43 210.37 2.75 54.84 32.24
1,410.23 1,452.07 1,363.01 1,125.90 954.84
Current assets
Inventories XX 105.72 67.66 40.47 0.20 0.20
Trade receivables XXI 647.63 536.64 459.94 339.78 318.70
Cash and cash equivalents XXII 114.02 121.32 293.77 452.35 161.28
Short-term loans and advances XVIII 561.94 487.93 410.82 369.09 206.07
Other current assets XXIII 172.65 136.18 66.35 69.63 25.39
1,601.96 1,349.73 1,271.35 1,231.05 711.64
Total Assets.. 3,012.19 2,801.80 2,634.36 2,356.95 1,666.48
Notes:
1. The above statement should be read with the annexures to restated consolidated summay statements of assets and liabilites, statement of profit & loss and cash flow as appearing in
annexure IV.
2. Refer annexure XLIX for material adjustment.
CL Educate Limited
Expenses
Cost of raw material and components consumed XXVI A 93.65 78.97 17.69 - -
Cost of services XXVI B 519.44 526.04 388.83 363.58 367.48
Purchases of stock-in-trade XXVII 16.31 13.17 53.01 28.52 45.79
(Increase) in inventories of finished goods, work-in-progress and traded XXVIII (39.91) (27.38) (18.12) - (0.20)
goods
Employee benefit expenses XXIX 686.57 674.64 620.72 358.57 344.10
Finance costs XXX 89.70 101.06 74.00 43.37 24.35
Depreciation and amortisation expense XXXI 54.69 55.97 46.00 32.12 28.23
Other expenses XXXII 659.19 610.87 469.57 357.64 346.14
Total expenses (II) 2,079.64 2,033.34 1,651.70 1,183.80 1,155.89
Profit before exceptional items, tax and minority interest (I-II) 217.43 186.97 109.08 148.65 72.83
Exceptional items (net) XLVII 13.26 - 191.94 - -
Profit/(loss) before tax and minority interest 204.17 186.97 (82.86) 148.65 72.83
Income tax expense:
For current year:
-Current tax 63.81 30.17 23.88 51.18 27.46
-Minimum alternate tax ('MAT') credit (25.42) (16.62) (7.74) (0.12) (1.38)
-Deferred tax (benefit)/charge 2.54 25.99 (37.10) 26.95 7.98
Total tax expenses 40.93 39.54 (20.96) 78.01 34.06
Profit/(loss) after tax before minority interest 163.24 147.43 (61.90) 70.64 38.77
Share of minority in loss for the year 8.44 2.73 (9.10) (18.06) (7.73)
Profit/(loss) after tax 154.80 144.70 (52.80) 88.70 46.50
1. The above statement should be read with the annexure to restated consolidated summay statements of assets and liabilites, statement of profir & loss and cash flow as appearing in
annexure IV
2. Refer annexure XLIX for material adjustment.
CL Educate Limited
Annexure III - Restated consolidated summary statement of cash flow
(൘ in Million)
For the year ended on March 31
Particulars
2014 2013 2012 2011 2010
A Cash flow from operating activities
Net profit/ (loss) before tax and minority interest and after prior 204.17 186.97 (82.86) 148.65 72.83
period items
Adjustments for:
Depreciation and amortisation 54.69 55.97 46.00 32.12 28.23
Depreciation and amortisation on investment property 0.22 0.21 0.21 - -
Interest expense 84.16 96.82 71.15 43.23 21.91
Loan processing charges 2.67 2.60 2.20 - 2.17
Interest income (76.25) (64.84) (78.03) (44.80) (24.05)
(Gain)/ loss on fixed assets sold (0.24) (7.03) - (1.96) -
Fixed assets written off 0.68 0.92 1.64 - 1.70
Transfer to employee stock option outstanding 0.85 3.44 3.36 (0.46) 2.13
Amortisation of preliminary expenses - 0.07 0.07 0.07 0.07
Dividend paid 0.03 0.02 - - -
Advances and deposits written off 2.13 123.22 1.96 2.85 0.92
Bad debts written off 47.11 34.72 42.16 28.02 16.78
Rent on investment properties (0.30) (0.66) (2.68) (3.08) (1.76)
Bad debts recovered (0.81) (0.57) (0.72) (0.53) (0.27)
Liability no longer required written back (18.09) (33.05) (17.32) (4.78) (9.07)
Provision for doubtful advances 0.85 3.08 3.00 1.95 0.34
Provision no longer required written back (3.08) (112.88) - - -
Exceptional non cash items:
Advances written off 13.26 - 60.70 - -
Doubtful receivables written off - - 31.93 - -
Provision for doubtful advances - - 112.88 - -
Gain on sale of fixed assets - - (13.57) - -
Gain on sale of investment - - - - (4.62)
Unrealised foreign exchange gain (1.53) (0.48) (1.46) (0.10) 2.40
Realised foreign exchange loss on sale of investment 9.45 - - - -
Operating profit before working capital changes 319.97 288.53 180.62 201.18 109.71
Taxes paid (net of refund including interest on refund) (55.29) (28.79) (6.45) (60.52) (44.67)
Net cash generated /(used in) from operating activities 98.26 59.60 (193.01) 138.48 20.03
Purchase of fixed assets (including capital advances and fixed assets (43.61) (78.98) (241.51) (154.53) (256.38)
related payable)
Proceeds from sale of fixed assets - 0.36 143.32 17.74 18.70 -
Proceeds from sale of investment - - - - 9.30
Share application money pending allotment - - - - (5.00)
Purchase of investment of in subsidiaries (47.91) (37.68) (73.13) - -
Inter-corporate deposits (net) (0.01) 7.29 3.70 6.28 (1.17)
Purchase of investment of in others - - (5.00) - -
Realisation from fixed deposits (net) 75.85 (16.15) 134.75 (275.09) 67.57
Loan given (48.46) (130.33) 30.84 (142.17) (73.99)
Rental Income 0.30 0.66 2.68 3.08 1.76
Interest received 52.23 64.45 79.23 39.62 29.35
Net cash used in Investing activities (11.25) (47.42) (50.70) (504.11) (228.56)
&RQWLQXHGRQQH[WSDJH«
CL Educate Limited
Annexure III - Restated consolidated summary statement of cash flow
Proceeds from issue of equity shares of subsidiary company (net of 2.13 18.19 (8.68) 186.33 2.10
minority adjustments)
Security premium 0.35 141.60 107.99 240.92 -
Share application money received 13.86 (29.45) (70.86) 100.31 -
Proceeds from long-term borrowings (including current maturities) 35.00 505.84 266.16 55.65 244.57
Repayment of long-term borrowings (116.96) (582.17) (231.67) (55.39) (53.57)
Proceeds from short-term borrowings (net) 59.12 60.98 181.14 (68.75) 46.07
Loan processing fee paid (2.67) (2.60) (2.20) - (2.09)
Dividend paid (0.03) (0.02) - - -
Share issue expenses (0.03) (6.00) - (11.92) (0.19)
Interest paid (Include interest capitalised) (84.80) (100.80) (71.04) (44.26) (18.52)
Net cash flow from financing activities (94.03) 5.57 170.84 402.89 218.37
Net increase / (decrease) in cash and cash equivalents (7.02) 17.75 (72.87) 37.26 9.84
Unrealised foreign exchange gain on cash and cash equivalents 0.02 (0.98) (1.58) (0.33) -
Cash and cash equivalents at beginning of the year 60.81 44.04 118.49 81.56 71.72
Adjustment on account of acquisition of subsidiary
Cash and cash equivalents at end of the year 53.81 60.81 44.04 118.49 81.56
Add:
Fixed deposits shown under Cash and bank balances 60.21 60.51 249.73 333.86 79.72
Total cash and bank balances at end of the year 114.02 121.32 293.77 452.35 161.28
Notes :
1. The above restated consolidated summary statement of cash flows has been prepared under the "Indirect Method" as set out in Accounting Standard-3 on "Cash Flow Statement" [notified
under the Companies Act, 1956 read with general circular 15/2003 dated September 13, 2013 issued by Ministary of Corporate Affairs, in respect section 133 of Companies Act, 2013].
2. The above restated consolidated summary statement of cash flows has been complied from and is based on the restated consolidated summary statement of assets and liabilities as at
March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011 and March 31, 2010, and the restated consolidated summary statement of profit and loss for the year ended on that date.
THE OFFER
Of which
A. QIB Category* 2,000,000 Equity Shares
Of which
Available for allocation to Mutual Funds only >Ɣ@(TXLW\6KDUHV
Balance for all QIBs including Mutual Funds >Ɣ@(TXLW\6KDUHV
Notes
1. The Offer comprises the Fresh Issue which shall constitute 14.77% of our post-Offer equity share capital and
the Offer for Sale shall constitute 14.51% of our post-Offer equity share capital.
2. The Selling Shareholders are offering upto 1,982,522 Equity Shares, which have been held by them for a
period of at least one year as on the date of filing of this Draft Red Herring Prospectus. For more
informationVHH³Capital Structure´RQSDJH61.
3. Our Company will not receive any proceeds from the Offer for Sale.
4. Allocation to all categories, except the Anchor Investor Portion and the Retail Category, if any, shall be
made on a proportionate basis. For more informationVHH³Offer Procedure´RQSDJH428.
5. Under-subscription, if any, in any category, except the QIB Category, would be met with spill-over from
any other category or categories, as applicable, at the discretion of the IPO Committee of our Company in
consultation with the BRLM and the Designated Stock Exchange, on a proportionate basis, subject to
applicable laws.
)RUGHWDLOVLQFOXGLQJLQUHODWLRQWRJURXQGVIRUUHMHFWLRQRI%LGVUHIHUWRWKH³Offer Procedure´RQSDJH428.
For details RIWKHWHUPVRIWKH2IIHUVHH³Terms of the Offer´RQSDJH425.
52
GENERAL INFORMATION
)RU PRUH LQIRUPDWLRQ RQ FKDQJHV LQ RXU 5HJLVWHUHG 2IILFH VHH ³History and Certain Corporate Matters´ RQ
page 138.
Board of Directors
The following table sets out the current details regarding our Board as on the date of the filing of this Draft Red
Herring Prospectus:
DIN: 00307326
Gautam Puri 49 R-90, Greater Kailash-I, New Delhi 110 048,
India
53
Name, Designation and DIN Age Address
Designation: Vice Chairman and Managing Director
DIN: 00033548
Nikhil Mahajan 43 House No. 457, Sector 30, Faridabad 121 003,
Haryana, India
Designation: Executive Director and Chief Financial
Officer
DIN: 00033404
Gopal Jain 43 1/E, First Floor, Ramalyam, 46 Peddar Road,
Mumbai 400 026, Maharashtra, India
Designation: Nominee Director
DIN: 00032308
Madhumita Ganguli 58 R-302, Greater Kailash Part 1, New Delhi 110
048, India
Designation: Nominee Director
DIN: 00676830
Sridar A. Iyengar 67 85, Fair Oaks Lane, Athereton, CA 94027,
United States of America
Designation: Independent Director
DIN: 00278512
Safir Anand 43 1, Jaipur Estate, Nizamuddin East, New Delhi
110 013, India
Designation: Independent Director
DIN: 02117658
Viraj Tyagi 44 Building No. 9, Flat No. G-01, Palm Springs,
16th Main, 7th Cross, 4th Block, Koramangala,
Designation: Independent Director Bengaluru 560 034, India.
DIN: 01760948
Kamil Hasan 70 12182, Parker Ranch Road, Saratoga, CA
95070, United States of America
Designation: Independent Director
DIN: 03457252
Sangeeta Bhagwatiprasad Modi 44 Flat No. 16, Retreat 1, Saraswat Colony,
Opposite HDFC Bank, Santacruz West,
Designation: Independent Director Mumbai 400 054, Maharashtra, India
DIN: 03278272
Talat Hasan, aged 62 years, DIN ± 02821005, residing at 12182, Parker Ranch Road, Saratoga, CA 95070,
United States of America, has been appointed as an alternate Director to Kamil Hasan.
Rachna Sharma
DTJ 925, DLF Tower-B
Jasola District Centre
New Delhi 110 025, India
Tel: +91 (11) 4507 0311
Fax: +91(11) 4504 0166
E-mail: compliance@cleducate.com
54
Bidders may contact our Company Secretary and Compliance Officer, the BRLM or the Registrar to the Offer in
case of any pre-Offer or post-Offer related problems such as non-receipt of letters of Allotment and credit of
Allotted Equity Shares in the respective beneficiary account or refund orders.
Nikhil Mahajan
DTJ 925, DLF Tower-B
Jasola District Centre
New Delhi 110 025, India
Tel: +91 (11) 4507 0311
Fax: +91 (11) 4504 0166
E-mail: nikhil.mahajan@careerlauncher.com
Syndicate Members
>Ɣ@
Plot No. 17 to 24
Vithal Rao Nagar, Madhapur
Hyderabad 500 081, India
55
Tel: 1800 3454001/+91 (40) 4465 5000
Fax: +91 (40) 2343 1551
E-mail: einward.ris@karvy.com
Investor Grievance E-mail: cleducate.ipo@karvy.com
Website: http://karisma.karvy.com
Contact Person: M. Murali Krishna
SEBI Registration Number: INR000000221
Investors may contact the BRLM for any complaint pertaining to the Offer. All grievances relating to the non-
ASBA process must be addressed to the Registrar to the Offer quoting the full name of the sole or first Bidder,
%LGFXP$SSOLFDWLRQ)RUPQXPEHU%LGGHUV¶'3,'&OLHQW,'3$1QXPEHURI(TXLW\6KDUHVDSSOLHGIRUGDWH
of Bid cum Application Form, name and address of the Syndicate Member or the Registered Broker where the
Bid was submitted and cheque or draft number and issuing bank thereof.
All grievances relating to the ASBA process may be addressed to the Registrar to the Offer, with a copy to the
relevant SCSB or the member of the Syndicate if the Bid was submitted to a member of the Syndicate at any of
the Specified Locations, or the Registered Broker if the Bid was submitted to a Registered Broker at any of the
Broker Centers, as the case may be, quoting the full name of the sole or first Bidder, Bid cum Application Form
QXPEHU%LGGHUV¶'3,'&OLHQW,'3$1QXPEHURI(TXLW\6KDUHVDSSOLHGIRUGDWHRI%LGFXP $SSOLFDWLRQ
Form, name and address of the member of the Syndicate or the Designated Branch or the Registered Broker, as
the case may be, where the Bid was submitted and ASBA Account number in which the amount equivalent to
the Bid Amount was blocked.
>Ɣ@
Refund Banks
>Ɣ@
The list of banks that have been notified by SEBI to act as SCSBs for the ASBA process is provided on the
website of the SEBI (http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-Intermediaries) and updated
from time to time. For details on Designated Branches of SCSBs collecting the Bid cum Application Forms,
refer to the website of the SEBI (http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-
Intermediaries).
In relation to ASBA Bids submitted to a member of the Syndicate, the list of branches of the SCSBs at the
Specified Locations named by the respective SCSBs to receive deposits of Bid cum Application Forms from the
members of the Syndicate is available on the website of the SEBI
(http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-Intermediaries) and updated from time to time.
For more information on such branches collecting Bid cum Application Forms from the Syndicate at Specified
56
Locations, see the website of the SEBI (http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-
Intermediaries).
Broker Centers
Bidders can submit Bid cum Application Forms with the Registered Brokers at the Broker Centers, a list of
which is available at the websites of the Stock Exchanges at www.bseindia.com and www.nseindia.com,
respectively. In relation to ASBA Bids submitted to the Registered Brokers at the Broker Centers, the list of
branches of the SCSBs at the Broker Centers named by the respective SCSBs to receive deposits of the Bid cum
Application Forms from the Registered Brokers is available on the website of the SEBI (www.sebi.gov.in) and
updated from time to time.
Credit Rating
Trustees
IPO Grading
No credit agency registered with SEBI has been appointed in respect of obtaining grading for the Offer.
Monitoring Agency
As the size of the Fresh Issue is less than ` 5,000 million, the appointment of a monitoring agency is not
required.
Appraisal Agency
No appraising agency has been appointed in respect of any project of our Company.
Experts
Except for the report of our Auditors on the restated consolidated and restated standalone financial statements
and the statement of tax benefits included in this Draft Red Herring Prospectus on pages 167 and 93,
respectively, our Company has not obtained any expert opinion.
The following table sets forth the responsibilities of the BRLM in relation to this Offer.
S. No. Activity
1 Capital Structuring with relative components and formalities such as type of instruments, etc.
Due diligence of Company's operations/ management/ business plans/ legal etc. Drafting and design of offer
documents including memorandum containing salient features of the offer document. The BRLM shall ensure
2
compliance with stipulated requirements and completion of prescribed formalities with the Stock Exchange(s),
RoC and SEBI including finalization of the offer documents and RoC filing.
57
S. No. Activity
3 Drafting and approval of all statutory advertisements.
Drafting and approval of all publicity material other than statutory advertisements, including non-statutory/
4
corporate advertisement and brochures
5 Appointment of intermediaries: Registrar, Advertising Agency, Bankers to the Offer and Printers
Marketing strategy for domestic institutions including banks, mutual funds, etc., finalizing the list and division of
6 investors for one to one meetings, in consultation with the Company and the Selling Shareholders, and finalizing
the investor meeting schedules.
Non-Institutional and retail marketing of the Offer, which will include inter alia, formulating marketing strategies,
preparation of publicity budget, finalizing media and public relations strategy, finalizing centers for holding
7
conferences for press and brokers, deciding on the quantum of issue material and following-up on distribution of
publicity and issue material including forms, prospectuses, etc.
8 Co-ordination with Stock Exchange(s) for Book Building software, bidding terminals and mock trading
9 Managing the book and finalization of pricing, in consultation with the Company and the Selling Shareholders
The post bidding activities including management of escrow accounts, co-ordination of institutional and non-
institutional allocation, intimation of allocation and dispatch of refunds to bidders etc. The post-Offer activities for
the Offer involving essential follow up steps, which include the finalization of trading and dealing of instruments
10 and demat delivery of Equity Shares, with the various agencies connected with the work such as the Registrar to
the Offer and Bankers to the Offer, SCSBs and the bank(s) handling refund business. The BRLM shall be
responsible for ensuring that these agencies fulfil their functions and enable it to discharge this responsibility
through suitable agreements with the Company and the Selling Shareholders
Book building refers to the process of collection of Bids on the basis of the Red Herring Prospectus and the Bid
cum Application Forms. The Offer Price will be finalized after the Bid/Offer Closing Date. The principal parties
involved in the Book Building Process are:
x our Company;
x the Selling Shareholders;
x the BRLM;
x the Syndicate Members (who are registered with the SEBI or registered as brokers with the Stock
Exchanges and eligible to act as underwriters);
x the Registrar to the Offer;
x the Registered Brokers;
x the Escrow Collection Banks; and
x the SCSBs.
Pursuant to Rule 19(2)(b)(i) of the SCRR, the Offer is being made for at least 25% of the post-Offer paid up
Equity Share capital of our Company. The Offer is being made through the Book Building Process where 50%
of the Offer will be available for allocation to QIBs on a proportionate basis, provided that the IPO Committee
of our Company may allocate up to 60% of the QIB Category to Anchor Investors at the Anchor Investor Offer
Price, on a discretionary basis, of which at least one-third will be available for allocation to domestic Mutual
Funds. Further, 5% of the QIB Category (excluding the Anchor Investor Portion) will be available for allocation
on a proportionate basis to Mutual Funds only. The remainder will be available for allocation on a proportionate
basis to all QIBs including Mutual Funds, subject to valid Bids being received at or above the Offer Price.
Further, not less than 15% of the Offer will be available for allocation on a proportionate basis to Non-
Institutional Investors subject to valid Bids being received at or above the Offer Price. Further, not less than
35% of the Offer will be available for allocation to Retail Individual Investors in accordance with SEBI ICDR
Regulations, subject to valid Bids being received at or above the Offer Price. Under-subscription, if any, in any
category, except the QIB Category, would be met with spill-over from any other category or categories, as
applicable, at the discretion of the IPO Committee of our Company in consultation with the BRLM and the
Designated Stock Exchange, on a proportionate basis, subject to applicable law.
QIBs and Non-Institutional Investors can participate in this Offer only through the ASBA process and
Retail Individual Investors have the option to participate through the ASBA process. Anchor Investors
are not permitted to participate through the ASBA process.
QIBs and Non-Institutional Investors are not permitted to withdraw their Bid(s) or lower the size of their
Bid(s) (in terms of quantity of Equity Shares or the Bid Amount) at any stage. Retail Individual Investors
58
can revise their Bid(s) during the Bid/ Offer Period and withdraw their Bid(s) until finalization of Basis of
Allotment. Anchor Investors are not allowed to withdraw their Bids after the Anchor Investor Bidding
Date. For more informationVHH³Offer Structure´RQSDJH421.
Our Company will comply with the SEBI ICDR Regulations and any other ancillary directions issued by SEBI
for the Offer. The Selling Shareholders will comply with the SEBI ICDR Regulations in relation to their
respective Offer for Sale portions. In this regard, our Company and the Selling Shareholders have appointed the
BRLM to manage the Offer and procure subscriptions to the Offer.
The Book Building process under the SEBI ICDR Regulations is subject to change from time to time and
Bidders are advised to make their own judgment about investment through the Book Building process
prior to making a Bid in the Offer.
Illustration of Book Building and Price Discovery Process (Investors should note that this example is solely
for illustrative purposes and is not specific to the Offer; and also excludes bidding under the ASBA process)
Bidders can bid at any price within the Price Band. For instance, assume a price band of ` 20 to ` 24 per equity
share, issue size of 3,000 equity shares and receipt of five bids from bidders, details of which are shown in the
table below. A graphical representation of the consolidated demand and price would be made available at the
bidding centers during the bidding period. The illustrative book below shows the demand for the equity shares
of the issuer company at various prices and is collated from bids received from various investors.
The price discovery is a function of demand at various prices. The highest price at which the issuer is able to
issue the desired number of shares is the price at which the book cuts off, i.e., ` 22 in the above example. The
issuer, in consultation with the book running lead manager will, finalize the issue price at or below such cut-off
price, i.e., at or below ` 22. All bids at or above this issue price are valid bids and are considered for allocation
in the respective categories.
1. Check eligibility for making a Bid (For more information VHH ³Offer Procedure - Who Can Bid´ RQ
page 429).
2. Ensure that you have a dematerialised account and the dematerialised account details are correctly
mentioned in the Bid cum Application Form, as applicable.
3. Ensure correctness of your PAN, DP ID and Client ID mentioned in the Bid cum Application Form.
Based on these parameters, the Registrar to the Offer will obtain the Demographic Details of the Bidders
from the Depositories.
4. Except for Bids on behalf of the Central or State Government officials, residents of Sikkim and the
officials appointed by the courts, who may be exempt from specifying their PAN for transacting in the
securities market, for Bids of all values ensure that you have mentioned your PAN allotted under the
Income Tax Act in the Bid cum Application Form. The exemption for Central or State Governments and
officials appointed by the courts and for investors residing in Sikkim is subject to the Depositary
3DUWLFLSDQW¶V YHULILFDWLRQ RI WKH YHUDFLW\ RI VXFK FODLPV RI WKH LQYHVWRUV E\ FROOHFWLQJ VXIILFLHQW
documentary evidence in support of their claims.
5. Ensure that the Bid cum Application Form is duly completed as per instructions given in the Red Herring
Prospectus, the General Information Document for Investing in Public Issues prepared and issued in
accordance with the circular (CIR/CFD/DIL/12/2013) dated October 23, 2013 notified by SEBI in the
Bid cum Application Form.
59
6. Bids by ASBA Bidders will have to be submitted to the designated branches of the SCSBs or to the
Syndicate at the Specified Locations or to the Registered Brokers at the Broker Centers. Ensure that the
SCSB where the ASBA Account (as specified in the Bid cum Application Form) is maintained has
named at least one branch at the Specified Location or the Broker Center for the members of the
Syndicate or the Registered Broker, respectively, to deposit Bid cum Application Forms (a list of such
branches is available at the website of the SEBI at
http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-Intermediaries).
7. Bids by ASBA Bidders may be submitted in the physical mode to the Syndicate at the Specified
Locations or to the Registered Brokers at the Broker Centers and either in physical or electronic mode, to
the SCSBs with whom the ASBA Account is maintained. ASBA Bidders should ensure that the ASBA
Accounts have adequate credit balance at the time of submission to the SCSB or the Syndicate or the
Registered Brokers to ensure that the Bid cum Application Form is not rejected.
8. Bids by QIBs (other than Anchor Investors) and Non-Institutional Investors must be submitted through
the ASBA process only.
Underwriting Agreement
After the determination of the Offer Price but prior to the filing of the Prospectus with the RoC, our Company
and the Selling Shareholders will enter into an Underwriting Agreement with the Underwriters for the Equity
Shares proposed to be offered through the Offer. It is proposed that pursuant to the terms of the Underwriting
Agreement, the BRLM will be responsible for bringing in the amount devolved, in the event any of its Syndicate
Members do not fulfill their underwriting obligations. Pursuant to the terms of the Underwriting Agreement, the
obligations of the Underwriters will be several and will be subject to certain conditions to closing, as specified
therein.
7KH 8QGHUZULWLQJ $JUHHPHQW LV GDWHG >Ɣ@ The Underwriters have indicated their intention to underwrite the
following number of Equity Shares:
This portion has been intentionally left blank and will be filled in before filing of the Prospectus with the RoC
(` in million)
Name, address, telephone, fax and e-mail of the Indicative Number of Amount
Underwriters Equity Shares to be Underwritten
Underwritten
>Ɣ@ >Ɣ@ >Ɣ@
>Ɣ@ >Ɣ@ >Ɣ@
The abovementioned amounts are provided for indicative purposes only and would be finalized after the pricing
and actual allocation and subject to the provisions of Regulation 13(2) of the SEBI ICDR Regulations.
In the opinion of our Board of Directors (based on representations made to our Company by the Underwriters),
the resources of the Underwriters are sufficient to enable them to discharge their respective underwriting
obligations in full. The Underwriters are registered with the SEBI under Section 12(1) of the SEBI Act or
registered as brokers with the Stock Exchange(s).
Allocation among the Underwriters may not necessarily be in proportion to their underwriting commitments set
forth in the table above. Notwithstanding the above table, the Underwriters shall be severally responsible for
ensuring payment with respect to Equity Shares allocated to investors procured by them. In the event of any
default in payment, the respective Underwriter, in addition to other obligations defined in the Underwriting
Agreement, will also be required to procure subscriptions for/subscribe to Equity Shares to the extent of the
defaulted amount in accordance with the Underwriting Agreement.
60
CAPITAL STRUCTURE
The share capital of our Company, as of the date of this Draft Red Herring Prospectus is set forth below:
(`)
Aggregate value at Aggregate value at
face value Offer Price
A. Authorized Share Capital*
16,000,000 Equity Shares of ` 10 each 160,000,000 -
C. The Offer**
Offer of upto 4,000,000 Equity Shares of ` 10 each 40,000,000 >Ɣ@
Of which:
Fresh Issue of 2,017,478 Equity Shares of ` 10 each 20,174,780 >Ɣ@
Offer for Sale of upto 1,982,522 Equity Shares of ` 10 each 19,825,220 >Ɣ@
Of which:
QIB Category of 2,000,000 Equity Shares*** 20,000,000 >Ɣ@
Of which:
- Available for allocation to Mutual Funds only >Ɣ@ >Ɣ@
- Balance for all QIBs including Mutual Funds >Ɣ@ >Ɣ@
Non Institutional Category of not less than 600,000 Equity Shares 6,000,000 >Ɣ@
Retail Category of not less than 1,400,000 Equity Shares 14,000,000 >Ɣ@
The specified securities constituting the Offer for Sale have been held by the respective Selling Shareholders for
a period of more than one year prior to the filing of this Draft Red Herring Prospectus. Where any Equity Shares
forming a part of the Offer for Sale have been acquired by the Selling Shareholders on conversion of
compulsorily convertible securities of the Company, the period of one year has been computed by aggregating
the time for which the compulsorily convertible securities were held and the time for which the resultant Equity
Shares have been held.
(i) Set forth below is the Equity Share capital history of our Company:
62
Date of Number of Face Issue Nature of Nature of allotment Cumulative
allotment Equity value Price Consideration paid-up Equity
Shares (``) (``) Share capital
(`)
conversion of 5,200 fully
convertible debentures11
October 9, 26,045 2 2 Cash Preferential allotment12 6,445,260
2002
December 26, 2,260 2 200 Other than cash Preferential allotment13 6,449,780
2002
January 10, 53,721 2 6 Cash Preferential allotment14 6,557,222
2003
April 18, 2003 250 2 70 Cash Preferential allotment 15 6,557,722
September 13, 19,673,16 2 - N.A. Bonus issue of six Equity 45,904,054
2004 6 Shares for every one Equity
Share held16
January 25, 75,000 2 2 Cash Preferential allotment 17 46,054,054
2005
February 23, 50,000 2 2 Cash Preferential allotment 18 46,154,054
2005
March 17, 37,500 2 2 Cash Preferential allotment 19 46,229,054
2005
September 13, 67,981 2 2 Cash Allotment against exercise 46,365,016
2005 of options granted under
ESOP 200120
September 23, 2,800 2 2 Cash Preferential allotment 21 46,370,616
2005
September 18, 99,615 2 14 Cash Allotment against exercise 46,569,846
2006 of options granted under
ESOP 200122
October 13, 140 2 11 Cash Allotment against exercise 46,570,126
2006 of options granted under
ESOP 200123
15,708 2 9 Cash Preferential Allotment24 46,601,542
December 1, 19,345 2 14 Cash Allotment against exercise 46,640,232
2006 of options granted under
ESOP 200125
January 15, 15,246 2 9 Cash Allotment against exercise 46,670,724
2007 of options granted under
ESOP 200126
7,500 2 11 Cash Allotment against exercise 46,685,724
of options granted under
ESOP 200127
7,515 2 14 Cash Allotment against exercise 46,700,754
of options granted under
ESOP 200128
3XUVXDQWWRDVKDUHKROGHUV¶UHVROXWLRQGDWHG)HEUXDU\ILYHHTXLW\VKDUHVRIIDFHYDOXH ` 2 each were consolidated
into one Equity Share of ` 10 each, therefore, 23,350,377 equity shares of ` 2 each were consolidated to 4,670,076 Equity
Shares of ` 10 each.
February 21, 341,000 10 10 Cash Preferential allotment29 50,110,760
2007
February 28, 2,505,538 10 - N.A. Bonus issue of one Equity 75,166,140
2007 Share for every two Equity
Shares held30
April 14, 2007 3,050 10 45 Cash Preferential allotment 31 75,196,640
July 16, 2007 5,555 10 70 Cash Allotment against exercise 75,252,190
of options granted under
ESOP 200132
37,500 10 70* Cash Allotment against exercise 75,327,190*
of options granted under
ESOP 200133
September 15, 7,500 10 300 Cash Preferential Allotment34 75,402,190
2007 21,000 10 45** Cash Preferential Allotment35 75,444,190**
15,000 10 45 Cash Preferential Allotment36 75,594,190
63
Date of Number of Face Issue Nature of Nature of allotment Cumulative
allotment Equity value Price Consideration paid-up Equity
Shares (``) (``) Share capital
(`)
October 17, 333,333 10 300 Cash Preferential Allotment37 78,927,520
2007
November 7, 748,167 10 300 Cash Preferential Allotment38 86,409,190
2007
March 6, 2008 3,530 10 50 Cash Preferential Allotment39 86,444,490
March 6, 2008 1,570 10 10 Cash Preferential Allotment40 86,460,190
March 6, 2008 184 10 70 Cash Allotment against exercise 86,462,030
of options granted under
ESOP 200141
April 28, 2008 50,000 10 350 Other than cash Preferential allotment42 87,430,030***
May 30, 2009 6,000 10 350 Other than cash Preferential Allotment43 87,490,030
April 29, 2011 1,600 10 300 Cash Allotment against exercise 87,506,030
of options granted under
ESOP 200844
500 10 150 Cash Allotment against exercise 87,511,030
of options granted under
ESOP 200845
November 3, 800 10 300 Cash Allotment against exercise 87,519,030
2011 of options granted under
ESOP 200846
January 27, 1,875 10 175 Cash Allotment against exercise 87,537,780
2012 of options granted under
ESOP 200847
March 16, 580,928 10 417 Cash Conversion of compulsorily 93,347,060
2012 convertible non-cumulative
preference shares
³CCPS´48
May 1, 2012 47,416 10 621 Other than cash Preferential allotment49 93,821,220
Issue of Equity Shares in the last two years
October 31, 8,351 10 10 Other than cash Preferential allotment50 93,904,730
2012 27,337 10 524.95 Other than cash Preferential allotment51 94,178,100
July 22, 2014 235,294 10 425 Cash Conversion of CCPS and 96,531,040
optionally convertible
preference shares
³OCPS´52
September 5, 23,486 10 590 Other than cash Preferential allotment53 96,765,900
2014 904,139 10 590 Other than cash Preferential allotment54 105,807,290
824,233 10 590 Cash Preferential allotment55 114,049,620
2,400 10 300 Cash Allotment against exercise 114,073,620
of options granted under
ESOP 200856
500 10 175 Cash Allotment against exercise 114,078,620
of options granted under
ESOP 200857
September 16, 237,293 10 590 Cash Preferential allotment58 116,451,550
2014
Total 11,645,155 116,451,550
*The issue price towards the 37,500 Equity Shares was received in two installments, i.e., ` 2 per Equity Share on application (which was
appropriated towards the face value) aggregating ` 75,000, and ` 68 per Equity Share on a call, payable on or before March 31, 2008 (of
which ` 8 per Equity Share was appropriated towards the face value) aggregating ` 2,250,000.
** The issue price towards the 21,000 Equity Shares was received in two installments, i.e., ` 2 per Equity Share on application (which was
appropriated towards the face value) aggregating ` 42,000, and ` 43 per Equity Share on a call, payable on or before March 31, 2008 (of
which ` 8 per Equity Share was appropriated towards the face value) aggregating ` 903,000.
***The 37,500 Equity Shares allotted on July 16, 2007 and 21,000 Equity Shares allotted on September 15, 2007 were made fully paid up
on or before March 31, 2008, pursuant to a call made by the Board of Directors in their resolution dated March 6, 2008. Accordingly, the
paid-up Equity Share capital of our Company increased by ` 468,000 as of March 31, 2008.
1
Subscription to 10 Equity Shares each, by Satya Narayanan .R and Gautam Puri.
2
Allotment of 2,100 Equity Shares each, to Satya Narayanan .R and Gautam Puri, and 800 Equity Shares to Ashok Kumar Thadi, pursuant
to the transfer of all assets and liabilities of The Career Launcher, a partnership firm to our Company.
3
Allotment of 2,100 Equity Shares each, to Satya Narayanan .R and Gautam Puri.
4
Allotment of 20,900 Equity Shares each, to Satya Narayanan .R and Gautam Puri, and 4,500 Equity Shares to Sreenivasan .R.
64
5
Allotment to R. Shiva Kumar
6
Allotment of 100 Equity Shares each, to Nikhil Mahajan, Rakesh K. Sehgal and Sanjay Tapriya.
7
Allotment of 216,835 Equity Shares each, to Gautam Puri and Satya Narayanan .R, 38,250 Equity Shares each, to Sreenivasan R. and R.
Shiva Kumar, 850 Equity Shares each, to Nikhil Mahajan, Rakesh K. Sehgal and Sanjay Tapriya.
8
Allotment of 100 Equity Shares to Intel Pacific Inc.
9
Allotment to Intel Pacific Inc.
10
Preferential allotment to Cipher Securities India Private Limited.
11
Allotment of 13,500 Equity Shares to Namit Arora, 3,500 Equity Shares to R.V. Subramanium, 3,000 Equity Shares to Srinivas Vadhri,
2,500 Equity Shares each, to Amitabh Parmar, Bibek Debroy, P.K. Sarangi, Ritu Sahney and Sujoy Bhattacharjee, 1,500 Equity Shares each
to Arun Kumar Jain, Arun Narayan, Arvind Sorang, Ashish Govind Mathur, Ashu Kumar Jain, Balaji Pasumarthy, Jaya Ram NS, K.
Venkatachalam, Mita Bhattacharyya, Neelam Monga, Rakesh K. Sehgal, Shikha Monga and V.V. Murty & Sons.
12
Allotment to Nikhil Mahajan.
13
Allotment to Compassbox.com Global Solutions Limited pursuant to an agreement to sell business dated July 21, 2001.
14
Allotment to Sujit Bhattacharyya.
15
Allotment to Kandarp Kapil Rai Mehta.
16
Allotment of 7,270,350 Equity Shares each, to Satya Narayanan .R and Gautam Puri, 1,282,500 Equity Shares each to Sreenivasan R. and
R. Shiva Kumar, 193,770 Equity Shares to Nikhil Mahajan, 28,500 Equity Shares each, to Rakesh K. Sehgal and Sanjay Tapariya,
1,445,100 Equity Shares to Intel Pacific Inc., 231,210 Equity Shares to Cipher Securities India Private Limited, 322,326 Equity Shares to
Sujit Bhattacharyya, 9,000 Equity Shares each, to Arun Kumar Jain, Arun Narang, Arvind Sorang, Ashish Govind Mathur, Ashu Kumar
Jain, Jaya Ram NS, K. Venkatachalam, Mita Bhattacharyya, Neelam Monga, Shikha Monga, Rakesh K. Sehgal and V.V. Murty & Sons,
15,000 Equity Shares to Bibek Debroy, 81,000 Equity Shares to Namit Arora, 15,000 Equity Shares to P.K. Sarangi, Sujoy Bhattacharjee,
Amitabh Parmar and Ritu Sahney, 21,000 Equity Shares to R.V. Subramaniam, 18,000 Equity Shares to Srinivas Vadhri, 13,560 Equity
Shares to Compassbox.com Global Solutions Limited and 1,500 Equity Shares to Kandarp Kapil Rai Mehta .
17, 18, 19
Allotment to Sujit Bhattacharyya.
20
Allotment to Sachin Malhan.
21
Allotment to Chandra Vijay Singh.
22
Allotment to Sachin Malhan.
23
Allotment to Arjun Wadhwa.
24
Allotment to Arindam Lahiri.
25
Allotment of 1,767 Equity Shares to Jitin Arora, 892 Equity Shares each, to Dheeraj Sharma and Harsh Wadhwa, 714 Equity Shares each,
to Aditya Nath Chaudhary, Akhilesh Jha, Alok Kumar Jha, Asit Kumar, Itishree Mishra, Kamal Krishan, K.K. Pandey, Manav Agarwal,
Manoranjan Mahakud, Pawan Kumar Sharma, Ritu Sehgal, Vinod Bhan, Vishal Mehra and Shivani Gambhir, and 446 Equity Shares each,
to B.S. Rawat, Chandrakant Gogawala, Gajendra Singh, Kandarp Kapil Rai Mehta, Praveen Nair, R. Raj Laxmi, Rahul Sharma, S.D.
Shukla, Salim Ur Rehman, Sanjay Vir, Shiva Pundir, Surjit Singh Dhatwalia and Upendra Kumar Sharma.
26
Allotment to Sharad Awasthi.
27
Allotment to Anup Prasad.
28
Allotment of 2,856 Equity Shares to Dipanjan Das, 2,142 Equity Shares each, to Deepak Madan and Arun Mittal, and 375 Equity Shares
to Jitin Arora.
29
Allotment of 190,000 Equity Shares to Bilakes, 105,000 Equity Shares to Sujit Bhattacharyya and 46,000 Equity Shares to Nikhil
Mahajan.
30
Allotment of 849,726 Equity Shares each, to Satya Narayanan .R and Gautam Puri, 260,000 Equity Shares to Bilakes, 149,898 Equity
Shares each, to Sreenivasan R. and R. Shiva Kumar, 106,353 Equity Shares to Sujit Bhattacharyya, 45,604 Equity Shares to Nikhil
Mahajan, 23,975 Equity Shares to Cipher Securities India Private Limited, 16,760 Equity Shares to Sachin Malhan, 9,450 Equity Shares to
Namit Arora, 3,325 Equity Shares each, to Rakesh K. Sehgal and Sanjay Tapriya, 3,000 Equity Shares to Kunal A Kumthekar, 2,450 Equity
Shares to R.V. Subramanyam, 2,100 Equity Shares to Srinivas Vadhri, 1,750 Equity Shares each, to Amitabh Parmar, P.K. Sarangi, Ritu
Sahney, Sujoy Bhattacharya and Esquire Financial Services Limited, 1,582 Equity Shares to Compassbox.com Global Solutions Limited,
1,569 Equity Shares to Arindam Lahiri, 1,525 Equity Shares to Sharad Awasthi, 1,050 Equity Shares each, to Arun Kumar Jain, Arun
Narayan, Arvind Sorang, Ashish Govind Mathur, Ashu Kumar Jain, Jaya Ram NS, K. Venkatachalam, Mita Bhattacharya, Rakesh K.
Sehgal, V.V. Murthy & Sons, Neelam Monga and Shikha Monga, 750 Equity Shares to Anup Prasad, 286 Equity Shares to Dipanjan Das,
280 Equity Shares Chadra Vijay Singh, 215 Equity Shares each, to Jitin Arora, Deepak Madan and Arun Mittal, 175 Equity Shares to K.K.
Mehta, 90 Equity Shares to Harsh Wadhwa, 89 Equity Shares to Dheeraj Sharma, 72 Equity Shares each to, Aditya Nath Chaudhary,
Akhilesh Jha, Alok Kumar Jha, Asit Kumar, Kamal Krishan, Itishree Mishra, KK Pandey, Manav Agarwal, Manoranjan Mahakud, Pawan
Kumar Sharma, Ritu Sehgal, Vinod Bhan, Shivani Gambhir and Vishal Mishra, 45 Equity Shares each, to B.S. Rawat, Chandrakant
Gogawala, Gajendra Singh, Kandarp Kapil Rai Mehta, Praveen Nair, R. Raj Laxmi, Rahul Sharma, S.D. Shukla, Salim Ur Rehman, Sanjay
Vir, Shiva Pundir, Surjeet Singh Dhatwalia and Upendra Kumar Sharma and 14 Equity Shares to Arjun Wadhwa.
31
Allotment to Sanjay Shivnani.
32
Allotment of 5,355 Equity Shares to Sachin Malhan and 200 Equity Shares to Dipanjan Das.
33
Allotment to Career Launcher Employee Welfare Society.
34
Allotment to Akansha Consultancy Services Limited.
35
Allotment of 7,000 Equity Shares each, to Arindam Lahiri, Sharad Awasthi and Sanjay Shivnani.
36
Allotment of 5,000 Equity Shares each, to Arindam Lahiri, Sharad Awasthi and Sanjay Shivnani.
37
Allotment to Shantanu Prakash.
38
Allotment of 427,196 Equity Shares to GPE (India) Limited and 320,971 Equity Shares to Gaja Trustee Company Private Limited (as
trustee for Gaja Capital India Fund ±I).
39
Allotment of 1,514 Equity Shares to Gaja Trustee Company Private Limited (as trustee for Gaja Capital India Fund ±I)and 2,016 Equity
Shares to GPE (India) Limited.
40
Allotment to Shantanu Prakash.
41
Allotment to Career Launcher Employee Welfare Society.
42
Allotment of 25,137 Equity Shares to Jayaram Krishnan and 24,863 Equity Shares to N. Mahalakshmi, then promoters of Kestone
,QWHJUDWHG0DUNHWLQJ6HUYLFHV3ULYDWH/LPLWHG³Kestone´pursuant to a share purchase agreement dated April 1, 2008 as amended on
March 29, 2009.
43
Allotment of 3,000 Equity Shares each, to Jayaram Krishnan and N. Mahalakshmi, then promoters of Kestone pursuant to a share
purchase agreement dated April 1, 2008 as amended on March 29, 2009.
44
Allotment of 800 Equity Shares each, to Safir Anand and Viraj Tyagi.
65
45
Allotment of 450 Equity Shares to Dipanjan Das and 50 Equity Shares to Akash Goel.
46
Allotment to Sridar Iyengar.
47
Allotment of 1,000 Equity Shares to Ajit Kumar, 625 Equity Shares to Vinod V.V. and 250 Equity Shares to Samiran Datta.
48
Allotment of 189,940 Equity Shares to GPE (India) Limited, 119,904 Equity Shares to Edelweiss Finance & Investments Limited, 59,952
Equity Shares to GHIOF, Mauritius, 49,868 Equity Shares to Gaja Trustee Company Private Limited (as trustee for Gaja Capital India
Fund ±I), 47,961 Equity Shares to N. Lakshmi Narayanan, 23,980 Equity Shares each, to India Infoline Venture Capital Fund and Gopal
Srinivasan, 11,990 Equity Shares each to Pawan Kumar Sachdeva, Gun Nidhi Dalmia, Vinay Mittal and Narayan Ramachandran, 5,995
Equity Shares each, to Anirudh Dutta and Bhargava Das Gupta and 5,393 Equity Shares to Indu Bhushan Sehra.
49
Allotment of 26,079 Equity Shares to Rakesh Mittal and 21,337 Equity Shares to Poonam Mittal, then promoters of GK Publications
3ULYDWH/LPLWHG³GKP´ pursuant to the agreement dated November 12, 2011 as amended on September 29, 2013.
50
Allotment of 4,593 Equity Shares to Rakesh Mittal and 3,758 Equity Shares to Poonam Mittal, then promoters of GKP pursuant to the
agreement dated November 12, 2011 as amended on September 29, 2013.
51
Allotment of 15,035 Equity Shares to Rakesh Mittal and 12,302 Equity Shares to Poonam Mittal, then promoters of GKP pursuant to the
agreement dated November 12, 2011 as amended on September 29, 2013.
52
Allotment of 41,861 Equity Shares to Gaja Trustee Company Private Limited (as trustee for Gaja Capital India Fund ±I) and 193,433
Equity Shares to GPE (India) Limited.
53
Allotment of 12,917 Equity Shares to Rakesh Mittal and 10,569 Equity Shares to Poonam Mittal, then promoters of GKP pursuant to the
agreement dated November 12, 2011 as amended on September 29, 2013.
54
Allotment of 13,393 Equity Shares each to Satya Narayanan .R and Gautam Puri, 458,334 Equity Shares to Bilakes, 108,790 Equity
Shares to Gaja Trustee Company Private Limited (as trustee for Gaja Capital India Fund ±I), 228,010 Equity Shares to SP Family Trust,
59,524 Equity Shares to Dhandaai Investments Private Limited, 3,051 Equity Shares to Sangeeta Gulati, 2,977 Equity Shares to Umesh
Malhotra, 2,381 Equity Shares to Vetri M Subramaniam, 4,762 Equity Shares to Vivek Agrawal, 2,381 Equity Shares each to Rakesh K
Sehgal, Tadigadapa Sriusha, Sanjeev Srivastava and Digant Parikh/Monalisa Parikh, in consideration of 1,898,684 equity shares of ` 10
each of CLEIS acquired by our Company, whereby our Company has issued one Equity Share for every 2.10 equity shares held, of CLEIS.
55
Allotment of 230,000 Equity Shares to GPE (India) Limited and 594,233 Equity Shares to Housing Development Finance Corporation
Limited.
56
Allotment of 800 Equity Shares each to Sridar Iyengar, Safir Anand and Viraj Tyagi.
57
Allotment of 250 Equity Shares each to Rachna Sharma and Akash Goel.
58
Allotment to GPE (India) Limited.
For details of agreements with then promoters of Kestone and GKPVHH³History and Certain Corporate Matters´RQSDJH138.
(ii) Set forth below is the preference share capital history of our Company:
Except as detailed below, no Equity Shares of the Company have been issued for consideration other than cash.
Date of Number of Face Issue Benefits accrued to our Company Equity Share
allotment Equity Shares Value (`) Price Capital (`)
(`)
66
October 31, 5,000 10 10 Allotment of 2,100 Equity Shares each, 50,000
1996 to Satya Narayanan .R and Gautam Puri,
and 800 Equity Shares to Ashok Kumar
Thadi, pursuant to an agreement dated
October 31, 1996 transfer of all assets
and liabilities of The Career Launcher, a
partnership firm, engaged in the business
of providing test preparation and training
services to our Company.
December 26, 2,260 2 200 Allotment of 2,260 Equity Shares to 4,520
2002 Compassbox.com Global Solutions
Limited pursuant to an agreement to sell
business dated July 21, 2001, for the
acquisition of Compassbox.com Global
6ROXWLRQV /LPLWHG¶V EXVLQHVV DV D JRLQJ
concern together with goodwill, trade
name and benefits of intellectual property
rights and its assets and liabilities.
April 28, 2008 50,000 10 350 Allotment of 25,137 Equity Shares to 500,000
Jayaram Krishnan and 24,863 Equity
Shares to N. Mahalakshmi, then
promoters of Kestone pursuant to a share
purchase agreement dated April 1, 2008
as amended on March 29, 2009.*
May 30, 2009 6,000 10 350 Allotment of 3,000 Equity Shares each, 60,000
to Jayaram Krishnan and N.
Mahalakshmi, then promoters of Kestone
pursuant to a share purchase agreement
dated April 1, 2008 as amended on
March 29, 2009.*
May 1, 2012 47,416 10 621 Allotment of 26,079 Equity Shares to 474,160
Rakesh Mittal and 21,337 Equity Shares
to Poonam Mittal, then promoters of
GKP pursuant to the agreement dated
November 12, 2011 as amended on
September 29, 2013.*
October 31, 8,351 10 10 Allotment of 4,593 Equity Shares to 83,510
2012 Rakesh Mittal and 3,758 Equity Shares to
Poonam Mittal, then promoters of GKP
pursuant to the agreement dated
November 12, 2011 as amended on
September 29, 2013.*
27,337 10 524.95 Allotment of 15,035 Equity Shares to 273,370
Rakesh Mittal and 12,302 Equity Shares
to Poonam Mittal, then promoters of
GKP pursuant to the agreement dated
November 12, 2011 as amended on
September 29, 2013.*
September 5, 23,486 10 590 Allotment of 12,917 Equity Shares to 234,860
2014 Rakesh Mittal and 10,569 Equity Shares
to Poonam Mittal, then promoters of
GKP pursuant to the agreement dated
November 12, 2011 as amended on
September 29, 2013.*
67
904,139 10 590 Allotment of 13,393 Equity Shares each 9,041,390
to Satya Narayanan .R and Gautam Puri,
458,334 Equity Shares to Bilakes,
108,790 Equity Shares to Gaja Trustee
Company Private Limited (as trustee for
Gaja Capital India Fund ±I), 228,010
Equity Shares to SP Family Trust, 59,524
Equity Shares to Dhandaai Investments
Private Limited, 3,051 Equity Shares to
Sangeeta Gulati, 2,977 Equity Shares to
Umesh Malhotra, 2,381 Equity Shares to
Vetri M Subramaniam, 4,762 Equity
Shares to Vivek Agrawal, 2,381 Equity
Shares each to Rakesh K Sehgal,
Tadigadapa Sriusha Sanjeev Srivastava
and Digant Parikh/Monalisa Parikh,
pursuant to which our Company acquired
1,898,684 equity shares of ` 10 each of
CLEIS, whereby our Company has issued
one Equity Share for every 2.10 equity
shares held of CLEIS.
*For details of agreements with then promoters of Kestone and GKP and the benefits accrued to our CompanyVHH³History and Certain
Corporate Matters´DQG³Our Business´on pages 138 and 117, respectively.
Further, our Company has issued bonus shares on August, 25, 2000, September 13, 2004 and February 28, 2007.
3. As on the date of this Draft Red Herring Prospectus, our Company has not issued any Equity Shares out
of revaluation reserves.
July 22, 2014 235,294 10 425 Cash Conversion of CCPS and 2,352,940
OCPS1
September 5, 23,486 10 590 Other than cash Preferential allotment2 234,860
2014 904,139 10 590 Other than cash Preferential allotment3 9,041,390
824,233 10 590 Cash Preferential allotment4 8,242,330
2,400 10 300 Cash Allotment against exercise 24,000
of options granted under
ESOP 20085
500 10 175 Cash Allotment against exercise 5,000
of options granted under
ESOP 20086
September 16, 237,293 10 590 Cash Preferential allotment7 2,372,930
2014
1
Allotment of 41,861 Equity Shares to Gaja Trustee Company Private Limited (as trustee for Gaja Capital India Fund ±I) and 193,433
Equity Shares to GPE (India) Limited.
2
Allotment of 12,917 Equity Shares to Rakesh Mittal and 10,569 Equity Shares to Poonam Mittal, then promoters of GKP pursuant to the
agreement dated November 12, 2011 as amended on September 29, 2013.
3
Allotment of 13,393 Equity Shares each to Satya Narayanan .R and Gautam Puri, 458,334 Equity Shares to Bilakes, 108,790 Equity
Shares to Gaja Trustee Company Private Limited (as trustee for Gaja Capital India Fund ±I), 228,010 Equity Shares to SP Family Trust,
59,524 Equity Shares to Dhandaai Investments Private Limited, 3,051 Equity Shares to Sangeeta Gulati, 2,977 Equity Shares to Umesh
Malhotra, 2,381 Equity Shares to Vetri M Subramaniam, 4,762 Equity Shares to Vivek Agrawal, 2,381 Equity Shares each to Rakesh K
Sehgal, Tadigadapa Sriusha Sanjeev Srivastava and Digant Parikh/Monalisa Parikh in consideration of 1,898,684 equity shares of ` 10
each of CLEIS acquired by our Company, whereby our Company has issued one Equity Share for every 2.10 equity shares held, of CLEIS.
4
Allotment of 230,000 Equity Shares to GPE (India) Limited and 594,233 Equity Shares to Housing Development Finance Corporation
Limited.
5
Allotment of 800 Equity Shares each to Sridar Iyengar, Safir Anand and Viraj Tyagi.
6
Allotment of 250 Equity Shares each to Rachna Sharma and Akash Goel.
7
Allotment to GPE (India) Limited.
68
ESOP 2001
ESOP 2008
3XUVXDQW WR D UHVROXWLRQ RI RXU %RDUG RI 'LUHFWRUV GDWHG 0DUFK DQG VKDUHKROGHUV¶ UHVROXWLRQ GDWHG
March 31, 2008, our Company has instituted the Career Launcher Employee Stock Options Plan 2008 which
was implemented with effect from April 1, 2008, which was amended pursuant to a resolution of our Board of
'LUHFWRUV GDWHG $XJXVW DQG VKDUHKROGHUV¶ UHVROXWLRQ GDWHG September 5, 2014 ³ESOP 2008´, and
continues to be in force until May 29, 2015. In accordance with the ESOP 2008, the aggregate number of
options to be granted shall not exceed 3.45% of the total capital of our Company (being 250,000 Equity Shares
of ` 10 each), therefore, 250,000 options could be granted to eligible employees of our Company exercisable
into 250,000 Equity Shares. As on September 22, 2014, our Company has granted 272,468* options convertible
into 167,932 Equity Shares of face value of ` 10 each to eligible employees under the ESOP 2008 of which
55,111 have lapsed, 167,932 have vested, 7,675 have been exercised and 209,682 are outstanding.
More than 5% :
Dipanjan Das 6,000 (16.00%)
Saaket Arora 4,000 (10.67%)
Vinod VV 2,500 (6.67%)
Year 2014-15: Total No. of grants: 23,500
More than 5%
Manav Agarwal 2,000 (8.51%)
Identified directors/employees who were granted Shantanu Prakash (director on the board of CLEIS) was granted
options during any one year equal to exceeding 1% of 142,857 options on January 28, 2009, which was approximately
the issued capital (excluding outstanding warrants and 1.63% of the issued capital at the time of the grant.
conversions) of our Company at the time of grant
Fully diluted EPS pursuant to issue of shares on ` 2.52 per share as on March 31, 2014
exercise of options in accordance with the relevant
accounting standard
Difference, if any, between employee compensation Nil
cost calculated according using the intrinsic value of
stock options and the employee compensation cost
calculated on the basis of fair value of stock options
and impact on the profits of our Company and on the
EPS arising due to difference in accounting treatment
and for calculation of the employee compensation cost
(i.e., difference of the fair value of stock options over
the intrinsic value of the stock options)
Weighted average exercise price and the weighted Weighted average exercise price of Options granted during
average fair value of options whose exercise price the year whose:
either equals or exceeds or is less than the market price Nil
of the stock Weighted average fair value of options granted during the
year whose:
Nil
Method and significant assumptions used to estimate Black Scholes valuation method
the fair value of options granted during the year
Method used (all figures as on March 31, 2014)
Risk free interest rate 8.70%
Expected life
- Director 1.58
- Employee 3.22
Expected volatility 19.04%
Expected dividends 0
Exercise Price ` 175 ± 300
Price of underlying shares (intrinsic value of share) at Refer Annexure:1
the time of the options grant
Intention of the holders of Equity Shares allotted on Not applicable
70
Particulars Details for the
exercise of options to sell their shares within three
months after the listing of Equity Shares pursuant to the
Offer
Intention to sell Equity Shares arising out of the ESOP Not applicable
Scheme within three months after the listing of Equity
Shares by directors, senior management personnel and
employees having Equity Shares arising out of the
ESOP Scheme, amounting to more than 1% of the
issued capital (excluding outstanding warrants and
conversions)
Impact on the profits and on the Earnings Per Share of For fiscal 2014: 853,950
the last three years if the issuer had followed the For fiscal 2013: 3,441,397
accounting policies specified in clause 13 of the For fiscal 2012: 4,226,613
Securities and Exchange Board of India (Employee
Stock Option Scheme and Employee Stock Purchase
Scheme) Guidelines, 1999 in respect of options granted
in the last three years.
*Although a total of 250,000 options were available to be granted, these include grants that had been forfeited/lapsed, and pooled back, and
granted again. At no point of time did the total number of options granted under the plan exceed 250,000.
Annexure 1
Price of underlying shares (intrinsic value of shares) at the date of grant of options
Name of the Employee Category of the employee No. of options Grant date Intrinsic Value
Granted per share (in `)
Sanjay Shivnani Senior Management 12,000 July 26, 2011 350.00
Dipanjan Das Senior Management 6,000 July 26, 2011 350.00
Ajith Kumar Employee 4,000 July 26, 2011 350.00
Vijay Jha Employee of subsidiary 1,500 July 26, 2011 350.00
company (CL Media)
Manav Agarwal Employee 1,000 July 26, 2011 350.00
Johnson K. Varghese Employee 1,000 July 26, 2011 350.00
Akash Goel Employee 1,000 July 26, 2011 350.00
Samiran Dutta Employee 1,000 July 26, 2011 350.00
Rachna Sharma Employee 1,000 July 26, 2011 350.00
Vinod Bhan Employee 1,000 July 26, 2011 350.00
Pawan Sharma Employee of subsidiary 1,500 July 26, 2011 350.00
company (CL Media)
Saaket Arora Employee 4,000 July 26, 2011 350.00
Vinod V. V. Employee 2,500 July 26, 2011 350.00
Sanjeev Srivastava Senior Management 20,000 October 31, 2012 524.94
Piyush Gupta Senior Management 9,000 October 31, 2012 524.94
Vivek Garg Senior Management 5,000 July 26, 2013 524.94
Sanjeev Srivastava Senior Management 5,000 July 22, 2014 590.00
Himanshu Jain Senior Management 2,500 July 22, 2014 590.00
Ajit Kumar Employee 2,500 July 22, 2014 590.00
Piyush Gupta Senior Management 2,500 July 22, 2014 590.00
Niharika Mittal Employee 2,500 July 22, 2014 590.00
Ruchika Employee 2,500 July 22, 2014 590.00
Rachna Sharma Employee 2,000 July 22, 2014 590.00
Vivek Garg Senior Management 2,000 July 22, 2014 590.00
Manav Agarwal Employee 2,000 July 22, 2014 590.00
(i) Build-XSRIRXU3URPRWHUV¶VKDUHKROGLQJLQRXU&RPSDQ\
As on the date of this Draft Red Herring Prospectus, our Promoters hold 7,642,626 Equity Shares, which
constitutes 65.63% of the issued, subscribed and paid-up Equity Share capital of our Company.
Set forth below is the build-up of the equity shareholding of our Promoters, since the incorporation of our
71
Company.
Source of Funds/
Date of No. of equity Face value Issue Price
Cash/other than Nature of allotment
allotment/transfer shares (`) (`)
Cash
Satya Narayanan .R
May 4, 1996 10 10 10 Cash Subscription to the
MoA
October 31, 1996 2,100 10 10 Other than cash Further issue
73
Source of Funds/
Date of No. of equity Face value Issue Price
Cash/other than Nature of allotment
allotment/transfer shares (``) (``)
Cash
Share held
January 25, 2005 75,000 2 2 Cash Preferential
allotment
February 23, 2005 50,000 2 2 Cash Preferential
allotment
March 17, 2005 37,500 2 2 Cash Preferential
allotment
February 21, 2007 105,000 10 10 Cash Preferential
allotment
February 28, 2007 106,353 10 - N.A. Bonus issue of one
Equity Share for
every two Equity
Shares held
April 29, 2011 (5,000) 10 10 Cash Transfer to Pabitra
Bhattacharyya
April 29, 2011 (5,000) 10 10 Cash Transfer to Shefali
Acharya
April 29, 2011 (2,000) 10 10 Cash Transfer to Abhishek
Bhattacharyya
April 29, 2011 (2,000) 10 10 Cash Transfer to Abhirup
Bhattacharyya
April 29, 2011 (2,000) 10 10 Cash Transfer to Sneha
Krishnan
Total (F) 303,062
Bilakes Consulting Private Limited
October 18, 2006 1,650,000 2 32 Cash Acquisition from
Intel Pacific Inc.
February 21, 2007 190,000 10 10 Cash Preferential
allotment
February 28, 2007 260,000 10 - N.A. Bonus issue of one
Equity Share for
every two Equity
Shares held
September 1, 2007 2,000 10 110 Cash Acquisition from
Sachin Malhan
September 5, 2007 134 10 110 Cash Acquisition from
Praveen Nair
September 12, 2007 3,150 10 110 Cash Acquisition from V.
Srinivas and V.
Sakuntala
September 15, 2007 1,575 10 110 Cash Acquisition from
V.V. Murthy & Sons
September 5, 2014 458,334 10 590 Other than cash Preferential
allotment
Total (G) 1,245,193
Total 7,642,626
(A+B+C+D+E+F+
G)
Except for the acquisition of 1,650,000 Equity Shares of ` 2 each on October 18, 2006 for ` 52.80 million by
Bilakes, which was financed pursuant to a loan amounting to ` 56.09 million availed of by Bilakes from HDFC
Bank Limited, New Friends Colony, our Promoters have confirmed to the Company and the BRLM that the
Equity Shares held by our Promoters have been financed from their personal funds or its internal accruals, as the
case may be, and no loans or financial assistance from any bank or financial institution has been availed of by
them for this purpose.
Pursuant to the SEBI ICDR Regulations, an aggregate of at least 20% of the post-Offer Equity Share capital of
our Company held by our Promoters shall be locked for a period of three years from the date of Allotment. All
74
(TXLW\6KDUHVKHOGE\RXU3URPRWHUVDUHHOLJLEOHIRU3URPRWHUV¶FRQWULEXWLRQ
Accordingly, Equity Shares aggregating 20% of the post-Offer expanded capital of our Company, held by our
Promoters shall be locked in for a period of three years from the date of Allotment in the Offer as follows:
For details on build-XS RI (TXLW\ 6KDUHV KHOG E\ RXU 3URPRWHU VHH ³± (i) Build-XS RI RXU 3URPRWHUV¶
shareholding in our Company´DERYH
7KH3URPRWHUV¶FRQWULEXWLRQ KDVEHHQEURXJKWLQWRWKH H[WHnt of not less than the specified minimum lot and
IURPWKHSHUVRQVGHILQHGDVµSURPRWHUV¶XQGHUWKH6(%,,&'55HJXODWLRQV
(a) 7KH VSHFLILHG VHFXULWLHV RIIHUHG IRU PLQLPXP 3URPRWHUV¶ FRQWULEXWLRQ KDYH QRW EHHQ DFTXLUHG LQ WKH
last three years for consideration other than cash and revaluation of assets or capitalization of intangible
assets nor resulted from a bonus issue out of revaluation reserves or unrealized profits of our Company
RUDJDLQVW(TXLW\6KDUHVZKLFKDUHRWKHUZLVHLQHOLJLEOHIRUFRPSXWDWLRQRI3URPRWHU¶VFRQWULEXWLRQ
(b) 7KH PLQLPXP 3URPRWHUV¶ FRQWULEXWLRQ GRHV QRW LQFOXGH DQ\ (TXLW\ 6KDUHV DFTXLUHG GXULQJ WKH
preceding one year at a price lower than the price at which the Equity Shares are being offered to the
public in the Offer;
(c) Our Company has not been formed by the conversion of a partnership firm into a company and thus no
Equity Shares have been issued to the Promoter upon conversion of a partnership firm;
(d) 7KH (TXLW\ 6KDUHV KHOG E\ RXU 3URPRWHUV DQG RIIHUHG IRU PLQLPXP 3URPRWHUV¶ FRQWULEXWLRQ DUH QRW
subject to any pledge; and
(e) All the Equity Shares of our Company held by the Promoters and the Promoter Group shall be held in
dematerialized form prior to filing of the RHP with the RoC.
In accordance with Regulation 37, other than the Equity Shares held by our Promoters which will be locked in
as 3URPRWHUV¶FRQWULEXWLRQIRUWKUHH\HDUV, all pre-Offer Equity Shares (not being sold in the Offer in the Offer
for Sale) shall be subject to lock-in for one year. Further, Equity Shares held by venture capital funds, foreign
venture capital investors and alternate investment funds (including GHIOF Mauritius and Gaja Capital India
Fund ± I (which holds Equity Shares through the Gaja Trustee Company Private Limited)), shall be locked in for
a period of one year from the date of purchase of Equity Shares.
Any Equity Shares Allotted to Anchor Investors in the Anchor Investor Portion shall be locked in for a period of
30 days from the date of Allotment.
The Equity Shares held by persons other than our Promoters prior to the Offer may be transferred to any other
person holding Equity Shares which are locked-in, subject to the continuation of the lock-in in the hands of
transferees for the remaining period and compliance with the Securities and Exchange Board of India
6XEVWDQWLDO$FTXLVLWLRQRI6KDUHVDQG7DNHRYHUV5HJXODWLRQV³Takeover Regulations´
Equity Shares held by our Promoters may be transferred to and among the Promoter Group or to new promoters
or persons in control of our Company, subject to continuation of the lock-in in the hands of the transferees for
the remaining period and compliance with the Takeover Regulations.
The table below presents our shareholding pattern as on date of filing of this Draft Red Herring Prospectus:
Category Category of Shareholder No. of Total No. of No. of Equity Total shareholding as a Shares pledged or
Code Shareholders Equity Shares shares held in percentage of total otherwise encumbered
dematerialized number of shares
form
As a % of As a % of No. of As a % of
(A+B) (A+B+C) shares the total
no. of
shares
(A) Promoter and Promoter
Group
1 Indian
(a) Individuals/ Hindu 19 6,485,967 6,441,247 55.70 55.70 - -
Undivided Family
(b) Central Government/ State - - - - -
Government(s)
(c) Bodies Corporate 1 1,245,193 786,859 10.69 10.69 - -
(d) Financial Institutions/ - - - - - -
Banks
(e) Any other (specify) - - - - - - -
Society/Trust 1 9,760 - 0.08 0.08 - -
Sub- Total(A)(1) 21 7,740,920 7,228,106 66.47 66.47
2 Foreign
(a) Individuals (Non-Resident - - - - - - -
Individuals/ Foreign non
Individuals)
(b) Bodies Corporate - - - - - - -
(c) Institutions - - - - - - -
(d) Qualified Foreign Investor - - - - - - -
(d) Any Others(Specify) - - - - - - -
Sub- Total(A)(2) - - - - - - -
Total Shareholding of 21 7,740,920 7,228,106 66.47 66.47 - -
Promoter and
Promoter Group
(A)= (A)(1)+(A)(2)
(B) Public shareholding
(1) Institutions
(a) Mutual Funds/ UTI - - - - - - -
(b) Financial Institutions / 1 594,233 - 5.10 5.10 - -
Banks
(c) Central Government/ State - - - - - - -
Government(s)
(d) Venture Capital Funds 1 376,409 - 3.23- 3.23- - -
(e) Insurance Companies - - - - - - -
(f) Foreign Institutional - - - - - - -
Investors
76
Category Category of Shareholder No. of Total No. of No. of Equity Total shareholding as a Shares pledged or
Code Shareholders Equity Shares shares held in percentage of total otherwise encumbered
dematerialized number of shares
form
As a % of As a % of No. of As a % of
(A+B) (A+B+C) shares the total
no. of
shares
(g) Foreign Venture Capital 1 59,952 - 0.51 0.51 - -
Investors
(h) Qualified Foreign Investor - - - - -
(i) Any Other (specify)- - - - - -
Foreign Company
Sub-Total (B)(1) 3 1,030,594 - 8.85 8.85 - -
(2) Non-institutions
(a) Bodies Corporate 7 267,546 120,154 2.30 2.30 - -
(b) Individuals
i. Individual shareholders 73 159,498 27,310 1.37 1.37 - -
holding nominal share
capital up to Rs. 0.1
million.
ii. Individual shareholders 16 431,253 174,910 3.70 3.70 - -
holding nominal share
capital in excess of Rs. 0.1
million.
(c) Qualified Foreign - - - - - - -
Investor
(d) Any Other (specify)
Non Resident 5 1,447,706 - 12.43 12.43 - -
India/OCB/Foreign Co
Trusts/HUF 3 567,638 - 4.87 4.87 - -
Sub-Total (B)(2) 104 2,873,641 322,374 24.68 24.68 - -
Total Public 107 3,904,235 322,374 33.53 33.53 - -
Shareholding
(B) = (B)(1)+(B)(2)
TOTAL (A)+(B) 128 11,645,155 7,550,480 100 100 - -
(C) Shares held by - - - - - - -
Custodians and against
which Depository Receipts
have been issued
(1) Promoter and Promoter - - - - - - -
Group
(2) Public - - - - - - -
GRAND TOTAL 128 11,645,155 7,550,480 100 100 - -
(A)+(B)+(C)
The table below presents the shareholding of our Promoter and Promoter Group, who hold Equity Shares as on
the date of filing of this Draft Red Herring Prospectus:
Further, Satya Narayanan .R, Gautam Puri, Nikhil Mahajan, Sapna Puri, Uma Ramachandran are also directors
of our corporate Promoter Bilakes and their shareholding in our Company is mentioned above. In addition,
Shantanu Prakash, a director of our corporate Promoter Bilakes, holds 562,913 Equity Shares in our Company
through the SP Family Trust.
8. The BRLM and its associates currently do not hold any Equity Shares in our Company.
9. The lists of top 10 equity shareholders of our Company and the number of Equity Shares held by them
as on the date of filing, 10 days before the date of filing and two years before the date of filing of this
Draft Red Herring Prospectus are set forth below.
(a) Our top 10 equity shareholders as on the date of filing and 10 days prior to the filing of this Draft Red
Herring Prospectus are as follows:
(b) Our top 10 equity shareholders two years prior to filing of this Draft Red Herring Prospectus, were as
follows:
78
S. No. Name of Shareholder No. of Equity Shares Percentage shareholding
Total 8,534,001 90.96%
10. As on the date of this Draft Red Herring Prospectus, there is no public shareholder holding more than 1%
of the pre-Offer share capital of our Company, except as stated below.
11. Except as provided below, there has been no subscription to or sale or purchase of our Equity Shares,
within three years preceding the date of filing of this Draft Red Herring Prospectus, by our Promoters or
Directors or Promoter Group which in aggregate equals to or is greater than 1% of the pre-Offer share
capital of our Company.
12. Under subscription, if any, in any category, except the QIB Category, would be allowed to be met with
spill-over from any other category or combination of categories at the discretion of our Company in
consultation with the BRLM and the Designated Stock Exchange.
13. As on date of this Draft Red Herring Prospectus, our Company has not allotted any Equity Shares
pursuant to any scheme approved under Sections 391 to 394 of the Companies Act 1956.
14. There are no partly paid-up Equity Shares in our Company. All the Equity Shares offered through the
Offer will be fully paid-up at the time of Allotment.
15. Except as disclosed below, neither the members of our Promoter Group, nor our Promoters, nor our
Directors and their relatives have purchased or sold, or financed the purchase of Equity Shares by any
other person, other than in the normal course of business of the financing entity during the period of six
months immediately preceding the date of filing of this Draft Red Herring Prospectus with SEBI.
Price at
Name of Promoter/ Number of Number which
Date on which
S. Promoter Promoter/Director/Pro Equity of Equity Equity
Equity Shares
No. Group/Directors/ moter Group Shares Shares Shares
Subscribed/Sold
Relatives of Directors Subscribed Sold Subscribed/
Sold
1. Satya Narayanan .R Promoter 13,393 Nil 590 September 5, 2014
2. Gautam Puri Promoter 13,393 Nil 590 September 5, 2014
3. Sridar Iyengar Independent Director 800 Nil 300 September 5, 2014
4. Viraj Tyagi Independent Director 800 Nil 300 September 5, 2014
5. Safir Anand Independent Director 800 Nil 300 September 5, 2014
6. Bilakes Promoter 458,334 Nil 590 September 5, 2014
16. As of the date of the filing of this Draft Red Herring Prospectus, our Company has 128 shareholders
holding Equity Shares.
17. Over-subscription to the extent of 10% of the Offer to the public can be retained for the purpose of
rounding off to the nearer multiple of minimum allotment lot while finalizing the basis of Allotment.
18. Our Promoters, members of our Promoter Group, our Company, the Selling Shareholders, our Directors
and the BRLM have not entered into any buy-back or standby arrangements for purchase of Equity
Shares from any person.
79
19. Other than options outstanding under the ESOP 2008 as disclosed above, there are no outstanding
warrants, options or rights to convert debentures, loans or other convertible instruments into our Equity
Shares as on date of this Draft Red Herring Prospectus.
20. Our Company has not raised any bridge loans against the Net Proceeds.
21. Other than the exercise of any options outstanding under the ESOP 2008 we currently do not intend or
propose any further issue of Equity Shares, whether by way of issue of bonus shares, preferential
allotment and rights issue or in any other manner during the period commencing from the date of filing
of this Draft Red Herring Prospectus with the SEBI until the Equity Shares have been listed on the Stock
Exchanges or all application moneys have been refunded on account of failure of the Offer.
22. We currently do not intend or propose to alter our &RPSDQ\¶Vcapital structure for a period of six months
from the Bid/Offer Opening Date, by way of split or consolidation of the denomination of Equity Shares
or, further issue of Equity Shares (including issue of securities convertible into or exchangeable, directly
or indirectly for Equity Shares) whether on a preferential basis or by way of issue of bonus issue or on a
rights basis or by way of further public issue of Equity Shares or qualified institutional placements or
otherwise, except issue and allotment of Equity Shares under ESOP 2008 upon conversion of options that
may vest and be exercised. However, if we enter into any acquisitions, joint ventures or other
arrangements, we may, subject to necessary approvals, consider raising additional capital to fund such
activity or use the Equity Shares as currency for acquisition or participation in such joint ventures.
23. There shall be only one denomination of the Equity Shares, unless otherwise permitted by law. We shall
comply with such disclosure and accounting norms as may be specified by SEBI from time to time.
24. Our Promoters, members of our Promoter Group and Group Entities will not participate in the Offer,
except for any sale of Equity Shares pursuant to the Offer for Sale.
25. Transactions in Equity Shares by the Promoter and members of the Promoter Group, if any, between the
date of registering the Red Herring Prospectus with the RoC and the Bid/Offer Closing Date shall be
reported to the Stock Exchanges within 24 hours of such transactions being completed.
80
OBJECTS OF THE OFFER
The Offer comprises a Fresh Issue by our Company and an Offer for Sale by the Selling Shareholders.
Our Company will not receive any proceeds of the Offer for Sale by the Selling Shareholders.
Further, our Company expects that the listing of the Equity Shares will enhance our visibility and brand image
among our existing and potential customers.
The main objects clause of our MoA enables us to undertake the activities for which the funds are being raised
by us in the Fresh Issue. Further, the activities we have been carrying out until now are in accordance with the
main objects clause of our MoA.
Offer Proceeds
The details of the proceeds of the Offer are summarized in the table below:
(` in million)
S. No. Particulars Amount*
(a) Gross Proceeds of the Offer [Ɣ]
(b) Proceeds of the Offer for Sale* [Ɣ]
(c) Offer Expenses** [Ɣ]
(d) Net Proceeds of the Fresh Issue (excluding the proceeds of the [Ɣ]
2IIHUIRU6DOHDQGWKH2IIHU([SHQVHV³Net Proceeds´
*To be finalized upon determination of Offer Price.
**All expenses with respect to the Offer will be shared between the Selling Shareholders and the Company, in proportion to the Equity
Shares being offered by them through the Offer.
The Net Proceeds will be utilized as set forth in the table below:
(` in million)
S. Particulars Amount
No.
1. Funding working capital requirements of our Company 308.53
2. Pre-payment of a debt facility availed of by CLIP, our Subsidiary 210.05
3. Investment in CLIP through CLEIS, for capacity expansion and infrastructure development at 209.03
certain Indus World Schools
4. Investment in our Subsidiary GKP for meeting working capital requirements 171.72
5. General corporate purposes* >Ɣ@
Total* >Ɣ@
*To be finalized upon determination of the Offer Price.
We propose to deploy Net Proceeds for the aforesaid purposes in accordance with the estimated schedule of
implementation and deployment of funds set forth in the table below. As of the date of this Draft Red Herring
Prospectus, our Company had not deployed any funds towards objects of the Offer.
81
(` in million)
S. Particulars Amount proposed to Estimated Estimated
No. be funded from the Utilization Utilization in
Net Proceeds in fiscal 2016 fiscal 2017
1. Funding working capital requirements of our 308.53 171.37 137.16
Company
2. Funding pre-payment of a debt facility 210.05 210.05 -
availed of by CLIP, our Subsidiary
3. Investment in CLIP through CLEIS for 209.03 113.23 95.80
capacity expansion and infrastructure
development at certain Indus World Schools
4. Investment in our Subsidiary GKP for 171.72 124.09 47.63
meeting working capital requirements
5. General corporate purposes* >Ɣ@ >Ɣ@ >Ɣ@
6. Total* >Ɣ@ >Ɣ@ >Ɣ@
*To be finalized upon determination of the Offer Price.
Means of finance
We propose to fund the requirements of the objects detailed above entirely from the Net Proceeds. Accordingly,
Paragraph VII C of Part A of Schedule VIII of the SEBI ICDR Regulations (which requires firm arrangements
of finance to be made through verifiable means towards at least 75% of the stated means of finance, excluding
the amount to be raised through the Fresh Issue) does not apply.
Our fund requirements and deployment of the Net Proceeds are based on internal management estimates based
on current market conditions, and have not been appraised by any bank or financial institution or other
independent agency. We operate in highly competitive and dynamic industry and may have to revise our
estimates from time to time on account of changes in external circumstances or costs, or changes in other
financial conditions, business or strategy. In case of variations in the actual utilization of funds earmarked for
the purposes set forth above, increased fund requirements may be financed through our internal accruals and/or
incremental debt, as required. In the event that estimated utilization out of the Net Proceeds in a fiscal is not
completely met, the same shall be utilized in the next fiscal. Any such change in our plans may require
rescheduling of our expenditure programs and increasing or decreasing expenditure for a particular object vis-à-
vis the utilization of Net Proceeds.
We fund the majority of our working capital requirements in the ordinary course of our business from our
internal accruals, financing from various banks and financial institutions and capital raising through issue of
Equity Shares.
Basis of estimation of working capital requirement and estimated working capital requirement
82
S. Particulars Fiscal Holding Fiscal Holding Fiscal Holding
No. 2014 levels 2016 levels 2017 levels
(days) (days) (days)
Other current assets 53.33 - 53.33 - 53.33 -
Total current assets (A) 650.80 968.91 1,154.11
II. Current Liabilities:
Trade payables 112.15 76 133.24 73 153.44 73
Other current liabilities 288.27 - 373.74 - 401.51 -
Short-term provisions 0.46 - 0.56 - 0.63 -
Total current liabilities (B) 400.88 507.54 555.58
III. Total working Capital Requirements (A ± 249.92 461.37 598.53
B)
IV. Funding pattern
Existing working capital facilities from banks 265.00 290.00 290.00
Internal accruals - - -
Part of the Net Proceeds to be utilized 171.37 137.16
Trade Receivables Receivables days as per historic performance from audited financial statements are adjusted for
future expected, though marginal changes in projected Receivables days for various segments of
business separately.
Inventories Inventory days as per historic performance from audited financial statements
Trade Payables Trade payables days as per historic performance from audited financial statements are adjusted
for future expected, though marginal changes in projected payables days for various categories of
payables.
Our Company proposes to utilize ` 308.53 million of the Net Proceeds in fiscal 2016 and fiscal 2017, towards
working capital requirements, for meeting our future business requirements.
M P R & Co., Chartered Accountants, have by a certificate dated September 22 2014, certified the working
capital requirements of our &RPSDQ\6HH³Material Contracts and Documents for Inspection´RQSDJH488.
CLIP, our Subsidiary has availed of a secured term loan facility from Housing Development Finance
Corporation Limited, which we intend to pre-pay from the Net Proceeds. Pre-payment of the loan facility will
reduce our debt to equity ratio on a consolidated basis and our finance costs.
Brief details of the secured term loan facility which has been identified for pre-payment from the Net Proceeds
are as follows:
(` in million)
Name of lender, loan Amount Amount Interest Term Pre-payment clause
documentation and sanctioned outstanding rate
nature of facility as on
August 31,
2014*
Secured term loan 280 215 CPLR Repayable in 32 unequal The lender may, at its
facility pursuant to minus quarterly installments sole discretion, and on
master facility 3.25%, commencing on February such terms as to the
agreement dated being 28, 2015 pre-payment charges
February 12, 2013, 14.85% etc. as it may
entered into with as on prescribe, permit
Housing August acceleration of interest
Development Finance 31, 2014 and/or prepayment of
Corporation Limited the facility at the
request of the borrower
* As per certificate issued by M P R & Co., Chartered Accountant dated September 22, 2014.
As per the certificate issued by M P R & Co., Chartered Accountants, dated September 22, 2014, the amount
drawn down under abovementioned loan has been utilized towards purposes for which the loan was sanctioned.
83
Under the terms and conditions of the above mentioned debt, pre-payment of such debt, may attract certain pre-
payment charges, as prescribed by the lender. Payment of such pre-payment charges or premium, if any, shall be
borne out of the internal accruals of CLIP.
Our Company intends to utilize ` 210.05 million of the Net Proceeds to prepay the above loan facility of CLIP.
The manner of investment in CLIP will be either through debt and/or equity, the form of which will be decided
by our Company at the time of prepayment of the debt facility. Our Company will remain interested in CLIP
and will derive benefits from it, to the extent of its shareholding. FoUGHWDLOVRIRXU&RPSDQ\¶VVKDUHKROGLQJLQ
CLIPVHH³History and Certain Corporate Matters´RQSDJH138.
3. Investment in CLIP through CLEIS, for capacity expansion and infrastructure development at
certain Indus World Schools
As on the date of this Draft Red Herring Prospectus, 10 English-medium K-12 schools across India operate
XQGHU WKH EUDQG ,QGXV :RUOG 6FKRROV ZLWK WZR VFKRROV XQGHU WKH µ2ZQHG-,QIUDVWUXFWXUH¶ PRGHO VL[ VFKRROV
XQGHU WKH µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ PRGHO DQG WZR VFKRROV XQGHU WKH µ(GXFDWLRQDO 3DUWQHUVKLS¶ PRGHO For
GHWDLOV VHH ³Our Business ± K-12 Schools´ RQ SDJH 126. Pursuant to the planned expansion, CLIP will be
HQWLWOHG WR KLJKHU LQIUDVWUXFWXUH IHHV )RU GHWDLOV VHH ³Our Business ± Business model for the Indus World
Schools´RQSDJH127.
We propose to utilize ` 209.03 million from the Net Proceeds for (i) funding the expansion of two of the Indus
:RUOG6FKRROVEHLQJRSHUDWHGXQGHUWKHµ2ZQHG-,QIUDVWUXFWXUH¶PRGHO, located at Raipur and Indore (Jhalaria)
and (ii) funding the infrastructure development of two of the Indus World Schools being operated under the
µ2ZQHG-,QIUDVWUXFWXUH¶ PRGHO ORFDWHG DW 5DLSXU DQG Indore (Jhalaria) and five of the Indus World Schools
being operated under the µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ PRGHO ORFDWHG DW %KLZDQL $XUDQJDEDG /XGKLDQD
Gurgaon and Indore (Chhawani).
(i) Funding the expansion of two Indus World Schools at Raipur and Indore (Jhalaria)
As on March 31, 2014, 297 students were enrolled in the Indus World School in Raipur, which offers
Kindergarten to the 10th grades. As on March 31, 2014, 438 students were enrolled in the Indus World School in
Indore (Jhalaria), which offers Kindergarten to the 10th grades.
We propose to expand the Indus World School, Raipur and Indus World School, Indore (Jhalaria) by increasing
the number of sections and classrooms.
Estimated Cost
The total cost of the planned expansion of the Indus World Schools at Raipur and Indore (Jhalaria) is estimated
at ` 158.22 million as per ,36(/9HQWXUHV 5HDOW\3ULYDWH/LPLWHG³IPSEL´. The detailed break down of the
estimated cost and description of cost items, as mentioned in the quotation dated September 14, 2014 issued by
IPSEL, is as follows:
(` in million)
S. No. Item Estimated Estimated Total Estimated
Expenditure in Expenditure in Cost
fiscal 2016 fiscal 2017
I. Civil Construction for Indus World School, Raipur
1. Foundation & Plinth with Plinth Slab - 14.72 14.72
2. Ground Floor - 29.44 29.44
3. First Floor - 29.44 29.44
Total (I) - 73.61 73.61
II. Civil Construction for Indus World School, Indore (Jhalaria)
1. Ground Floor 21.04 - 21.04
2. First Floor 21.04 - 21.04
3. Second Floor 21.04 - 21.04
4. Third Floor 21.04 - 21.04
5. Terrace Floor 0.47 - 0.47
Total (II) 84.61 - 84.61
Total (I and II) 84.61 73.61 158.22
84
According to the quotation dated September 14, 2014, prepared by IPSEL, the built-up area for the Indus World
School, Raipur and Indus World School, Indore (Jhalaria) have been estimated as 4,686 square meters and 4,500
square meters, respectively. The total cost of construction has been computed on an average construction cost of
` 15,708.33 per square meter and ` 18,803.20 per square meter for Indus World School, Raipur and Indus
World School, Indore (Jhalaria), respectively, applied on the estimated built-up area.
No additional land would be required for expansion of these Indus World Schools.
(ii) Funding the infrastructure development of seven Indus World Schools at Raipur, Indore (Jhalaria),
Bhiwani, Aurangabad, Ludhiana, Gurgaon and Indore (Chhawani)
We intend to fund infrastructure development such as laboratory facilities, library, sports infrastructure etc., at
WKH,QGXV:RUOG6FKRROVEHLQJRSHUDWHGXQGHUWKHµ2ZQHG-,QIUDVWUXFWXUH¶PRGHOORFDWHGDW5DLSXUDQGIndore
(Jhalaria) and five RI WKH ,QGXV :RUOG 6FKRROV EHLQJ RSHUDWHG XQGHU WKH µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ PRGHO
located at Bhiwani, Aurangabad, Ludhiana, Gurgaon and Indore (Chhawani).
The total cost of the planned infrastructure development of the Indus World Schools is estimated at ` 50.81
million as per various quotations received. The detailed break down of the estimated cost and description of cost
items is as follows:
85
S. Item Number of Units Rate per Unit Total Total Total
No. (Quotations) estimated estimated estimated
(in `) expenditure expenditure cost
Indore Indore
Raipur Bhiwani Aurangabad Ludhiana Gurgaon in fiscal 2016 in fiscal 2017 (in `
(Jhalaria) (Chawanni)
(in ` million) (in ` million) million)
I. Set of
Musical
Instruments 2 2 2 2 2 2 2 114,565(16) 0.69 0.92 1.60
Total 28.62 22.19 50.81
(1)
Quotation from Greaves Cotton Limited dated September 3, 2014.
(2)
Quotation from Ace Electronics dated September 2, 2014.
(3)
Quotation from Modern Decorators dated September 2, 2014.
(4)
Quotation from Harmony Computer Private Limited dated September 2, 2014.
(5)
Quotation from SS Aqua Marketing System dated September 2, 2014.
(6)
Quotation from Harmony Computer Private Limited dated September 12, 2014.
(7)
Quotation from Harmony Computer Private Limited dated September 12, 2014.
(8)
Quotation from British Paints dated September 2, 2014.
(9)
Quotation from LTS International dated September 2, 2014.
(10)
Quotation from LTS International dated September 2, 2014.
(11)
Quotation from Modern Decorators dated September 2, 2014.
(12)
Quotation from LTS International dated September 2, 2014.
(13)
Quotation from Rajlaxshmi Construction dated September 1, 2014.
(14)
Quotation from Ebaco India dated September 4, 2014.
(15)
Quotation from Ebaco India dated September 4, 2014.
(16)
Quotation from Nitin Enterprises dated September 1, 2014.
Funds Deployed
As per the certificate of M P R & Co., Chartered Accountants dated September 22, 2014, as of September 22,
2014, our Company has not deployed any funds towards the aforementioned object.
Our Company intends to deploy ` 209.03 of the Net Proceeds to invest in CLIP through CLEIS, for the planned
expansion and infrastructure development of the Indus World Schools as stated above.
The manner of investment in CLEIS and CLIP will be either through debt and/or equity, the form of which will
be decided by our Company in the future. Our Company will remain interested in CLEIS and CLIP and will
derive benefits from it, to tKHH[WHQWRILWVVKDUHKROGLQJ)RUGHWDLOVRIRXU&RPSDQ\¶VVKDUHKROGLQJLQ CLEIS
and CLIPVHH³History and Certain Corporate Matters´RQSDJH138.
As of the date of this Draft Red Herring Prospectus, our Company holds 100% of the issued and paid up capital
of GKP.
Our Subsidiary GKP is currently engaged in the business of distribution of test preparation guides, books and
other academic material. TKHPDMRULW\RI*.3¶VZRUNLQJFapital requirements is funded in the ordinary course
of business from internal accruals, financing from various banks and financial institutions and capital raising
through issue of equity shares.
Basis of estimation of working capital requirement and estimated working capital requirement for GKP
Trade receivables Receivables days as per historic performance from audited financial statements
Inventories Inventory days as per historic performance from audited financial statements adjusted for marginal
expected change
Trade payables Trade payables days as per historic performance from audited financial statements are adjusted for
future expected changes in payables days
M P R & Co., Chartered Accountants, have by a certificate dated September 22, 2014, certified the working
FDSLWDOUHTXLUHPHQWVRIWKH*.36HH³Material Contracts and Documents for Inspection´RQSDJH488.
Our Company proposes to utilize ` 171.72 million of the Net Proceeds in fiscals 2016 and 2017, to invest in
GKP by way of debt to fund the working capital requirements of GKP, for meeting future business
requirements.
The manner of investment in GKP will be either through debt and/or equity, the form of which will be decided
by our Company in the future. Our Company will remain interested in GKP and will derive benefits from it, to
the extent of its shareholding. )RU GHWDLOV RI RXU &RPSDQ\¶V VKDUHKROGLQJ LQ GKP VHH ³History and Certain
Corporate Matters´RQSDJH138.
Our Company intends to deploy the balance Net Proceeds, if any, for general corporate purposes, as may be
approved by our management, including the following:
The total expenses of the Offer are estimated to be approximately ` >Ɣ@ PLOOLRQ The expenses of this Offer
include, among others, listing fees, underwriting and management fees, printing and distribution expenses,
advertisement expenses and legal fees, if applicable. The estimated Offer expenses are as follows:
(` in million)
Activity Estimated expenses* As a % of the As a % of the total
total estimated Offer size
Offer expenses
87
Activity Estimated expenses* As a % of the As a % of the total
total estimated Offer size
Offer expenses
Fees payable to the Book Running Lead Manager >Ɣ@ >Ɣ@ >Ɣ@
Advertising and marketing expenses >Ɣ@ >Ɣ@ >Ɣ@
Fees payable to the Registrar >Ɣ@ >Ɣ@ >Ɣ@
Underwriting commission, fees payable to the Bankers to >Ɣ@ >Ɣ@ >Ɣ@
the Offer, brokerage and selling commission payable to
Registered Brokers, as applicable**
Processing fees to SCSBs for ASBA Applications procured >Ɣ@ >Ɣ@ >Ɣ@
by the members of the Syndicate or Registered Brokers and
submitted with the SCSBs**
Others (listing fees, legal fees, etc.) >Ɣ@ >Ɣ@ >Ɣ@
Total estimated Offer expenses >Ɣ@ >Ɣ@ >Ɣ@
*Will be incorporated at the time of filing of the Prospectus.
** Disclosure of commission and processing fees will be incorporated at the time of filing the Red Herring Prospectus.
All expenses with respect to the Offer will be shared among the Selling Shareholders and our Company, in
proportion to the Equity Shares being offered by them in this Offer.
Our management will have flexibility in deploying the Net Proceeds. Pending utilization for the purposes
described above, we intend to temporarily invest the funds from the Net Proceeds in interest bearing instruments
including investment in money market mutual funds, deposits with banks and other interest bearing securities
for the necessary duration. Such investments will be approved by our management from time to time. Our
Company confirms that, pending utilization of the Net Proceeds, it shall not use the funds for any investment in
any other equity or equity linked securities.
Bridge Loan
Our Company has not raised any bridge loans which are required to be repaid from the Net Proceeds.
As the size of the Fresh Issue is less than ` 5,000 million, the appointment of a monitoring agency is not
required.
Pursuant to Clause 49 of the Equity Listing Agreements, our Company shall on a quarterly basis disclose to the
Audit Committee the uses and application of the Net Proceeds. We will disclose the utilization of the Net
Proceeds under a separate head in our balance sheet(s) until such time as the Net Proceeds remain unutilized
clearly specifying the purpose for which such Net Proceeds have been utilized. In the event that we are unable to
utilize the entire amount that we have currently estimated for use out of the Net Proceeds in a fiscal, we will
utilize such unutilized amount in the next fiscal.
We will also, under a separate head in our balance sheet, provide details, if any, in relation to any amounts out
of the Net Proceeds that have not been utilized, also indicating interim investments, if any, of such unutilized
Net Proceeds.
Further, in accordance with Clause 43A of the Equity Listing Agreements, our Company shall furnish to the
Stock Exchanges on a quarterly basis, a statement indicating material deviations, if any, in the utilization of the
Net Proceeds for the objects stated in this Draft Red Herring Prospectus. This information will also be
advertised in newspapers simultaneously with the interim or annual financial results of the Company after
placing the same before the Audit Committee.
Variation in Objects
In accordance with Section 27 of the Companies Act, 2013, the Company shall not vary the Objects without the
Company being authorised to do so by the shareholders by way of a special resolution. In addition, the notice
issued to the shareholders in relation to the passing of such special resolution shall specify the prescribed details
and be published in accordance with the Companies Act, 2013. Pursuant to the Companies Act, 2013, the
88
Promoter or controlling shareholders will be required to provide an exit opportunity to the shareholders who do
not agree to such proposal to vary the Objects in accordance with the Articles of Association of the Company
and as may otherwise be prescribed by SEBI.
Investors may note that the Selling Shareholders are not liable under Section 27 of the Companies Act or any
other applicable law or regulation (including any direction or order by any regulatory authority, court or
tribunal) for any variation of (i) terms of a contract referred to in this Draft Red Herring Prospectus; and/or (ii)
Objects of the Offer.
Other Confirmations
No part of the Net Proceeds will be paid by our Company as consideration to our Promoters, members of the
Promoter Group, Directors, Group Entities or key managerial employees. However, (i) our Promoters and
certain Promoter Group, (ii) GHIOF Mauritius, a Selling Shareholder, in which our Director Kamil Hasan is
interested to the extent of being a partner of Granite Hill India Opportunities Fund, an affiliated entity, and (iii)
Gaja Trustee Company Private Limied and GPE (India) Limited, entities which have nominated Gopal Jain as a
Director of our Company, will receive a portion of the proceeds of the Offer for Sale, net of their respective
share of Offer Expenses, as Selling Shareholders, in proportion to the Equity Shares being offered by them
through the Offer.
89
BASIS FOR OFFER PRICE
The Offer Price will be determined by the IPO Committee of our Company in consultation with the Book
Running Lead Manager on the basis of an assessment of market demand for the offered Equity Shares by the
book building process and on the basis of the following qualitative and quantitative factors. The face value of
the Equity Shares of our Company is ` 10 each and the Offer 3ULFHLV>Ɣ@WLPHVRIWKHIDFHYDOXHDWWKHORZHU
HQGRIWKH3ULFH%DQGDQG>Ɣ@WLPHVWKHIDFHYDOXHDWWKHKLJKHUHQGRIWKH3ULFH%DQG
Qualitative Factors
x Diversified provider of educational products, services, content and infrastructure, with pan-India
presence.
x Leading courses in aptitude based test preparation in India.
x Strong brand equity.
x Track record of successful inorganic growth.
x Professionally qualified, experienced and entrepreneurial management team, and quality human capital.
For a detailed discussion on the qualitative factors, which form the basis for computing the Offer Price, see
³Our Business´DQG³Risk Factors´RQSDJHV117 and 11, respectively.
Quantitative Factors
Information presented in this section is derived from our restated financial statements prepared in accordance
with the Companies Act and the SEBI Regulations.
Some of the quantitative factors which may form the basis for computing the Offer Price are as follows:
1. Basic and Diluted Earnings / Loss per Equity Share (³EPS´) of our Company (in `)
Note: EPS has been calculated in accordance with the Accounting Standard 20 ± ³(DUQLQJSHU VKDUH´QRWLILHGSXUVXDQWWR
Companies (Accounting Standards) Rules 2006 read with general circular 15/2013 dated September 13, 2013, issued by the
Ministry of Corporate Affairs in respect of Section 133 of the Companies Act, 2013. The face value of equity shares of the
&RPSDQ\³Equity Shares´LV` 10.
i) EPS have been computed as below:
(a) Basic earnings per share (`) = Net profit after tax (as restated) attributable to equity shareholders/weighted average
number of equity shares outstanding during the year.
(b) Diluted earnings per share (`) = Net profit after tax (as restated) attributable to equity shareholders/weighted average
number of dilutive equity shares outstanding during the year.
ii) Weighted average number of equity shares are the number of equity shares outstanding at the beginning of the year
adjusted by the number of equity shares issued during year multiplied by the time weighing factor. The time weighing factor
is the number of days for which the specific shares are outstanding as a proportion of total number of days during the period
90
/year.
iii) Considering that we have incurred losses during the year ended March 31, 2012, the conversion of CCPS and issue of
ESOPs would decrease the loss per share for the year ended March 31, 2012 and hence it has been ignored for the purpose
of calculation of diluted EPS for the said year.
Note: The return on net worth is arrived at by dividing restated consolidated and unconsolidated net profit after tax by
restated consolidated and unconsolidated net worth, respectively, as at the end of the year.
3. Minimum Return on Increased Net Worth required to maintain pre-Offer EPS for the year
ended March 31, 2014:
Note: Net asset value per Equity Share represents restated consolidated/unconsolidated net worth at the end of
the year divided by the number of Equity Shares outstanding at the end of the year.
a. 3(EDVHGRQEDVLFDQGGLOXWHG(36DWWKHORZHUHQGRIWKH3ULFH%DQGLV>Ɣ@
b. 3(EDVHGRQEDVLFDQGGLOXWHG(36DWWKHKLJKHUHQGRIWKH3ULFH%DQGLV>Ɣ@
c. P/E based on basic and diluted EPS as per our restated financial statements for year ended March 31,
LV>Ɣ@
d. Peer Group P/E:
a. Highest: 21.49
b. Lowest: 14.07
c. Industry Composite: 17.33
S Name of the Company For the year ended March 31, 2014
91
no. Face Total Basic EPS P/E (3) RoNW (4) NAV (5)
Value Income (1) (2)
(%) (`)
(``) `)
(`
1. CL Educate Limited# 10 2,297.07 16.44 >Ɣ@ 10.36% 150.60
Peer Group
2. Career Point Limited## 10 780.15 5.40 14.07 2.92% 184.89
3. MT Educare Limited ## 10 2,018.03 5.29 16.42 18.54% 28.14
Tree House Education and
4. 10 1,589.78 12.04 21.49 10.96% 107.85
Accessories Limited ###
Industry Composite 17.33
Notes:
#
Based on the restated consolidated financials of the Company for fiscal 2014
##
Based on consolidated financials from the Annual Report for fiscal 2014
###
Based on financials from Annual Report for fiscal 2014
1
Based on total revenue as reported in company filings
2
Basic EPS as reported in company filings
3
Price earnings ratio calculated by dividing the market value of the shares of the companies as on March 31, 2014, by the
basic EPS of the companies
4
Return of net worth has been computed by dividing the profit after tax by the at the end of March 31, 2014
5
Net asset value per equity share has been computed as net worth divided by the total number of equity shares outstanding
as at March 31, 2014
92
STATEMENT OF TAX BENEFITS
To,
The Board of Directors
CL Educate Limited
DTJ 925, DLF Tower ± B, Jasola District Centre,
New Delhi ± 110025, India
Dear Sirs,
Sub: Certification of Statement of Possible Special Tax Benefits in connection with Initial Public Offering
E\&/(GXFDWH/LPLWHG³WKH&RPSDQ\´XQGHU6HFXULWLHVDQG([FKDQJH%RDUGRI,QGLD,VVXHRI
&DSLWDODQG'LVFORVXUH5HTXLUHPHQWV5HJXODWLRQV³WKH5HJXODWLRQV´
We, Haribhakti & Co.LLP, Chartered Accountants, the statutory auditors of the Company have been requested
by the management of the Company to certify the statement of possible special tax benefits available to the
Company and its shareholders under the provision of the Income Tax Act, 1961 (the Act) and Wealth Tax Act,
1957(WT Act) (collectively reffered to as Tax Laws), presently in force in India, for the Financial Year 2014-15
(Assessment Year 2015-16). Several of these benefits are dependent on the Company or its shareholders
fulfilling the conditions prescribed under the relevant Tax Laws. Hence, the ability of the Company or its
shareholders to derive the special tax benefits is dependent upon fulfilling such conditions, which based on the
business imperative, the Company faces in future, the Company may or may not choose to fulfill.
The benefits discussed in the enclosed annexure are neither exhaustive nor conclusive. The contents stated in the
annexure are based on the information, explanations and representation obtained from the Company. This
statement is only intended to provide general information to the investors. It is neither designed nor intended to
be a substitute for professional tax advice. A shareholder is advised to consult his/ her/ their own tax consultant
with respect to the tax implications of an investment in the equity share particularly in view of the facts that
certain recently enacted legislation may not have a direct legal precedent or may have a different interpretation
on the benefits, which an investor can avail.
x The Company or its shareholders will continue to obtain these benefits in future; or
x The conditions prescribed for availing the benefits have been or would be met with;
The contents of this Annexure are based on the information, explanations and representations obtained from the
Company and on the basis of our understanding of the business activities and operations of the Company. The
certificate is based on the existing provisions of Tax Laws and its interpretations, which are subject to
amendments every fiscal year and changes from time to time. We do not assume responsibility to up-date the
changes.
This report is intended solely for your information and for the inclusion in the Offer Documents in connection
with the proposed Initial Public Offering of the Company and is not to be used, referred to or distributed for any
other purpose without our prior written consent.
For Haribhakti & Co., LLP
Chartered Accountants
ICAI Firm Registration No.: 103523W
93
ANNEXURE TO THE STATEMENT OF POSSIBLE SPECIAL TAX BENEFITS AVAILABLE
TO THE COMPANY AND ITS SHAREHOLDERS
Outlined below are the possible special tax benefits available to the Company and its Shareholders under the
current Tax Laws in India for the Financial Year 2014-15.
A special benefit under 80IC is available to one of the wholly owned subsidiary of the Company namely CL
Media Private Limited (CL Media).
Under section 80IC of the Act and subject to the conditions and to the extent specified therein, CL Media is
eligible for deduction of 100% of the profit and gains from its eligible business at Roorkee, Uttrakhand for the
first five years, commencing from the financial year 2011±12, which was the initial year in which the
undertaking began to manufacture or produce articles or things, and 30% of the profit and gains from the
eligible business for the next five years. However, CL Media shall be subject to Minimum Alternate Tax (MAT)
u/s 115JB of the Act during this period.
There are no special tax benefits available to the shareholders of the Company.
The above Statement of Possible Special Tax Benefits sets out the possible tax benefits available to the
Company and its shareholders under the current tax laws presently in force in India. Several of these benefits are
dependent on the Company or its shareholders fulfilling the conditions prescribed under the relevant tax laws.
94
SECTION IV- ABOUT US
INDUSTRY OVERVIEW
Unless otherwise stated, the information in this section has been extracted from the CRISIL Research Report
GDWHG0D\RQµ$VVHVVPHQWIRU7HVW3UHSDUDWLRQ.9RFDWLRQDO7UDLQLQJDQG 3XEOLVKLQJ,QGXVWULHV¶
WKH³CRISIL Report´7KLVUHSRUWDVZHOODVWKHSXEOLFO\DYDLODEOHGRFXPHQWVDVFLWHGEHORZLQWKLVVHFWLRQ
have not been prepared or independently verified by us or the Book Running Lead Manager or any of our or its
respective affiliates or advisors. This information may not be consistent with other information compiled by
third parties within or outside India. Industry sources and publications referred to by us generally state that the
information contained therein has been obtained from sources generally believed to be reliable, but their
accuracy, completeness and underlying assumptions are not guaranteed and their reliability cannot be assured.
Industry and Government publications are also prepared based on information as of specific dates, which may
no longer be relevant or reflect current trends. Accordingly, investment decisions should not be based on such
LQIRUPDWLRQ 6WDWHPHQWV LQ WKLV VHFWLRQ WKDW DUH QRW VWDWHPHQWV RI KLVWRULFDO IDFW FRQVWLWXWH ³IRUZDUG-looking
VWDWHPHQWV´ 6XFKIRUZDUG-looking statements are subject to various risks, assumptions and uncertainties and
certain factors could cause actual results or outcomes to differ materially.
Indian Economy
India is the world's largest democracy in terms of population (approximately 1,236.3 million people, July 2014
estimate) with an estimated GDP (by purchasing powering parity valuation of country GDP) of approximately
US$ 4.99 trillion in 2013 (Source: CIA World Factbook). This makes it the third largest economy in the world in
terms of GDP after the United States of America and China in 2013 (Source: International Monetary Fund
(IMF), World Economic Outlook Database, April 2014).
Despite the global economic decline in fiscal 2008, India continues to be one of the fastest growing countries in
the world. India has been growing faster than the emerging and developing economies in the period in the period
2009- DQG KDV JHQHUDOO\ EHHQ DW SDU VXEVHTXHQW WR ILVFDO )XUWKHU ,QGLD¶V JURZWK KDV JHQHUDOOy
outperformed the advanced economies and the world GDP growth rate since fiscal 2009. (Advanced economies
include 36 countries such as Australia, Canada, France, Japan, United Kingdom, United States and others; and
Emerging and Developing economies include over 153 countries such as Argentina, Brazil, China, Russia,
South Africa, Turkey and others, as defined by IMF;
https://www.imf.org/external/pubs/ft/weo/2014/01/weodata/groups.htm)
The following table sets forth the key indicators of the Indian economy for the past five fiscals.
After achieving growth of over 9% for three successive years between fiscal 2006 and fiscal 2008 and
recovering swiftly from the global financial crisis of 2008-09, the Indian economy has been going through
challenging times that have resulted in lower than 5% growth of GDP for the last two years, i.e., fiscal 2014 and
fiscal 2013. Persistent uncertainty in the global outlook, caused by the crisis in Europe and general slowdown in
the global economy, compounded by domestic structural constraints and inflationary pressures, resulted in a
protracted slowdown. The slowdown is broadly in sync with trends in other emerging and developing
HFRQRPLHV,QGLD¶VJURZWKGHFOLQHGIURPDQDYHUDJHRISHUDQQXPGXULQJILVFDOWRILVFDOWRDQ
average of 4.6% during fiscal 2013 to fiscal 2014. In comparison, average growth in the emerging markets and
developing economies including China declined from 6.8% to 4.9% in this period (calendar-year basis) (Source:
Indian Economic Survey 2013-14, Ministry of Finance, Government of India).
95
The education sector in India can be broadly classified into the formal and non-formal categories. The formal
category comprises K+12 and higher education, up to post-graduation, and is subject to high levels of regulation
in India, both at the central and state government level.
$QRWKHUNH\IDFWRUJRYHUQLQJWKHIRUPDOHGXFDWLRQFDWHJRU\LVWKHµQRWIRUSURILW¶GLNWDW(GXFDWLRQDOLQVWLWXWLRQV
LQ,QGLDFDQQRWEHVHWXSRQDµIRUSURILW¶EDVLVDQGEXVLQHVVVWUXFWXUHVVXFKDVVXFKDVSDUWQHUVKLSVSULYDWHDQG
public companies, etc.are prohibited from setting up educational institutions in India. Educational institutions in
India are either set up by government entities or by private sector entities such as a society registered under the
Societies Registration Act, 1860, a public trust registered under the Indian Trust Act, 1882, or under
FRUUHVSRQGLQJVWDWHODZVVXFKDVWKH%RPED\3XEOLF7UXVW$FWRUDµQRWIRUSURILW¶FRPSDQ\VHWXSXQGHU
the Companies Act. The key common feature among all these entities is that profits cannot be distributed to the
provider of capital, either as dividend or otherwise. This generally serves as a disincentive to private players,
thereby restricting private investments in the education sector.
On the other hand, the non-formal category largely comprises segments like pre-schooling, coaching (also
known as test prep), vocational training, online education and publishing, which enjoy a lesser degree of
regulation.
As education is on the concurrent list of the Indian constitution, the sector is governed by both the central and
state government. The Ministry of Human Resource Development plays a pivotal role in governing the
education sector, governing the education sector through its two nodal agencies:
x the Department of School Education and Literacy, which is responsible for disbursing central grants to
states for building educational infrastructure at the K+12 (kindergarten to grade 12) level in India; and
x the Department of Higher Education, which is responsible for governing higher education (graduation,
post-graduate and professional) in India.
Government expenditure on education is directed through five-year plans, which are developed, executed and
monitored by the Planning Commission. The central government, through the five-year plans, allocates a budget
IRU HGXFDWLRQ IRU D SHULRG RI ILYH \HDUV %XGJHWDU\ DOORFDWLRQ LQFOXGHV D µSODQ¶ FRPSRQHQW WR PHHW WKH
objectives laid down in the five-\HDU SODQ DQG D µQRQ-SODQ¶ FRPSRQHQW WR Dccount for unforeseen events.
However, it revises its allocation annually based on various factors, which is intimated through the annual
Union Budget.
Over the years, the Government of India has been making dedicated efforts to promote literacy and elementary
education, resulting in higher expenditure in this segment. Of the total government expenditure on education,
the majority of funds have been allocated to this segment. In the Tenth Plan, approximately 55% of the funds
were allocated to elementary education, which was increased to approximately 57% in the Eleventh Plan.
Allocation of funds for the K+12 segment rose to approximately ` 408.5 billion in 2013, from approximately `
66.2 billion in 2004.
Over the same period, government expenditure on secondary school education has increased to approximately `
86.5 billion, from ` 14 billion. The higher education segment in India has historically received less attention
IURPWKHJRYHUQPHQWDVWKHJRYHUQPHQW¶VPDLQIRFXVKDVEHHQWRXQLYHUVDOL]HSULPDU\HGucation and, therefore,
more efforts have been directed towards providing access to basic education in rural areas. In the Eleventh Plan,
approximately 12% of funds have been allocated for secondary education. Government expenditure on higher
education has grown from approximately ` 212.8 billion in 2013 from approximately ` 34.4 billion in 2004. In
the Eleventh Plan, approximately 30% of the funds have been allocated to this segment.
Key measures announced during the Union Budget 2014-2015 include the following:
x a multi-skill program, Skill India, to be launched to develop skills among the youth;
x allocation of ` ELOOLRQ WR VHW XS ILYH QHZ ,QGLDQ ,QVWLWXWHV RI 7HFKQRORJ\ ³IITs´ LQ -DPPX
Chhattisgarh, Goa, Andhra Pradesh and Kerala and five new ,QGLDQ,QVWLWXWHVRI0DQDJHPHQW³IIMs´
in Himachal Pradesh, Punjab, Bihar, Odisha and Maharashtra;
96
x introduction of the Pandit Madan Mohan Malviya New Teachers Training Program, with an outlay of `
5 billion, to develop new training tools and motivate teachers;
x allocation of ` 1 billion to set up virtual classrooms as Communication Linked Interface for Cultivating
.QRZOHGJH³CLICK´DQGRQOLQHFRXUVHVDQG
x provision of restroom and drinking water facilities in all girls schools, as part of a phased effort to
improve school infrastructure facilities in India.
In addition to the central government, states also incur expenditure on education, which is financed by their own
revenues and through deficit financing.
The coaching sector in India, which is one of the most unregulated segments of the Indian education sector, can
be broadly classified into curriculum-based and test prep-based coaching.
x Curriculum-based coaching classes focus on coaching students appearing for K+12 examinations and
graduation courses, and are based on a fixed curriculum.
x Test prep-based coaching classes focus on coaching students appearing for entrance examinations at
the undergraduate and post-graduate level, and are typically aptitude-based.
The graduation-based test prep segment caters to students appearing for entrance examinations for admission to
undergraduate courses across varied streams such as engineering, medical, law, finance and accounting,
architecture and international test prep.
The engineering entrance examinations include the Joint Entrance Exam ± 0DLQ³JEE-Main´IRUDGPLVVLRQWR
undergraduate SURJUDPV LQ WKH 1DWLRQDO ,QVWLWXWHV RI 7HFKQRORJ\ ³NITs´ ,,7V DQG RWKHU FHQWUDOO\ IXQGHG
technical institutes, and the Joint Entrance Exam-$GYDQFHG³JEE-Advanced´ ZKLFK LVWKHVHFRQG VWDJHRI
admission to undergraduate courses to the IITs and the Indian School of Mines. The JEE-Main replaced the All
India Entrance Engineering Exam from April 2013 onwards.
The JEE-Advanced replaced the IIT-JEE examinations from May 2013 onwards. The States of Gujarat,
Maharashtra, Madhya Pradesh, Nagaland and Odisha, which were earlier admitting students to undergraduate
courses based on their respective State-level examinations, have joined the JEE-Main system from 2014. Only
the top 150,000 candidates across categories based on their scores in Paper-1 of JEE-Main are eligible to
attempt the JEE-Advanced.
7KH PHGLFDO HQWUDQFH H[DPLQDWLRQV LQFOXGH WKH $OO ,QGLD 3UH 0HGLFDO 7HVW ³AIPMT´ DQG WKH $OO ,QGLD
,QVWLWXWHRI0HGLFDO6FLHQFH0%%6³AIIMS MBBS´7KH$,307LVIRUDGPLVVLRQWRXQGHUJUDGXDWHFRXUVHV
in medicine and dental streams across Government-run colleges in India (except in the states of Andhra Pradesh
and Jammu & Kashmir). The AIPMT is conducted for 15% of the merit seats available across medical and
dental colleges in India. Apart from the Government-run colleges, 14 other States/universities/institutions utilize
AIPMT scores for admission to MBBS/BDS seats under their control. The final decision as to the
implementation of the National Eligibility cum Entrance Test, which was expected to replace the AIPMT and all
individual MBBS examinations for undergraduate and postgraduate courses by States or colleges in 2013, is
pending before the Supreme Court of India.
97
,QODZWKH/DZ6FKRRO$GPLVVLRQ7HVW³LSAT´LVXVHGIRUDGPLVVLRQWRODZVFKRROVLQFRXQWULHVVXFKDVWKH
United States and Canada. LSAT scores are also accepted by other law schools, including certain law schools in
India.
The finance and accounting entrance examinations include the Chartered Accountancy ± Common Proficiency
7HVW ³CA-CPT´ DQG WKH &RPSDQ\ 6HFUHWDU\ ³&6´ DQG WKH &RVW DQG :RUNV $FFRXQWDQW ³CWA´
examinations. The CA-CPT is the first level test for the degree of chartered accountancy.
The post-graduate test prep segment caters to students applying for post-graduate courses across varied streams
such as management, engineering, finance and accounting, job-oriented, and language proficiency.
7KH PDQDJHPHQW HQWUDQFH H[DPLQDWLRQV LQFOXGH WKH &RPPRQ $GPLVVLRQ 7HVW ³CAT´ WKH &RPPRQ
0DQDJHPHQW $GPLVVLRQ 7HVW ³CMAT´ WKH *UDGXDWH 0DQDJHPHQW $GPLVVLRQ 7HVW ³GMAT´ *UDGXDWH
RecRUG ([DPLQDWLRQV ³GRE´ WKH ;/5, $GPLVVLRQ 7HVW ³XAT´ 10,06 0DQDJHPHQW $SWLWXGH 7HVW
³NMAT´ 6\PELRVLV 1DWLRQDO $SWLWXGH 7HVW ³SNAP´ DQG $,06 7HVW IRU 0DQDJHPHQW $GPLVVLRQ
³ATMA´ 7KH &$7 LV DQ DQQXDO DOO-India entrance examination for admission WR WKH ,,0V¶ SRVWJUDGXDWH
business administration courses. From 2011, the IITs and Indian Institutes of Science began to use CAT scores
instead of the Joint Management Entrance Test for admission to their management programs. The CMAT is an
all-India entrance examination for admission to management programs to more than 3,500 business schools
DSSURYHG E\ WKH $OO ,QGLD &RXQFLO IRU 7HFKQLFDO (GXFDWLRQ ³AICTE´ 7KH $,&7( ODXQFKHG WKH &0$7 LQ
2012 to counter the multiple entrance examinations for entry into management programs.
The GMAT is an entrance examination for admission into business management courses across 2,100
universities in 112 countries worldwide.
The GRE is an entrance examination for admission into various masters and doctoral programs across
universities in the United States.
The finance and accounting examinations include the Chartered Accountancy ± Integrated Professional
&RPSHWHQFH³CA-IPC´DQG&KDUWHUHG$FFRXQWDQF\³CA Final´H[DPLQDWLRQV7KH&$-IPC is the second
level test for the degree of chartered accountancy. The CA Final is the last test for the degree of chartered
accountancy.
Job-RULHQWHG H[DPLQDWLRQV LQFOXGH WKH &RPPRQ :ULWWHQ ([DP ³CWE´ 8QLRQ 3XEOLF 6HUYLFH &ommission
³UPSC´&LYLO6HUYLFHV&HQWUDO7HDFKHU(OLJLELOLW\7HVW³CTET´DQG&RPELQHG*UDGXDWH/HYHO³CGL´
examinations.
x The CWE is an all-India examination for recruitment of probationary officers and clerical level
positions to nationalized banks and public sector banks. The State Bank of India also conducts its own
PO and clerical examinations.
x The Civil Services Exam is an all-India examination conducted by the UPSC for recruitment to various
civil sources of the Government of India, including the Indian Administrative Service, Indian Foreign
Service and Indian Police Service, among others.
98
x The CTET is an annual all-India entrance examination for appointment as a teacher in any Central
Government school, which has become mandatory since the notification of the Right to Education Act,
2009.
Language proficienF\ H[DPLQDWLRQV LQFOXGH WKH 7HVW RI (QJOLVK DV D )RUHLJQ /DQJXDJH ³TOEFL´ DQG
,QWHUQDWLRQDO(QJOLVK/DQJXDJH7HVWLQJ6\VWHP³IELTS´
x The TOEFL is used to gauge the language proficiency of non-native English speakers for academic and
other purposes. The TOEFL is accepted in over 9,000 universities, institutes and agencies across 130
countries.
x The IELTS is used to assess the language proficiency of non-native English language speakers. The
IELTS is conducted in two versions: the academic version, for those wishing to study, and the general
training version intended for non-academic or work related experience. The IELTS is accepted in over
8,000 educational institutions, governments, professional registration bodies and employers in over 130
countries.
The Indian test prep market is currently estimated at ` 245 billion (as of 2013-2014), of which the graduate
segment accounts for 68% share, while the post-graduate, job-oriented and language proficiency segment
account for the balance 32% share.
Being an unregulated sector, the market is typically dominated by the larger branded players across various
streams. A large number of unorganized local players also thrive in the current scenario, given the extensive
number of entrance examinations carried out by different states, universities and institutes.
The following graph shows the growth in the Indian test prep segment from 2006-2007 until 2013-2014:
(in Rs billion)
300
245
213
187 183
200 172
143
120
96
100
-
2006-07 2007-08 2008-09 2009-10 2010-11 2011-12 2012-13 2013-14E
;
(Source: CRISIL Report.)
The following graph shows the share of graduate vs. post-graduate test prep in India:
99
120%
60%
40%
69% 72% 73% 72% 72% 68%
67% 67%
20%
0%
2006-07 2007-08 2008-09 2009-10 2010-11 2011-12 2012-13 2013-14E
The graduate-based tests, which include the JEE-Main, JEE-Advanced, AIPMT, NATA, CLAT, CA-CPT and
SAT account for nearly 2/3rds of the total market size for the Indian test prep market. Within the graduate-based
test prep segment, the largest share is of engineering tests, namely the JEE-Main and JEE-Advanced and NATA,
which account for 82%. This segment is also expected to register healthy growth in the next few years. While
other fields like accountancy (CA-CPT) and law (CLAT) are also gaining popularity among students, their share
in the graduate-based test market currently remains meagre.
The following graph shows the share of various streams, within the graduate based test prep segment in India:
100
(in Rs billion)
180
3
160
27
140 3
3
3 17 25
120 3
14
23
100 2
10
2
80 11
1 136
60 11 114 114
108
92 97
40 74
53
20
0
2006-07 2007-08 2008-09 2009-10 2010-11 2011-12 2012-13 2013-14E
The post-graduate tests include CAT, CMAT, GRE, GATE, CA-Inter and Final, job-oriented tests such as
CWE, UPSC and SSC and language proficiency tests such as TOEFL and IELTS. Within the post-graduate test
prep segment, the largest share is of job-oriented tests, which account for 80%. Within the job-oriented tests, the
SSC test accounts for a majority share, at nearly 70%.
The following graph shows the share of various streams, within the post-graduate test prep segment in India:
(in Rs billion)
90
80
5
70 4 8
9 3
60 3
2
6
50 3 3
3 5
3 2
40 2
3
2
2 3
30 1 62
2
1 3 56
2 49
20 39 43
32
24 27
10
0
2006-07 2007-08 2008-09 2009-10 2010-11 2011-12 2012-13 2013-14E
Others (GRE, GMAT, TOEFL, IELTS, CA-Inter and Final) Engineering (GATE)
Management (CAT) Job-based (UPSC, Bank PO, SSC)
(Source: CRISIL Report.)
The following graph shows the estimated future growth of the Indian test prep segment, from 2013-2014 to
2018-2019:
101
(in Rs Billion)
600
523
500
447
383
400
329
284
300
245
200
100
-
2013-14E 2014-15P 2015-16P 2016-17P 2017-18P 2018-19P
Demand drivers
Structural changes in the Indian economy, such as increase in disposable income, increase in number of nuclear
families, increase in expenditure on education along with other factors such as improvement in the Gross
(QUROPHQW5DWLRV³GERs´DFURVVVFKRROVDQGSHHUSUHVVXUHIRUKLJKJUDGHVLQWKH,QGLDQHGXFDWLRQDOV\VWHP
are the major demand drivers of the Indian test prep segment. The major demand drivers for the test prep
segment can be broadly classified under three parameters, namely, demographic, infrastructural and social:
Demographic drivers:
x Over the years, the transition of households from lower income to higher income brackets has also
resulted in an increase in per capita expenditure on education, especially in the urban sectors.
x Growing numbers of nuclear families and the cultural change of both parents being employed has
increased the dependence of parents and students on coaching classes for educational guidance and
supervision.
x Improving GERs across schools in the country has expanded the addressable market competing for
limited seats in top institutes and universities in the country.
Infrastructural drivers:
x Limited numbers of good quality educational institutes in the Indian education system have played a
key role in the growth of the test prep segment. While the number of students passing out of the
education system has increased exponentially year on year, there are still limited institutes offering
quality education. This has resulted in increasing numbers of students chasing limited seats for their
undergraduate and postgraduate courses.
x A bigger issue is the sizeable skill gap between an educated candidate and an employable candidate.
Since the Indian formal education system continues to lay stress on theoretical knowledge, more and
more students are opting for higher education courses to improve their chances of gainful employment.
This has resulted in growing competition among students to get into premier schools and colleges,
leading to increased dependence on test prep classes.
Social drivers:
102
x An important growth driver is the peer pressure faced by students when selecting their undergraduate
or postgraduate streams. Lack of proper guidance often results in students pursuing similar courses as
chosen by their classmates and friends. Also, students start taking help in their studies at an early age,
which results in continued dependence even in their graduate and postgraduate courses.
In conjunction with these factors driving growth, the test prep segment is low capital intensive and has attracted
significant entrepreneurial interest. Several alumni of reputed institutes such as IITs and IIMs have ventured into
this business segment.
Consequently, the Indian test prep market, which grew at a CAGR of 14% during the last eight years, is
expected to grow at a CAGR of 16% during the period 2014-2019.
Among the graduate-based tests, the engineering tests, namely, JEE-Main, JEE-Advanced and NATA, are
expected to register the highest growth at 19% CAGR during the period 2014-2019, primarily on account of
steady growth in enrolments and high average fees charged for engineering test prep. Law and accountancy-
based tests are also expected to register steady growth at 16% and 13%, respectively.
Among the post-graduate tests, the engineering test, namely, GATE, is expected to register the highest growth at
21% CAGR during the period 2014-201DVDQLQFUHDVLQJQXPEHURISXEOLFVHFWRUXQLWV³PSUs´KDYHVWDUWHG
accepting GATE scores for their entry-level positions. Management examinations such as CAT and GMAT are
expected to register a lower CAGR of 9% during the same period given the gradual decline in their popularity.
Among the job-oriented tests, the UPSC tests are expected to register the highest growth at 16% CAGR.
Competitive assessment
Due to its unregulated nature, the Indian test prep segment is dominated by private players, both large and small.
Typically, the bigger players in this segment enjoy better brand equity due to their vintage and promoter
background. Such players are also able to scale up their operations, mostly via the franchising route.
Consequently, the number of students coached annually is far higher for the larger players as they have a much
stronger penetration across states and cities, as compared to the regional or local players. Moreover, the larger
players have also diversified from the test prep segment into other educational verticals such as K+12, pre-
school, higher education, and publishing, to achieve higher revenues.
Among the Indian test prep segment, Career Launcher one of the leading brands, with 165 centers across India,
and with approximately 80,000 students trained annually. Other large pan-India players in the market include
T.I.M.E., Aakash, IMS,FIIT-JEE, PT Education, Career Forum and GATE Forum. There are also other players,
such as JK Shah Classes and Career Point, which have a limited geographical scope and spread and are not
competing on a pan-India level.
Among these players, Career Launcher is the only player with a presence across the entrance test, K+12,
vocational training and publishing and content development business.
Publishing Industry
Overview
Publishing is the activity that involves preparation and marketing of books. Publishers acquire content from
authors in the form of manuscripts. The content is then evaluated, edited and then sent for printing in the form of
a book. The books are then distributed through wholesalers and retailers to reach the end-user. Many publishers
also are in the book distribution business.
103
(Source: CRISIL Report.)
The Indian book publishing industry is large and fragmented with approximately 19,000 publishers publishing
over 100,000 titles a year. However, only approximately 12,500 publishers have International Standard Book
1XPEHUV³ISBNs´DQGWKHUHVWSXEOLVKZLWKRXW,6%1V(QJOLVKDQG+LQGLERRNVDFFRXQWIRUDOPRVWRI
the books published in India, while regional languages account for the rest. India is the third largest English
language publisher in the world, after the U.S. and U.K.
In terms of the type of books published, the Indian publishing industry can be divided into two broad categories,
namely, academic and non-academic. The academic segment can be further divided into three broad sub-
categories, namely, school, higher education and test prep.
The test prep segment includes books published for competitive exams such as engineering entrance (including
JEE), management entrance (including CAT), medical entrance (including AIPMT), civil services (including
UPSC) and other entrance tests such as law (including CLAT) and teacher training (including CTET).
Revenues from the Indian book publishing industry were estimated to aggregate to ` 174 billion in 2013-2014.
While the academic segment is the largest at ` 135 billion and a share of 78%, the non-academic segment
accounts for the remaining at ` 39 billion and a share of 22%.
The following graph shows the estimated book publishing market in India in 2013-14:
School
56%
Higher
education
17%
Test prep
5%
The Indian book publishing industry is expected to grow at 10-11% over the next five years to reach ` 287
billion by 2018-2019. While publishing of academic books is expected to grow at 11-12% annually to ` 227
billion in 2018-2019, the growth of the non-academic segment is expected to be slower at 8-9% annually to ` 60
billion by 2018-2019.
The following graph shows the estimated future growth in Indian book publishing (academic vs. non-academic),
from 2013-2014 to 2018-2019:
104
(Source: CRISIL Report.)
The literacy rate in India has been steadily increasing over the last 30 years. Taking into account the various
Government schemes and initiatives, the literacy rate is expected to go up higher, boosting the Indian publishing
industry. Assuming that less than half of the literates have completed more than primary education, it is
expected that there is significant scope for people pursuing further studies, which, in turn, will result in usage of
more books.
The following graph shows the estimated level of education among literates (as per the 2001 census):
Diploma
Std V to X 1%
30% Std XII
7% Graduate and
Above
7%
Literate without
education
3%
Upto Primary
52%
The following graph shows the estimated GER in K+12, in the period 2007-2019:
105
100% 87.2% 90.0%
82.4%
75.5%
80% 68.7% 71.3%
60%
40%
20%
0%
On account of various initiatives such as the Sarva Shiksha Abhiyan, the Midday Meal scheme, and the Right to
Education Act, 2009, undertaken by the Government, GERs of the school segment are expected to increase from
80% in 2013-2014 to reach 90% by 2018-2019. Enrolment in private schools is expected to increase from 47%
in 2013-2014 to 51% in 2015-2016. Rising urbanization, increasing ability and willingness to spend on quality
education have resulted in a shift of preference from Government schools to private schools. Also, slow-paced
capacity creation of Government schools has led to higher enrolments in private institutions. Similarly, in the
higher education segment, GERs are expected to increase from the current levels of 18% to 20% in 2018-2019.
Similarly, it is expected that more numbers of students would opt for professional and technical courses than
general graduation. Further, on account of inflation, players are expected to keep increasing unit prices of books
published by 6-8% annually. Consequently, the school segment is expected to grow at 11% CAGR from ` 98
billion in 2013-2014 to ` 163 billion in 2018-2019. The higher education segment is also expected to grow at
11% CAGR from ` 29 billion in 2013-2014 to ` 48 billion in 2018-2019.
Driven by the increase in the number of students opting for technical and professional courses on account of
better employment prospects, this segment is expected to increase from ` 7.7 billion in 2013-2014 to ` 15.6
billion in 2018-2019. For instance, after eight new IITs were commissioned in 2008, the demand for JEE
coaching has increased substantially. The attraction towards Government jobs is expected to continue to pull
students to appear for civil service exams (both UPSC and State) and this category is expected to continue to
experience strong growth.
The non-academic segment is expected to grow at a slower rate of 8-9% annually over the next five years to
reach from ` 39 billion in 2013-2014 to ` 60 billion in 2018-2019. Although there is expected to be a substantial
increase in the number of leisure readers in India, pirated books as well as the increase in the use of e-books,
which are cheaper than hard copies, are expected to eat into the revenues of the non-academic publishing
industry, especially in the fiction segment.
The following graph shows the estimated growth in school and higher education book publishing in India, from
2013-2014 to 2018-2019:
106
(Source: CRISIL Report.)
The following graph shows the estimated growth in the Indian test prep segment book publishing, from 2013-
2014 to 2018-2019:
Competitive Landscape
The Indian book publishing industry is extremely fragmented, with 19,000 publishers. A majority of these
publishers are family run businesses with revenues of less than ` 1 billion. With 100% foreign direct investment
being permitted in non-news publishing, most of the top international publishing houses have subsidiaries in
India. However, even key international and national publishers have less than 5% market share. Consequently,
competition in this industry is very high.
x School segment:
The largest publishers in the school segment are government based text book publishers like NCERT
and SCERT. Among private players the school segment is dominated by a few national publishers such
as S. Chand, Ratna Sagar, Orient Blackswan and Navneet, and a large number of regional publishers.
107
0XOWLQDWLRQDO FRPSDQLHV ³MNCs´ PDLQO\ SUHVHQW ERRNV IRU WKH &HQWUDO %RDUG RI 6HFRQGDU\
(GXFDWLRQ ³CBSE´ ,&6( ,% DQG ,*6&( ERDUG .H\ 01&V LQ WKH VFKRRO VHJPHQW LQFOXGH
MacMillan, Wiley, McGraw Hill, Pearson and Cengage Learning.
The science and technology segment is dominated by Indian players such as Himalaya, Techmax and
CBS, and MNCs such as McGraw Hill, Wiley, Pearson and Prentice Hall. For medical books, the key
Indian player is Jaypee Brothers, while key MNCs include Elsiever, Wolters Kluwer, Springer, etc. The
books for general streams such as arts, science and commerce are dominated by regional players.
In the test prep segment, there is a mix of MNCs such as Cengage, Wiley, Pearson, McGraw Hill, and
Indian national and regional players such as Himalaya and GK Publications.
x Non-academic segment:
The key MNC publishing houses in the non-academic segment are Penguin, Random House, Hachette
and Harper-Collins, while India players include Rupa and Jaico.
For the academic segment, which accounts for 78% of the Indian book publishing industry, the threat of users
switching to digital formats such as e-books is low. This is on account of the costs associated with procuring
hardware (e-book readers) is high, as well as the low internet penetration in our country. However, academic
publishers are supplementing their book content with multimedia, videos, e-books, etc. for elite schools. On the
other hand, the non-academic segment faces the threat if slower revenue growth as e-book adoption increases, as
they are priced cheaper than paperbacks.
Piracy is rampant in India and accounts for almost 15-20% of all books being sold. In the non-academic
segment, illegally reprinted books impact the revenues of the publishers. Photocopying of books, which is
illegal, is very common in the higher education academic segment.
The market for academic books is marked by a significant presence of second hand books in India. Students
who get promoted sell their books to small retail book shops, who, in turn, sell these books at a steep discount to
new books. However, when the syllabus is revised for a particular course, the second hand books market for that
segment becomes dormant for a few initial years leading to increased demand for new books during that period.
Vocational Education
Vocational education mainly refers to the training imparted to people to prepare them for specific trades in
various fields such as nursing and medicine, retail, automotive, banking and financial services, IT-ITeS, real
estate, and others.
A majority of the Indian population falls into the working age group, which is defined as the population in the
age group 15-59 years. According to the census, the total population of India has grown from 1 billion in 2001
to 1.2 billion in 2011. The share of the workforce in the total population has increased from 59% to 62% during
the same period. It is estimated that 11-12 million people will be added to the Indian workforce annually, over
the next five years, of which a majority will be unskilled.
The labor force participation rate is defined as the share of people in the working age population who are
working or willing to work. Hence, the population which is enrolled in higher education is considered to be out
of the workforce.
The decline in the labor force participation rate in 2009-2010 to 58 per cent as compared to 61 per cent in 2004-
2005 can be attributed to the increase in education avenues and, hence, the increased numbers of enrolments in
108
educational institutions across the country, as well as the recessionary period of 2008-2009, during which a
number of people lost their jobs and were unwilling to provide their services to a different job profile. Hence,
they are considered to be out of the labor force.
It is expected that, with the increase in education avenues, the labor force participation rate will continue to
remain stable over the next four years. It is estimated that, out of the 11-12 million people added to the Indian
workforce annually, 6-7 million people will be added to the labor force annually, over the next five years.
Although the Government has taken initiatives to improve enrolment in schools, drop-out rates in India remain
high. Nearly 40% of the students dropped out of school by the time they reached class IX in 2010-2011 and
nearly 50% dropped out by the time they reached class XI. On the one hand, these dropouts add to the labor
force as unskilled labor while, on the other hand, the industry faces a shortage of skilled workers. Imparting
skills to this population via vocational training programs is expected to help solve this demand-supply
mismatch. Realizing the importance of developing skills, the Government adopted the National Skill
Development Policy in 2009, aimed at providing skills to 500 million people by 2022.
,Q,QGLDVNLOOGHYHORSPHQWLQLWLDWLYHVDUHPDLQO\FDUULHGRXWE\WKH3ULPH0LQLVWHU¶V2IILFHDQGWKHUHVSHFWLYH
Ministries. Under the Prime Minister¶V 2IILFH WKUHH ERGLHV QDPHO\ WKH 1DWLRQDO &RXQFLO RQ 6NLOO
Development, the National Knowledge Commission and the Planning Commission are involved in designing the
skill development initiatives for the Government.
mn persons
150
135
100
50
20 20
15
10
The following chart shows the major vocational training programs conducted through the ministries of the
Government of India:
109
Minis tr y Functions
Responsible for the functioning of the Industrial Training Institute (ITI) and
Industrial Training Centre (ITC), w hich constitute a majority of the
skill development training programmes in the country
Ministry of Labour and Employment
It has also implemented the Modular Employability Scheme w hich has short-
term courses, w hich help in providing an individual w ith the bare minimum
skills to get a job
The Ministry of Rural Development restructured its flagship program, the Swarnajayanti Gram Swarozgar
Yojana, into the National Rural Livelihoods Mission in June 2011, with the objective of reducing poverty and
achieving the Millennium Development Goals by 2015.
The National Rural Livelihoods Mission aims to create platforms for the rural poor in order to help them
increase their household incomes via improved access to financial services and vocational training.
The Planning Commission has allocated ` 290 billion for the National Rural Livelihoods Mission for the 12 th
Five Year Plan. The World Bank has also committed US$ 500 million for the National Rural Livelihoods
Mission.
The Government adopted the National Skill Development Policy in 2009, with the aim of providing skills to 500
million people by 2022. The National Skill Development Cooperation (NSDC) was set up as a part of the
national skill development mission. The National Skill Development Corporation was set up as a public-private
partnership in which 49% is owned by the Finance Ministry and the remaining 51% is owned by industry bodies
such as the Confederation of Indian Industry, National Association of Software and Services Companies,
Federation of Indian Chambers of Commerce and Industry, and the Associated Chambers of Commerce.
Partners associated with the National Skill Development Corporation have trained approximately 0.4 million
people until 2012-2013, of which 54% have been placed.
Approximately 7-8 million people were estimated to have been trained under various vocational training
schemes in 2013-2014. Going forward, the vocational training market is estimated to grow at 22% annually
between 2013-2014 and 2018-2019, in volume terms, i.e., from 9.1 million people expected to be trained in
2014-2015 to 21.2 million people expected to be trained in 2018-2019.
The following chart shows the estimated growth in the number of persons trained under various vocational
training schemes, in the period 2014-2019:
110
(Source: CRISIL Report.)
The National Skill Development Corporation is expected to play a key role, going forward, by fostering private
sector participation in skills development in India via soft loans, tax holidays, and support in curriculum
development and certifications. Consequently, private players will increasingly play a larger role in providing
vocational training in the next few years. The private sector is expected to train nearly 30% of all the people
undergoing vocational training in 2018-2019, whereas they are expected to account for training only 7% in
2014-2015.
Certain sectors such as construction, IT-,7H6 DQG EDQNLQJ DQG ILQDQFLDO VHUYLFHV ³BFSI´ UHTXLUH D KLJKHU
proportion of vocationally skilled employees than others.
The following chart shows the estimated sector-wise requirement for vocationally skilled employees, in the
period 2015-2019:
Construction
The construction industry is a largely labor intensive sector. It is estimated that 80-85% of the total employees in
the construction sector are either unskilled or semi-skilled. It is expected that this sector will have the largest
requirement for vocationally trained people in the next five years. In this sector, the positions of technicians and
foremen, skilled workers and semi-skilled workers can be filled by the vocationally trained workforce. It is
estimated that the total employee strength in the construction sector will grow by 4-5% annually from 57 million
persons in 2013-2014 to 67 million persons in 2018-2019.
111
BFSI
It is estimated that approximately 0.3 million employees will be needed by financial institutions such as banks,
non banking financH FRPSDQLHV³NBFCs´LQVXUDQFHFRPSDQLHVDQG PXWXDO IXQGFRPSDQLHVEHWZHHQ-
2015 and 2018-2019. It is estimated that banks and NBFCs will need approximately 0.23 million more
employees by 2019, whereas insurance companies and mutual funds will need approximately 0.06 million
additional people.
It is also estimated that approximately 0.32 million people will be added to the financial intermediaries (people
who are working on commission basis with financial institutions) over the next five years, most of whom are
currently insurance agents as well as agents for other financial institutions.
It is estimated that the requirement from the financial institutions is primarily for students at the postgraduate
level (approximately 70%). The institutes providing skill development programs find it very difficult to cater to
the demand at the post-graduate level due to the high level of skills at this level. Moreover, most financial
institutions prefer to recruit postgraduates from the formal education stream.
The growth drivers for vocational education in India include the following:
It is estimated that 11-12 million people will be added to the workforce annually over the next five years.
After taking into account the proportion of the workforce that will opt for higher education and those who
choose not to work, 6-7 million people will join the labor force annually over the next five years, of which,
a majority will be unskilled. This presents a significant opportunity for vocational training.
Despite Government initiatives to improve enrolments in schools, over 25% of students dropped out of
school in India in 2010-2011. In the same year, nearly 40% of students dropped out of school by the time
they reached class IX and nearly 50% of students dropped out of school by the time they reached class XI.
These school dropouts add to the unskilled labor force and have to settle for low paying jobs or no jobs,
while the industry faces a shortage of skilled workers. Vocational training can play a major role in bridging
the gap between supply and demand of skilled labor, by equipping this section of the population with the
wherewithal to meet industry requirements.
The Government has taken several initiatives to promote skill development or vocational training in India,
including through the Ministry of Labor and Welfare and the Ministry of Human Resources Development.
In 2009, the Government adopted the National Skill Development Policy, which targets skill-training 500
million people by 2022. The National Skill Development Corporation was set up under the National Skill
Development Policy, to promote skill development and attract private sector participation in this sector.
In May 2014, the Government has created a new Ministry of Skill Development and Entrepreneurship in
order to facilitate skill-training 500 million people by 2022.
112
The Indian education system is divided into two categories, namely, formal and informal. Formal education
includes schools and colleges, while informal education includes pre-schools, coaching classes and
vocational training.
A large proportion of schools and colleges focus mainly on theoretical knowledge. Due to a lack of
practical training, there is sometimes a mismatch in demand and supply for vocationally skilled manpower.
Vocational training is expected to help bridge this gap to a large extent.
Competitive Landscape
In terms of capacities, the vocational training segment is dominated by the public sector. Vocational training is
mostly imparted via various programs under the Ministry of Labor and Employment and the Ministry of Human
Resource Development.
Although the participation of private sector players is increasing, most private sector players offer courses in a
limited set of sectors such as IT-ITeS, BFSI, English and soft skills. Very few players, such as NIIT and Aptech,
have been in the business for a significant period of time. The participation of private sector players has been
increasing since the setting up of the National Skill Development Corporation, which provides soft loans and tax
holidays to private players for setting up vocational training institutes.
Some of the private sector players in this segment include Aptech, Centum Learning, Pratham Institute, ICA
Infotech, Speakwell, ICA Infotech, IFBI, IL&FS Training and others, including Career Launcher.
K+12 Industry
K+12 education is imparted through institutions offering schooling from kindergarten to class XII. These
schools form the largest chunk of the educational services industry in India.
The K+12 education structure in India can be broadly classified on the basis of the following factors:
x Management;
Student enrolment
The GER of K+12 in India was 75.5% in 2011-2012 and is expected to reach 90% in 2018-2019, driven by
factors such as Government initiatives through various policies (including the Sarva Shiksha Abhiyan, Midday
Meal scheme, Rashtriya Madhyamik Shiksha Abhiyan and Right to Education Act, 2009), rising demand for
education and the entry of new private players in the segment. Taking into account population growth in the age
group of 5-19 years as well as increase in GER, enrolments are expected to increase from 247 million students
in 2011-2012 to 285 million students in 2018-2019.
The number of institutions imparting K+12 education is expect to grow from 1.6 million schools in 2011-2012
to nearly 1.8 million schools in 2018-2019, driven by continued Government focus and entry and expansion by
private players. Private players are looking at expanding or entering into the K+12 education space to cater to
the increase in demand with the rising urbanization, disposable incomes, etc. The need for quality education and
better infrastructure, which Government-owned institutions lack, has driven private players to increasingly
invest in the education sector.
113
The following graph shows the estimated enrolment in K+12 until 2018-2019:
200
150
100
50
(Source: District information System for Education (DISE) 2012-13, CRISIL Report.)
The share of private K+12 institutions is expected to gradually rise from 25% in 2008-2009 to 31% in 2018-
2019. This can also be attributed to the higher estimated enrolments per institution in private schools (255 in
2012-2013) as against enrolments in public schools (115 in 2012-2013) (as per DISE 2012-13 report). It is
estimated that private institutes will cater to over 52% of total enrolments in 2018-2019,
The following graph shows the estimated GER in K+12, in the period 2007-2019:
60%
40%
20%
0%
(Source: District information System for Education (DISE) 2012-13, CRISIL Report.)
The following graph shows the estimated growth in the relative shares of the public and private sectors in K+12,
in the period 2009-2019:
114
80% 75%
73%
71%
69%
70%
62%
60% 57%
53%
52%
48%
50% 47%
43%
38%
40%
31%
29%
30% 27%
25%
20%
10%
0%
Public Private Public Private
Institutions Enrollments
(Source: District Information System for Education (DISE) 2012-13, CRISIL Report.)
Across India, especially in urban areas, a large part of the household monthly income is being diverted towards
securing quality education, due to the increased preference for private schools, as they are believed to offer
better quality than public schools.
In the K+12 segment, more schools are seeking affiliation to international boards, especially in metros and
larger cities. The K+12 segment offers significant potential for private players looking to enter the education
sector, given the rising need for quality education, increasing government expenditure on elementary education
and the adoption of a public-private partnership model to facilitate access to school education across the
country.
x Rising urbanization;
x Increase in demand for quality education, better infrastructure facilities, contemporary teaching
methodologies; and
x Government initiatives.
K+12 education in India is regulated entirely at the State level and, hence, regulation differs at every State.
Schools established or funded by State Governments are regulated through State-level boards for secondary (and
higher secondary) education and the education departments of the respective States. Currently, schools that are
fully self-financed (privately owned and fully unaided by Central or State Government agencies) are relatively
less regulated, as compared to Government schools, which are funded by the Central or State Government.
The State Government regulates education through the board of secondary and higher secondary education for
schools owned by the State or affiliated to the State board. Central Government schools affiliated to the CBSE
will be regulated by CBSE and schools affiliated to the ICSE by that board. Now, private schools also get
themselves affiliated to the IGCSE board regulated by the Cambridge University and the IB board regulated by
International Baccalaureate, Geneva. Affiliation with a board is a voluntary decision for schools, except when
the school is fully or partly aided by the State Government; in that case, the school has no choice but to affiliate
with the respective State board.
115
Government policy on education and key initiatives
&HUWDLQRIWKH*RYHUQPHQW¶VLQLWLDWLYHVWRSURPRWHDQGHQVXUHVFKRROLQJRQDODUJHVFDOHDUHDVIROORZV
x Grade I to VIII:
For elementary education, the Sarva Shiksha Abhiyan and the Midday Meal (both are continued from the
11th Five Year Plan) were launched in order to drive growth in the K+12 segment.
The Sarva Shiksha Abhiyan was launched in 2000-2001, to promote and provide universal access to
elementary education, remove gender and social gaps with regard to imparting school education, and
improved the quality of learning. The scheme also seeks to facilitate opening of new schools, provide
inclusive education to children with special needs, and create alternative schooling facilities for out-of-
school children, among other things. The scheme is also key to promoting the education of the girl child and
computer-aided learning.
While the Midday Meal scheme is operational in various states since 1925, it was launched as a centrally
sponsored scheme known as the National Program of Nutritional Support to Primary Education in 1995.
The scheme basically seeks to incentivize and enhance school attendance and also to improve nutritional
levels among children, especially in grades I-V, from the economically weaker sections of society.
x Grade IX to X:
For secondary schooling, the Government launched a separate scheme known as the Rashtriya Madhyamik
Shiksha Abhiyan in 2009 to enhance access to secondary education and also to improve the quality of
education imparted. The scheme also compulsorily ensures that all secondary schools follow the prescribed
norms on eliminating gender, socioeconomic and disability barriers.
Competitive Landscape
Some of the larger players in the Indian K+12 segment include Bharatiya Vidya Bhavan, with a presence across
pre-school, primary, upper primary and secondary schools, Gadson Elementary Magnet School (GEMS) and
Ryan International School, with a presence across primary, upper primary and secondary schools, and others.
116
OUR BUSINESS
Overview
We are a diversified provider of educational products, services, content and infrastructure in India, with a
presence across the education value chain. We commenced operations in 1996 as a provider of MBA test
preparation courses and since commencement of operations, we have diversified our operations across four
segments across the education value chain: test preparation and training, generally referred to as test prep,
conducted under the widely-UHFRJQL]HG EUDQG µ&DUHHU /DXQFKHU¶ SXEOLVKLQJ DQG FRQWHQW development,
FRQGXFWHGXQGHUWKHEUDQGµ*.3XEOLFDWLRQV¶.-VFKRROVRSHUDWHGXQGHUWKHEUDQGµ,QGXV:RUOG6FKRROV¶
with 10 schools across India; and vocational training programs implemented by us under Government schemes
in various States across India, as well as recruitment, training and event management services for corporates.
Under the umbrella of our Career Launcher test prep courses, we offer leading test prep courses for MBA, Civil
Services and Law, as well as courses for, among others, Engineering, Bank entrances, GATE and Staff Selection
&RPPLVVLRQ³SSC´368HQWUDQFH (Source: CRISIL Report). For fiscal 2014, we had 67,549 enrolments in
our test prep segment across a network of 164 test prep centers in 73 cities throughout India, with 76 owned
centers RIZKLFKDUHWHPSRUDU\µ6PDUW&DUHHU&HQWHUV¶and 88 centers operated under a partnership model.
In addition, we had two owned test prep centers in UAE. Out of our total student enrolments, as on March 31,
2014, we had 32,286 enrolments in our MBA courses, followed by 12,138 enrolments in our Civil Services
courses, and 9,220 enrolments in our Law courses. Our students have established a strong success record for us,
across our test prep business. For instance, 67 of our students secured ranks in the top 100 successful candidates
in the CLAT examination held in May 2014, and 1,632 of our students received interview calls from at least one
IIM in the CAT examination held in October and November 2013. Further, 742 of our students qualified for
Civil Services Main Examinations, of which 176 of our students were in the final merit list of Civil Services
Main Examinations held in 2013.
With our acquisition of the GK Publications business in November 2011, we believe that we have an established
brand in the publishing and content development business, in particular, a brand that has built a reputation for
publishing niche test prep books, guides, mock test papers and question banks for popular professional and
entrance examinations in India, including titles for Engineering, GATE, Civil Services and Bank entrances.
During the year ended March 31, 2014, we had released 945 titles and had sold over 1.1 million copies under the
brand GK Publications. As on March 31, 2014, we had a network of over 1,000 dealers and distributors, across
several States in India.
We provide infrastructure, educational services and license our µ,QGXV:RUOG6FKRROV¶brand to 10 K-12 schools
across India, providing English-PHGLXP HGXFDWLRQ WKURXJK WZR VFKRROV XQGHU WKH µ2wned-,QIUDVWUXFWXUH¶
PRGHO VL[ VFKRROV XQGHU WKH µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ PRGHO DQG WZR VFKRROV XQGHU WKH µ(GXFDWLRQDO
3DUWQHUVKLS¶ PRGHO 6HH ³-Our Business Operations ± K-12 Schools´ EHORZ $V RQ 0DUFK 2,612
students were enrolled in the Indus World Schools RSHUDWHGXQGHUWKHµ2ZQHG,QIUDVWUXFWXUH¶DQGµ,QIUDVWUXFWXUH
3DUWQHUVKLS¶PRGHOV, across the States of Punjab, Delhi NCR, Madhya Pradesh, Chhattisgarh, Maharashtra and
Haryana.
In the vocational training segment, we had an aggregate of 8,233 enrolments in our vocational training programs
implemented by us under project tenders issued by the Central and various State Governments, during fiscal
2014, across the States of Gujarat, Rajasthan, Jharkhand, Chhattisgarh, Madhya Pradesh and Uttar Pradesh.
With the Government of India and other State Governments promoting private participation in their drive for
VNLOO GHYHORSPHQW LQ ,QGLD LQFOXGLQJ WKURXJK WKH 3ULPH 0LQLVWHU¶V 1DWLRQDO 3ROLF\ RI 6NLOO 'HYHORSPHQW
seeking to train 500 million people in India by 2022, we believe that there is a significant growth opportunity in
the vocational training segment. In addition, we undertake certain recruitment, training and event management
services for corporates from time to time, through our Subsidiary, Kestone, which, we believe, enables us to
build relationships with corporates and drives our placement programs for enrolments in our vocational training
programs.
Our revenue from operations for fiscal 2014, 2013 and 2012 aggregated to ` 2,186.85 million, ` 1,989.72
million and ` 1,657.31 million, respectively, on a consolidated basis. Revenues from our test prep business
aggregated to ` 1,016.46 million, ` 985.67 million and ` 809.10 million, respectively; revenues from our
publishing and content development business, conducted under the brand GK Publications, aggregated to `
180.93 million, ` 149.60 million and ` 55.43 million, respectively; revenues from the K-12 schools operated
117
under the brand Indus World Schools, aggregated to ` 60.85 million, ` 52.83 million and ` 91.82 million,
respectively; revenues from our vocational training programs aggregated to ` 162.87 million, ` 146.11 million
and ` 70.67 million, respectively; and revenues from our recruitment, training and event management services
for corporates aggregated to ` 733.83 million, ` 627.83 million and ` 604.11 million, respectively; for fiscal
2014, 2013 and 2012. Our profit after tax for fiscal 2014, 2013 and 2012 aggregated to ` 163.24 million, `
147.43 million and ` (61.90) million, respectively, on a consolidated basis.
Strengths
Diversified provider of educational products, services, content and infrastructure, with pan-India presence.
We commenced operations as a provider of MBA test prep courses. Over the last two decades, we have
diversified our operations in four business segments, spanning opportunities across age groups and across the
education value chain: test prep, under the brand Career Launcher, for MBA, Civil Services, Law, among other
courses; publishing and content development, under the brand GK Publications, publishing books, guides, mock
test papers and question banks for professional and entrance examinations in India, particularly Engineering,
GATE, Civil Services and Bank entrances; K-12 schools, under the brand Indus World Schools; and vocational
training programs under Government schemes in various States across India, as well as recruitment, training and
event management services for corporates.
With a view to maximizing our reach and enhancing revenue across student age groups and across the education
value chain, we had a network of 164 test prep centers in 73 cities throughout India, as on March 31, 2014, with
a comprehensive array of course offerings; our publishing and content development business, which includes
our in-house content development team, and 945 titles and a network of over 1,000 dealers and distributors, as
on March 31, 2014; 10 Indus World Schools located across the States of Punjab, Delhi NCR, Madhya Pradesh,
Chhattisgarh, Maharashtra, Haryana and Himachal Pradesh; and vocational training courses conducted from
time to time in various States in India, as well as recruitment, training and event management services for
corporates, through our Subsidiary, Kestone.
We believe that our multi-pronged approach to growth across the education value chain provides us with a
strategic advantage over competitors who generally remain focused on individual segments in the education
value chain.
Under the umbrella of our Career Launcher test prep courses, we offer leading test prep for MBA, Civil Services
and Law, as well as courses for, among others, Engineering, Banking, and SSC. We have established a
standardized set of modules and procedures across our systems with respect to our test prep business, which, we
believe, allows us to achieve operating efficiency and consistency in curricula delivered throughout our
extensive network of test prep centers across our wide course portfolio, including in test prep centers operated
under our partnership model.
For fiscal 2014, we had 67,549 enrolments in our test prep courses, as compared to 60,646 enrolments during
fiscal 2012. In addition to growth in enrolments across our test prep business over the years, we have seen
robust growth in enrolments in our recently launched courses, which we believe is indicative of our success in
DQWLFLSDWLQJ DQG FDWHULQJ WR PDUNHW WUHQGV DQG RXU VWXGHQWV¶ H[SHFWDWLRQV )RU LQVWDQFH RXU &LYLO 6HUYLFHV
courses, had 859 enrolments in fiscal 2010 and had 12,138 students enrolled as on March 31, 2014. Further, as
on March 31, 2014, we had 2,723 enrolments in our Banking courses, and 2,305 enrolments in our SSC courses.
We believe that our reputation and market position, especially in the aptitude-based test prep segment, are based
not only on our corporate philosophy, business ethos, quality courses and results-oriented, innovative and
differentiated pedagogy, but also on our strong success records in niche professional and entrance examinations
in India. For instance, 67 of our students secured ranks in the top 100 successful candidates in the CLAT
examination held in May 2014, and 1,632 of our students received interview calls from at least one IIM in CAT
examination held in October 2013. Further, 742 of our students qualified for Civil Services Main Examinations,
of which 176 of our students were in the final merit list of Civil Services Main Examinations held in 2013.
118
In addition, we have established an in-house content development team, with domain and subject expertise, with
a view to continuing to grow and enhance the quality of our content library. Further, we engage faculty
members, trainers and content developers who have years of experience in their specialized fields, as well as
students who have enjoyed success in the respective professional or entrance examinations in the past.
We believe that Career Launcher is a well-recognized brand in the education sector, particularly in aptitude-
based test prep courses. Furthermore, with our acquisition of the GK Publications business in November 2011,
we believe we have an established brand in the publishing and content development business. In addition, Indus
World School is a well-recognized brand in the K-12 schools segment, among private English medium schools
in India. Indus World Schools were ranked 5th among the top 100 organizations to work for in India, in the Great
Place to Work India survey 2013, and among the top 50 organizations to work for in India as well as the second
best in the education sector, in the Great Place to Work India survey 2012. We also enjoy strong relationships
with several reputed corporates in our recruitment, training and event management business, and with various
State Governments and other Government agencies in relation to our vocational training business.
We believe that our strong brand image and reputation represent our commitment towards academic excellence
and enable us to better position and market our courses and services to students and parents. Moreover, we
believe that our growing brand equity serves to strengthen the relationships that we have cultivated across the
education value chain over the years, with our students (including our alumni) and parents, faculty and trainers,
corporate customers, Governments and Government agencies, and other industry players across India.
Therefore, we believe that we are well-positioned to capitalize on our brand equity to expand our distribution
networks and course offerings across the education value chain in India.
We believe that we have been successful in selectively identifying strategic acquisition targets in the past, and in
integrating, developing, synergizing and leveraging the existing businesses and brand equity of our past
acquisitions to grow our business across the education value chain. We believe that our successful inorganic
growth strategies have contributed to our robust and consistent financial performance.
Our acquisitions in the test prep segment including our past strategic acquisitions of Law School Tutorials
³LST´LQ.KXUDQD,QIRUPDWLRQDQG7UDLQLQJ6\VWHPV3ULYDWH/LPLWHG³KITS´LQDQG$UXQ5R\
&ODVVHV ³ARC´ LQ HDFK RI ZKLFK KDYH EHHQ XQGHUWDNHQ ZLWK WKH REMHFWLYH RI DGGLQJ HLWKHU D QHZ
geography or a new product category to our business in the test prep segment. In our publication and content
development business, we believe that our acquisition of GK Publications in November 2011 allowed us to,
among other things, reach out to students relying more on self-study than on classroom training. We also
acquired Kestone in 2008, with the objective of entering into the vocational training business and recruitment,
training and event management business, which we have continued to grow since the date of this acquisition.
Professionally qualified, experienced and entrepreneurial management team, and quality human capital.
We believe that we operate in an industry where the quality of our people is a critical asset. In particular, we
believe that we benefit significantly from the vision, strategic guidance, experience and skills of several key
members of our management team, including our individual Promoters and founders, Satya Narayanan .R.,
Gautam Puri, Nikhil Mahajan, R. Shiva Kumar, Sreenivasan .R, and Sujit Bhattacharyya, who, have an average
of 16 years of experience in this business. We also had a large pool of faculty of 84 instructors for our test prep
business as on March 31, 2014, including management, engineering and other postgraduates, or professionals
such as chartered accountants and company secretaries or who have obtained educational degrees. In addition,
we have established an in-house content development team, with domain and subject expertise, with a view to
continuing to grow and enhance the quality of our content library.
Each of our individual Promoters is an IIT and/or IIM graduate, with a record of entrepreneurial success and/or
years of experience at reputed companies or organizations. In addition, we engage faculty members, trainers and
content developers who have years of experience in their specialized fields, as well as students who have
enjoyed success in the respective professional or entrance examinations in the past. We also actively recruit
professionally qualified individuals from renowned institutions or organizations in India to fill important
management and executive roles, and we conduct continuous training programmes including refresher guidance
119
programmes for faculty members throughout the year on teaching subjects, personality development, attitude
development, presentation, communication and leadership skills and time management, in order to better equip
RXU IDFXOW\ PHPEHUV WR DGDSW WR RXU VWXGHQWV¶ FKDQJLQJ QHHGV LQ WKH FRPSHWLWLYH HQYLURQPHQW DQG FKDQJLQJ
examination trends, academic syllabi and increasing career options. Our faculty training sessions help us in
attaining and maintaining quality across our operations, which, we believe, constitutes a significant competitive
advantage, especially vis-à-vis smaller and regional players, who rely on one or a few renowned teachers.
We believe that the core members of our management team, along with some of our core faculty members and
trainers and key executives have, collectively, been instrumental in developing our results-oriented, innovative
and differentiated pedagogy, business ethos and course as well as publishing content, and in building strong
institutional relationships over the years, and that, with their involvement, we are well positioned to continue to
tap growth opportunities across the education value chain in India in the future.
Strategies
Our aim is to strengthen our market position and brand recognition, by continuing to pursue the following
growth strategies:
Expand our geographical footprint and increase center utilization across India, in our test prep business.
Given the limited numbers of seats available across the spectrum of organized employment opportunities in
India as well as the extremely skewed student to seat ratio at many universities and higher educational institutes
DFURVV ,QGLD ZH EHOLHYH WKDW WHVW SUHS FRQVWLWXWHV D FULWLFDO WRRO IRU HQKDQFHPHQW RI VWXGHQWV¶ DSWLWXGH DQG
knowledge for entry into such educational institutes and, therefore, that there is significant untapped market for
our test prep courses across a wide array of courses and subjects. We also believe that a shift from knowledge-
based to aptitude-based testing is leading to market consolidation, providing us with a unique opportunity to
capitalize on favorable demographics throughout the growing education sector in India. Moreover, we believe
that aptitude-based test preparation is a scalable business, compared to knowledge-based test preparation, which
is generally more individual-driven, which offers us a unique growth opportunity in this segment, across a wide
array of course offerings.
Accordingly, we seek to continue extending our distribution network and revenue generating opportunities
across India, including in the southern and western regions of India, primarily through the scalable, asset-light,
less capital-intensive partnership model, subject to our systematic selection process and service standards for
business partners as well as our analysis of demographic and other local factors (in order to align our course
offerings with local needs, while maintaining the efficiency of our operations through our centralized control
mechanisms and standardized training and content development processes). In this relation, we may also
continue to explore other strategic organic and inorganic growth opportunities that may arise for us in the future.
In addition, we are continuing to explore opportunities to expand our current course offerings and to improve
center utilization, including by way of increasing the number of course offerings per test prep center. For
example, we believe that introduction of more non-MBA courses at individual test prep centers will improve our
center utilization and offer our students a more comprehensive portfolio of course offerings from each of our
individual test prep centers, thus enhancing our revenue generation potential and mitigating concentration risks
from each test prep center. In this relation, we believe that our future success in the test prep business will
significantly depend on our ability to LGHQWLI\DQGFDWHUWRFKDQJLQJWHVWSUHSQHHGVDQGVWXGHQWV¶H[SHFWDWLRQV
For instance, while business and management programs have historically been the largest and fastest growing
areas of the education sector in India, including for our business, we expect to see robust growth in courses such
as Engineering, Banking, Civil Services and SSC test prep (due, in part, to the recent global financial crisis and
its lingering worldwide effects, which resulted in volatility in placement opportunities for management
graduates in India and worldwide, as well as incentivizing certain students to instead seek placements in the
public sector, which is seen as a more stable career option in India).
Develop and derive synergies from our publishing and content development business.
As part of our ongoing larger strategy of diversification, we seek to continue to develop and derive synergies
from our publishing and content development business, including in terms of extending our point-of-sale
network and expanding our content library, through our in-house content development team as well as
otherwise.
120
We believe that our GK Publications business is synergistic with our existing lines of business, in particular, our
test prep business, allowing us to, among other things, reach out to what we believe to be a significant student
population currently relying on self-study instead of classroom training and tutorials. Accordingly, we seek to
FRQWLQXH WR OHYHUDJH DQG IXUWKHU GHYHORS *. 3XEOLFDWLRQV¶ VWURQJ EUDQG YDOXH DQG PDUket reputation, wide
content library, and extensive distribution network to increase brand recall and, therefore, tap further
opportunities for cross-selling our test prep courses (i.e., among students buying GK Publications titles, to
incentivize them to enroll in our test prep courses) and for continuing to monetize our content (including content
developed and published in-house under the brand GK Publications) through using such content as course
materials and supplementary reference materials in our test prep business expand on distribution network. For
instance, we are exploring opportunities for the introduction of bilingual and multilingual titles within our
overall content library, with the objective of foraying into and deepening our presence in regional markets.
We seek to explore opportunities for better capacity utilization at the Indus World Schools, particularly the
schools for which we provide infrastructure and education services, including through increasing the intake
capacity for each grade as well as the grades offered at such schools, accompanied by expansion of the
infrastructure offered at such schools, including libraries, laboratories and other facilities and amenities required
in relation to the increased number of enrolments.
We believe that the consolidation and growth of our K-12 schools business, including in terms of increased
HQUROPHQWVDWWKH,QGXV:RUOG6FKRROVZRXOGVHUYHWRLQFUHDVHVWXGHQWV¶H[SRVXUHWRRXUEUDQGDQGTXDOity of
service at an earlier age and, thus, incentivizing them to seek our test prep courses under the brand Career
Launcher, as well as our content developed and sold under the brand GK Publications, in the future (at the time
that such students begin to prepare for higher education and professional entrance examinations). Towards this
objective, we seek to continue our focus on marketing and brand building initiatives for our K-12 schools
business, as well as seeking to provide a better learning experience at the Indus World Schools, including in
terms of quality of educational content and delivery as well as school infrastructure.
:H H[SHFW WKDW ,QGLD¶V WUDQVLWLRQ IURP D SULPDULO\ DJULFXOWural economy to a more service-oriented economy,
coupled with increasing geographical mobility influenced by job aspirants seeking to migrate from rural and
semi-urban regions to larger and more urban cities and towns, which may offer more attractive employment
opportunities, provides us with a unique opportunity to continue to grow our vocational training business, which
we commenced in fiscal 2008 across regions in India, for aspirants seeking employment in sectors and areas
including retail and sales management, data entry, hospitality, computer hardware, automotive repair,
refrigeration and air conditioning. We believe that, despite a relatively large graduate pool, a large number of
job aspirants in India lack formal vocational training or identifiable vocational skills and industry-readiness,
exacerbated by infrastructural constraints in the Indian public education system.
With the Government of India and other State Governments promoting private participation in their drive for
skill development in IQGLDDQGZLWKWKH3ULPH0LQLVWHU¶V1DWLRQDO3ROLF\RI6NLOO'HYHORSPHQWVHHNLQJWRWUDLQ
500 million people in India by 2022, we believe that there is a significant growth opportunity in the vocational
training segment. Pursuant to this policy statement, various Central and State Government ministries have also
identified specific targets within their respective administrative jurisdictions and for each current year. Vendor
selection for such Government funded vocational training programs is based on criteria including our technical
competencies, past experience and our projected costs of implementing such programs. In view of our robust
and varied technical competencies, recent relevant experience and strong placement record, including in respect
of 8,233 students enrolled and 4,395 students placed by means of our vocational training programs implemented
under Government schemes across the States of Gujarat, Rajasthan, Jharkhand, Chhattisgarh, Madhya Pradesh
and Uttar Pradesh as on March 31, 2014, we believe that we are well-positioned to continue to successfully
build credentials and compete for and win contracts for implementation of vocational training programs
launched and conducted under various Government schemes in various States across India, in the future.
We also intend to continue providing recruitment, training and event management services in the private sector
through our Subsidiary, Kestone, which we believe has been instrumental in our developing strong relationships
121
with corporates across India. Towards this objective, we seek to continue to explore and develop relationships
with new corporates, as well as launching new training projects with corporates.
We seek to extend our customer base and revenue-generation capabilities, including through exploring a variety
of innovative and technology-enhanced platforms as well as new media initiatives, to target the growing and
increasingly mobile Indian middle class with rising household incomes, and, accordingly, to cross-leverage our
online and offline delivery modes to increase capacity utilization at each of our individual test prep centers. For
instance, we are continuing to develop our online testing modules as well as mobile and tablet applications in
relation to our test prep courses, which we believe provides us with a cost-effective and flexible means of
extending our visibility and market reach beyond our physical test prep network, and facilitates our students in
interacting with, and receiving instruction from, our test prep instructors through the Internet and mobile
platforms. As the Internet continues to gain widespread use and acceptance throughout India, we seek to
leverage our well-recognized education brand to develop new and complementary online programs, services and
products in our test prep business and other areas.
Moreover, we are exploring opportunities to grow our content development and publication business, through
publication of e-books or other modes of digital distribution, including by way of strategic alliances or tie-ups in
the future. We are also exploring a variety of innovative and technology-enhanced platforms to provide
interactive content, as well as new media initiatives, with the objective of continuing to grow our K-12 schools
business. We believe that such initiatives would allow us to reach out to, and engage with, a significant student
and customer base beyond our physical network of dealers and distributors for our publication and content
development and K-12 schools businesses, respectively, thus providing us with a significant competitive
advantage over other players in the educational sector, who may be continuing to rely on conventional modes of
marketing and distribution.
Since commencement of operations, we have diversified our operations across four segments, spanning
opportunities across age groups and across the education value chain: test prep, under the brand Career
Launcher, offering test prep courses for MBA, Civil Services and Law, among other courses; publishing and
content development, under the brand GK Publications; K-12 schools under the brand Indus World Schools; and
vocational training programs implemented under Government schemes in various States across India, as well as
recruitment, training and event management services for corporates.
Our business segment-wise revenues for the last five fiscals are provided below.
(in ` million)
Fiscal Fiscal Fiscal Fiscal Fiscal
2014 2013 2012 2011 2010
Test preparation and training 1,016.46 985.67 809.10 810.06 843.39
Publishing and content development 180.93 149.60 55.43 - -
K-12 Schools 60.85 52.83 91.82 19.27 27.21
Vocational Training 162.87 146.11 70.67 27.87 -
Recruitment, training and event management services for
corporates 733.83 627.83 604.11 336.50 265.00
Other income 31.91 27.68 26.18 80.08 50.03
Total operating revenue 2,186.85 1,989.72 1,657.31 1,273.78 1,185.63
122
The following map illustrates our India-wide presence, as on March 31, 2014*:
*The map indicates cities in which our Company has test prep centers, vocational centers, schools and GKP offices. Additionally, our
Company has two test prep centers in the UAE.
Since we commenced operations in 1996 as a provider of MBA test prep under the brand Career Launcher, we
have expanded our array of test prep courses to include Law, Banking, Civil Services and several others. In
addition to our organic growth in this segment, we acquired the entire business of LST, on a going concern
basis, pursuant to an agreement dated September 23 DORQJ ZLWK /67¶V JRRGZLOO WUDGH QDPH DQG
intellectual property. Our acquisition of LST expanded our then-existing product portfolio in our test prep
business (which, at the time, was more focused on courses for MBA test prep) to include Law. Our acquisition
of the intellectual property of KITS pursuant to an agreement dated December 1, 2000 enabled us to grow our
product portfolio as well as our presence in the Mumbai and Maharashtra region. Our acquisition of ARC
pursuant to an agreement dated March 31RQDJRLQJFRQFHUQEDVLVDORQJ ZLWK $5&¶VJRRGZLOOWUDGH
name and intellectual property, enabled us to grow our presence in the Engineering test prep market, particularly
in the Mumbai region.
As on March 31, 2014, we had a network of over 164 test prep centers in 73 cities throughout India, with 76
owned centers RIZKLFKDUHWHPSRUDU\µ6PDUW&DUHHU&HQWHUV¶and 88 centers operated under a partnership
model. Our leading test prep courses include MBA, Civil Services and Law. Our students have established a
strong success record for us, across our test prep business. For instance, 67 of our students secured ranks in the
top 100 successful candidates in the CLAT examination held in May 2014, and 1,632 of our students received
interview calls from at least one IIM in CAT examination held in October 2013. Further, 742 of our students
qualified for Civil Services Main Examinations, of which 176 of our students were in the final merit list of Civil
Services Main Examinations held in 2013.
123
Certain key details of our product portfolio, as on and for the year ended March 31, 2014, are set out below.
S. Name of Nature of No. of No. of Total No. No. of No. of Total No. of Placement/
No. Product Entrance Test Owned of Centers Students Students Students Success Ratio
Exam Centers Centers operated Enrolled Enrolled Enrolled
(Aptitude/ Offering Offering by our for this for this for this
Knowledge this this Business Product at Product at Product
Based) Product Product Partners Owned Centers across
Offering Centers operated by Owned and
this our Centers
Product Business operated by
Partners our
Business
Partners
Graduate
1. Banking Aptitude 71 20 51 656 2,067 2,723 -
2. Campus Aptitude 54 25 29 468 772 1,240 -
Express
3. Civil Services Aptitude + 38 25 13 11,705 433 12,138 742 Selected for
Knowledge Civil Services
Main
Examinations.
176 selected in
final merit list
4. GATE Aptitude + 11 8 3 379 205 584 -
Knowledge
5. MBA Aptitude 104 37 67 17,741 14,545 32,286 1,632 Students
receiving at least
one IIM Call in
CAT 2013
6. SSC Aptitude + 60 11 49 1,415 890 2,305 -
Knowledge
Undergraduate
7. Law ± CLAT Aptitude 95 37 58 4,451 4,761 9,220 67 in the top 100
Law - NLU, As on, March 31,
Delhi 2012, names of
54 students
appeared in the
first list of
selected and
waitlisted
candidates
8. Engineering Knowledge 15 8 7 637 685 1,322 -
9. After 12 Aptitude 62 35 27 1,928 2,342 4,270 -
(Includes
Business
Administration
and Hotel
Management)
10. Others Aptitude 5 4 1 178 66 244 -
International
11. GMAT, GRE Aptitude 35 25 10 806 280 1,086 -
and SAT
:H DOVR RIIHU FDUHHU FRXQVHOLQJ WKURXJK µ)XWXUH0DS¶ RXU FDUHHU JXLGDQFH SURJUDP DV ZHOO DV µ&DPSXV
([SUHVV¶ SURJUDPV WR FRXQVHO VWXGHQWV RQ YDULRXV DVSHFWV RI FDPSXV UHFUXLWPHQW LQWHUYLHZV SHUVRQDOLW\
assessment and participation in group discussions and other group exercises.
We seek to provide our test prep courses through a mix of offline and online modes, i.e., through classroom
learning as well as by monetizing content via video delivery of classes and online testing to maximize reach and
enhance revenue (and supplementing these product and service offerings with our own publishing and content
development business), which we believe, enhance sensory learning and contribute to greater retention.
124
The pricing of our courses generally varies depending on the locations where our centers are situated.
Regardless of whether students are enrolled at our owned centers or at centers operated by our business partners,
student ownership resides with us and fees paid by students at centers operated by our business partners are
payable to our designated bank accounts (after which we settle our revenue share with our business partners, on
a regular basis), and each student receives a unique online customer identity and account as part of our Student
Information 6\VWHP ³SIS´ 6WXGHQWV DOVR UHFHLYH SK\VLFDO VWXGHQW LGHQWLW\ FDUGV LGHQWLI\LQJ WKHP DV RXU
students. Moreover, students receive the same course curricula and materials for the respective courses,
regardless of whether they are enrolled at our owned centers or at centers operated by our business partners.
Owned Centers
In our test prep business, we directly lease or own the premises from which we operate our owned centers, as
well as directly owning or leasing the equipment and infrastructure used at such centers, and we receive the
entire revenue generated by, and bear the full cost of operating, such owned centers.
In our test prep business, in addition to our owned centers, we operate on a partnership model to expand our
geographical presence across the country. As on March 31, 2014, we had 88 centers operated by our business
partners in India.
We enter into non-exclusive service agreements with third parties for individually specified territories or
regions, in respect of which our business partners licence from us, and operate under, the brand Career
Launcher, typically for a period of three years and generally with an option for renewal for a further period of
three years, and terminable at our option on the occurrence of any specified events of default (subject to an
appropriate cure period in case of defaults capable of remedy), including payment defaults or using the
infrastructure and resources dedicated to us at our centers for any other purposes or for infringing or otherwise
misusing our trademarks or any other of our brands or materials.
Our agreements with our business partners do not restrict us from entering into similar agreements or
arrangements with other business partners in the same market space.
Our business partners operate our test prep centers in consideration of a one-time upfront licence fee payable by
them to us for use of our brand and intellectual property and for pre-commencement training. Out of the fees
paid by students (including tuition fees, advances and deposits), our business partners receive a specified service
fee as a percentage of center revenue, which varies from 70% to 85% depending on the test prep product.
We undertaNH V\VWHPDWLF VHOHFWLRQ SURFHVV WR HQVXUH RXU EXVLQHVV SDUWQHUV¶ FRPSDWLELOLW\ ZLWK RXU EXVLQHVV
philosophy and ethos. We also leverage our experience in training faculty to enhance the quality of instruction
and retention of trained faculty at our test centers. We seek to maintain standardized delivery and quality across
our test centers, by setting service standards in our service agreements, providing induction programs, providing
course content and study materials, guidelines for conduct of classes, tests and examinations, as well as
technological support and training to teaching and sales staff. We also engage in periodic conferences with, and
require periodic reporting from our business partners and retain rights for inspection and audits of the centers
and their assets and records. The site, equipment, furniture, furnishings, fixtures and signs and cost of personnel
including faculty are provided by our business partners. Our business partners are generally required to seek our
prior consent for activities such as any change in the location or site of the center, any change in the payment
structure, or for opening other professional learning centers or otherwise providing any competing or other
educational services within or outside the same specified territories or utilizing the same premises for any other
purposes.
We also reserve the right to interact with students directly, to obtain feedback and for research and quality
control. Moreover, with a view towards quality control, in the event of any breach or irregularity in relation to
student admissions or payments by our students enrolled at test prep centers operated by our business partners,
125
RXUEXVLQHVVSDUWQHUVDUHREOLJDWHGWRXQGHUWDNHGLUHFWUHVSRQVLELOLW\WRFRPSHQVDWHVWXGHQWV¶IHHVLQDGGLWion to
any liability for penalty leviable by us in relation to such breach or irregularity.
Revenues from our test prep business aggregated to ` 1,016.46 million, ` 985.67 million and ` 809.10 million,
respectively, for fiscal 2014, 2013 and 2012, representing 46.48%, 49.54% and 48.82% of our total revenue
from operations for fiscal 2014, 2013 and 2012, respectively, on a consolidated basis.
Our owned centers and centers operated by our business partners contributed 48.38% and 51.62%, respectively,
of our total test prep revenue in fiscal 2014, compared to 42.52% and 57.48%, respectively, of our total test prep
revenue in fiscal 2013, and 40.99% and 59.01%, respectively, of our total test prep revenue in fiscal 2012.
With our acquisition of the GK Publications business in November 2011, we entered into the publishing and
content development business, as part of our ongoing strategy of expansion and diversification. We seek to
OHYHUDJH*.3XEOLFDWLRQV¶EUDQGLPDJHDQGPDUNHWUHSXWDWLRQWRUHDFKRXWWRZKDWZHEHOLHYHWREHDVLJQLILFDQW
student population currently relying on self-study instead of classroom training and tutorials, to cross-sell our
test prep courses and online testing services to them.
While we operate our publication business from premises located in Roorkee in the State of Uttarakhand, we
outsource certain printing activities to various third party printers from time to time, on a job work basis. We do
not have long-term arrangements with our dealers and distributors.
In addition to our publication and content development business described above, we generate revenues from
advertisements placed in titles published under the brand GK Publications.
Revenues from our publishing and content development business, conducted under the brand GK Publications,
aggregated to ` 180.93 million, ` 149.60 million and ` 55.43 million, respectively, for fiscal 2014, 2013 and
2012, representing 8.27%, 7.52% and 3.34% of our total revenue from operations for fiscal 2014, 2013 and
2012, respectively, on a consolidated basis.
K-12 Schools
We believe that the brand Indus World Schools is well-recognized in India, in the K-12 schools segment,
particularly, in the private English-medium schools segment.
We seek to ensure that the Indus World Schools are among the best recognized schools in their respective
locations, in terms of factors including education quality and fees. For instance, in the 2013 survey of Top
Schools in India conducted by Education World, Indus World School, Gurgaon, which was set up in 2010,
ranked 8th best school in the NCR; Indus World School, Indore and Indus World School, Raipur, ranked 7 th and
10th in the combined list for Madhya Pradesh and Chhattisgarh, and Indus World School, Ludhiana ranked 7 th in
the list of schools for Ludhiana (within 24 months of its opening).
126
Indus World Schools were ranked 5th among the top 100 organizations to work for in India, in the Great Place to
Work India survey 2013, and among the top 50 organizations to work for in India as well as the second best in
the education sector, in the Great Place to Work India survey 2012.
As per the Indian industry and regulatory framework for K-12 schools, schools are required to be run by a
registered society or trust on a non-profit basis. Therefore, the Indus World Schools include two schools under
WKH µ2ZQHG-,QIUDVWUXFWXUH¶ PRGHO RSHUDWHG WKURXJK WKH 1DODQGD )RXQGDWLRQ VL[ VFKRROV XQGHU WKH
µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ PRGHO RSHUDWHG WKURXJK WKH 1DODQGD )RXQGDWLRQ, other than the Indus World
School in Gurgaon, Haryana, which is operated by certain individuals), and two schools operated under the
µ(GXFDWLRQDO3DUWQHUVKLS¶PRGHORSHUDWHGWKURXJKWKHUHVSHFWLYHVFKRROWUXVWVDVH[SODLQHGEHORZ
In relation to our K-12 schools business, we have conducted market studies to identify suitable locations for the
Indus World Schools, taking into consideration factors such as local demographic features, capacity saturation,
achievable fee point and availability of infrastructure. Accordingly, once we had identified suitable locations,
we determine the most feasible model for the operation of such schools, including a systematic selection process
to identify suitable infrastructure and education partners, where relevant, taking into consideration factors such
as their mindset and commitment WRZDUGV D SDUWQHUVKLS DQG WR JXLGH DQG HQVXUH RXU SDUWQHUV¶ FRPSDWLELOLW\
with our business philosophy and ethos. In our K-12 schools business, although we provide educational services
including training of teachers, the teaching and non-teaching staff in all of the Indus World Schools is employed
by the respective school trusts that operate and manage the Indus World Schools.
Set out below are details of each of our models for operation of the Indus World Schools:
µ2ZQHG-,QIUDVWUXFWXUH¶PRGHO
There are two owned Indus World Schools, situated in the States of Chhattisgarh and Madhya Pradesh in India,
which are operated by the Nalanda Foundation. We provide: (a) educational services (brand, academic content,
technology support, human resources systems including training of teachers), through our Subsidiary, CLEIS, in
return for a one-time licence and training fee and a specified annual fee; and (b) infrastructure (including the
land and building, furniture, fixtures, computers, laboratory equipment, etc.), through our Subsidiary, CLIP, in
return for a one-time infrastructure fee and a specified annual fee.
The agreements for providing educational services, entered into between CLEIS and Nalanda Foundation are for
a term of 10 years and can be terminated mutually by either party giving VL[ PRQWKV¶ notice. However, the
agreements may be terminated by CLEIS without any further notice if, Nalanda Foundation fails to pay fees to
CLEIS for a period of three months. These agreements are also terminable at the option of the non-defaulting
party in case there is any material or persistent breach by the other party which is not rectified within 15 days.
The agreements for providing infrastructure, entered into between CLIP and Nalanda Foundation are for a term
of 30 years and can, after the expiry of the term, be terminated by either party by giving a 30 day notice.
However, if the agreement is terminated by Nalanda Foundation prior to the expiry of term of the agreements,
Nalanda Foundation will not be entitled to the refund of the security deposit. These agreements are also
terminable at the option of the non-defaulting party in case there is any material or persistent breach by the other
party which is not rectified within 30 days.
µ,QIUDVWUXFWXUH3DUWQHUVKLS¶PRGHO
We provide: (a) educational services (brand, academic content, technology support, human resources systems
including training of teachers) through our Subsidiary, CLEIS, in return for a one-time licence and training fee
127
and a specified annual fee; and (b) infrastructure other than land and building (i.e., furniture, fixtures,
computers, laboratory equipment, etc.) through our Subsidiary, CLIP, in return for a one-time infrastructure fee
and a specified annual fee.
Other than in the case of the Indus World School in Gurgaon, Haryana, the agreements for providing
educational services, entered into between CLEIS and Nalanda Foundation are for a term of 10 years and can be
terminated mutually by either party giving VL[PRQWKV¶notice. However, the agreements may be terminated by
CLEIS without any further notice if, Nalanda Foundation fails to pay fees to CLEIS for a period of three
months. These agreements are also terminable at the option of the non-defaulting party in case there is any
material or persistent breach by the other party which is not rectified within 15 days.
The agreements for providing infrastructure, entered into between CLIP and Nalanda Foundation, are for a term
of 30 years and can, after the expiry of the term, be terminated by either party by giving a 30 day notice.
However, if the agreement is terminated by Nalanda Foundation prior to the expiry of term of the agreements,
Nalanda Foundation will not be entitled to the refund of the security deposit. These agreements are also
terminable at the option of the non-defaulting party in case there is any material or persistent breach by the other
party which is not rectified within 30 days. In relation to the Indus World School in Gurgaon, Haryana, the
agreement is for a period of 22 and half years, and is terminable at the option of the non-defaulting party in case
there is any material default.
µ(GXFDWLRQDO3DUWQHUVKLS¶model
2XUWZR,QGXV:RUOG6FKRROVXQGHUWKHµ(GXFDWLRQDO3DUWQHUVKLS¶PRGHOVLWXDWHGLQWKH6WDWHVRI0DKDUDVKWUD
and Himachal Pradesh in India, are operated by the respective school trusts, as mentioned below. We have
licensed our trademark and brand on a non-exclusive basis, typically for a period of 10 years, to the third parties
with which we have entered into agreements to in relation to the schools, in return for a one-time licence and
training fee and a specified annual fee, paid to our Subsidiary, CLEIS, by these trusts. The school infrastructure
is owned or leased directly by the school trusts, as mentioned below.
The agreements entered into between CLEIS and the respective school trust, for licensing of our trademark and
brand is for a period of 10 academic years and cannot be terminated prior to the expiry of such period. However,
these agreements may be terminated by either party after providing a notice of one month in case (i) there is a
material breach of the agreement and such breach is not remedied within 15 days, (ii) the other party becomes
incapable of performing its obligations under the agreement for a period of three months, and (iii) the other
becomes insolvent. The agreement can also be terminated by CLEIS without any notice in case the other party
fails to make payment of the consideration.
Set out below are brief details regarding our business in the K-12 schools segment in India, as on March 31,
2014:
S. No. Name and Total No. of Grades Board Affiliation Model of Operation Name of Trust
Location Students Presently Status Operating the
Enrolled Offered School
1. IWS, Raipur 297 10th CBSE* Owned School Nalanda
Foundation
2. IWS, Indore 438 10th CBSE* Owned School Nalanda
(Jhalaria) Foundation
3. IWS, Bhiwani 170 7th No affiliation Infrastructure Nalanda
Partnership Foundation
4. IWS, Aurangabad 438 8th CBSE** Infrastructure Nalanda
Partnership Foundation
5. IWS, Sohna Road 140 7th Haryana board** Infrastructure Nalanda
Partnership Foundation
6. IWS, Ludhiana 240 6th District Education Infrastructure Nalanda
Officer Partnership Foundation
7. IWS, Gurgaon DLF 157 Play School No affiliation*** Infrastructure N.A.***
Partnership
8. IWS, Indore 732 12th CBSE* Infrastructure Nalanda
Partnership Foundation
9. IWS, Ahmednagar 268**** 10th CBSE Educational Swayamsiddha
Partnership Mahila Vikas &
128
S. No. Name and Total No. of Grades Board Affiliation Model of Operation Name of Trust
Location Students Presently Status Operating the
Enrolled Offered School
Prashikshan
Sanstha
10. IWS, Mandi 208**** 10th CBSE Educational Onam Education
Partnership Society
*Provisional affiliation
**Application for affiliation is pending with the relevant school board.
***As this is a play school, which is not required to be affiliated, this school is operated by certain individuals, and not under a non-profit
school trust.
**** Data provided for fiscal 2012. Since fiscal 2012, the two K-VFKRROVRSHUDWHGXQGHUWKHµ(GXFDWLRQ3DUWQHUVKLS¶PRGHODW0DQGL
and Ahmednagar have not been sharing certain information with CLEIS in accordance with their agreements, including updated student
lists. For more LQIRUPDWLRQ VHH ³Risk Factors´ DQG ³Outstanding Litigation and Material Developments´ RQ SDJHV 11 and 393,
respectively.
Revenues from our K-12 schools business aggregated to ` 60.85 million, ` 52.83 million and ` 91.82 million,
respectively, for fiscal 2014, 2013 and 2012, representing 2.78%, 2.66% and 5.54% of our total revenue from
operations for fiscal 2014, 2013 and 2012, respectively, on a consolidated basis.
Our academic SKLORVRSK\ UHFRJQL]HV µPXOWLSOH LQWHOOLJHQFH¶ LH WKDW SHRSOH KDYH GLIIHUHQW VNLOOV DQG
peculiarities, and helps to choose a career path that caters to such differences. We believe that the career of a
FKLOG VKRXOG EH WDLORUHG WR WKH FKLOG¶V DSWLWXGH LQWHUHVW DQG SHUVRQDOLW\ HQFDSVXODWHG LQ WKH DFURQ\P µ$3,¶
7KHVHDQGWKH DUWRIOHDUQLQJ IRUOLYLQJDUH DWWKH KHDUWRIWKH,QGXV:RUOG6FKRROV¶SKLORVRSK\,QGXV:RUOG
Schools are built on a learner-friendly model, with three levels according to the age of the student:
Jigyasa ± learning through inquiry and experimentation, wherein children are encouraged to learn by doing,
observing their surroundings and asking questions (up to the eighth year of schooling).
Saadhna ± learning becomes focused towards the ultimate career goal (from the ninth year of schooling).
We believe that this model enables the child to effectively take career decisions through a host of aptitude
assessments, stepwise career assistance and continuous support and guidance. In addition, when the child enters
WKH µSaadhna¶ VWDJH ZH VHHN WR SURYLGH DSWLWXGH WHVWLQJ FDUHHU DGYLVRU\ VHUYLFHV DSWLWXGH EXLOGLQJ DQG
personality development programs to guide students towards the right career choice.
Vocational Training
In our vocational training business, we implement vocational training and livelihood skills programs, under
project tenders issued by Central and State Governments, for employment in sectors and areas such as retail and
sales management, data entry, hospitality, computer hardware, automotive repair, refrigeration and air
conditioning.
We commenced our vocational training business in fiscal 2008. During fiscal 2014, we had an aggregate of
8,233 enrolments and had placed 4,395 students pursuant to our vocational training programs conducted under
Government schemes, across the States of Gujarat, Rajasthan, Jharkhand, Chhattisgarh, Madhya Pradesh and
Uttar Pradesh.
As on the date of this Draft Red Herring Prospectus, we are engaged as an implementing agency for vocational
training programs launched under the State Skills Mission-Aajeevika Skills, Vanbandu Kalyan Yojana and
Mission Mangalam Skill Development Programme in the states of Gujarat, Jharkhand, Chhattisgarh, Madhya
Pradesh and Uttar Pradesh.
Vendor selection for Government funded vocational training programs is based on criteria including technical
competencies, past experience and projected costs of implementing such programs. In view of our robust and
129
varied technical competencies, recent relevant experience and strong placement record, we believe that we are
well-positioned to continue to successfully compete for and win contracts for implementation of vocational
training programs launched and conducted under Government schemes in various States in India, in the future.
The vocational training programs are funded by grants-in-aid by the relevant Central or State Governments and
a separate agency selected or nominated by the relevant Government is made responsible for program
coordination, including ensuring that project funds released by the Government are used only for the sanctioned
project. We, as the implementation agency, are reimbursed for costs and expenses incurred by us in relation to
the implementation of such projects, typically in a phased manner, subject to our meeting certain specified
training and placement targets, for instance, subject to specified percentages of trainees achieving placements
pursuant to their enrolment in our vocational training programs.
Vocational training conducted under project tenders issued by Central and State Governments is imparted by us
generally in temporarily rented facilities (with a view to minimizing capital expenses), wherein trainers are
sourced by us locally on contractual basis for the duration of the vocational training programs, typically ranging
from a period of two to three months up to two years. We, as the implementing agency, are responsible for
curriculum and training, aptitude assessment, personality and skill development, apprenticeship and on-the-job
training, placement, and other related responsibilities. The medium of instruction is generally bilingual or
multilingual. The terms of reference of the contracts awarded to us specify the minimum and total expected
numbers of candidates to be trained by us, the duration of such programs, and the local/tribal area from which
such trainees (typically, youth from lower income groups, requiring vocational or livelihood skills training as
part of a Government-aided scheme or policy) are to be sourced.
We are responsible for enrolments in our vocational training programs, and are typically subject to Government
directions as to reservations or preferred admission requirements, for instance, for scheduled castes and
scheduled tribes, minority categories and women. We are also subject to periodic reporting obligations,
including in relation to enrolments and placements achieved through the vocational training programs
implemented by us under Government schemes. Cost escalations, if any, are typically required to be borne by
the implementation agency. While this business is carried out by implementation agencies on a cost basis, the
administrative costs of the projects are permitted to be shared. The infrastructure required by us for our
vocational training business under Government schemes is provided by our Subsidiary, Kestone, on a lease
rental basis.
Revenues from vocational training programs implemented by us under Government schemes aggregated to `
162.87 million, ` 146.11 million and ` 70.67 million, respectively, for fiscal 2014, 2013 and 2012, representing
7.45%, 7.34% and 4.26% of our total revenue from operations for fiscal 2014, 2013 and 2012, respectively, on a
consolidated basis.
We, including through our Subsidiary Kestone, acquired by us with effect from April 1, 2008, conduct
recruitment, training and event management services for corporates, presently mainly in the information
technology/information technology enabled services and telecom sectors. For this purpose, Kestone has
presence in India and in Singapore, through .HVWRQH $VLD +XE 3WH /WG 6LQJDSRUH ³Kestone Asia´.
Historically, we have also undertaken vocational training programs for the private sector, primarily in the
%DQNLQJ)LQDQFLDO6HUYLFHVDQG,QVXUDQFH³BFSI´VHFWRU
Integrated Marketing Services ³IMS´ .HVWRQH LQWHJUDWHV GLIIHUHQW PDUNHWLQJ VHUYLFHV WR KHOS GHOLYHU WKH
desired messages to RXU FOLHQWV¶ FXVWRPHUV DQG SDUWQHUV LQFOXGLQJ GHDOHUV DQG YHQGRUV WR EXLOG RXU FOLHQWV¶
brand image and to achieve the desired business results for our clients, including event management services;
and
Managed Manpower Services ³MMS´.HVWRQHKHOSVVource/acquire talent, build competency through skills
training, ensure consistency by realigning talent with the systems and processes, and run customer relationship
PDQDJHPHQW³CRM´LQLWLDWLYHVVXFKDVOR\DOW\DQGUHZDUGSURJUDPV
130
In addition to revenues generated from our recruitment, training and event management services for corporates,
we seek to leverage our relationships with corporates to drive placements for students enrolled in our vocational
training programs. Over the years, we believe that we have built strong relationships with reputed corporates
and organizations.
Revenues from our recruitment, training and event management services for corporates aggregated to ` 733.83
million, ` 627.83 million and ` 604.11 million, respectively, for fiscal 2014, 2013 and 2012, representing
33.56%, 31.55% and 36.45% of our total revenue from operations for fiscal 2014, 2013 and 2012, respectively,
on a consolidated basis.
Corporate Philosophy
Ownership: Accepting responsibility for actions and carrying the team forward in a crisis situation.
Openness: Regularly sharing experiences with team members and customers, and encouraging feedback and
initiative from them.
Honesty and commitment to customers: Communicating clearly and honestly to customers, the deliverables.
And expectations from them.
Innovation: Creating courses, systems and processes with enhanced effectiveness to meet customer needs.
Marketing
In our test prep business, we believe that we benefit greatly from word-of-mouth referrals by our students, their
parents and instructors. We also endeavor to leverage and increase penetration of our course offerings by
offering concessional rates to alumni at our test prep centers, as well as scholarship schemes offered from time
to time, as part of our routine brand building and marketing initiatives. We also undertake marketing initiatives
such as participation in education fairs and other similar events, advertisements through electronic media such
as web banners on websites, advertisements in print media such as education sector magazines and publications,
partnering in talent search examinations, and forming alliances and tie-ups with educational institutions, for
instance, to provide test prep counseling at the campuses of the selected educational institutions and to provide
fee incentives on enrolments of students at such educational institutions.
The target audience for marketing activities for the K-12 schools comprises parents of students and potential
business partners. For this purpose, the schools undertake initiatives such as organizing in inter-school quizzes
and similar events, advertisements through electronic media such as web banners on websites, and
advertisements in print media such as education sector magazines and publications. For instance, in 2013, we
organized the Career Launcher Young India Challenge, a pan-India quiz event for K-12 students in grades 9
through 12. This event was launched and advertised through our website and our presence on social networking
fora including Facebook and YouTube, as well as in schools directly, across over 100 cities, with participation
of students of approximately 1,500 schools in India.
Our vocational training business is generally driven by programs launched by, and under the aegis of, various
State and Central Governments in India in a need-based manner, wherein contracts are awarded through the
tender process. Therefore, the target audience to support our vocational training business generally comprises
corporates that could participate in placement programs for students enrolled in our vocational training courses.
In addition to seeking to leverage our relationships with corporates in our recruitment, training and event
management businesses (conducted through our Subsidiary, Kestone) for this purpose, we also undertake
marketing initiatives such as participation in trade fairs and industry events.
Competition
Competition in each of our business segments, as well as in the education sector as a whole, is generally
fragmented. In India, we believe that while the K-12 schools segment is formal and organized to an appreciable
131
extent, the test prep, publishing and content development and vocational training segments are presently largely
informal and unorganized. Differentiators between competitors generally include, among other factors, pricing,
location, portfolio of product/service offerings, quality and reputation of faculty, product differentiation through
content development, success rates and brand value, level of capital investment and infrastructure, and
management of quality issues in EXVLQHVVSDUWQHUV¶RSHUDWLRQV
For instance, in the test prep segment, we believe that we face competition in each of the courses that we offer
from generally from multiple regional players, in addition to larger players that have wider coverage across
India. Large pan-India players in the market include T.I.M.E., Aakash, IMS, FIIT-JEE, PT Education, Career
Forum and GATE Forum. There are also other players, such as JK Shah Classes and Career Point, which have a
limited geographical scope and spread and are not competing on a pan-India level.
In the publishing and content development business, in addition to competition from traditional print and
publishing companies, we believe that we may also be facing an increasing level of competition from
multimedia companies that are engaged in developing educational content and providing multimedia courses
and services in the education sector. Cengage, Wiley, Pearson, McGraw Hill, Himalaya, Arihant and S. Chand
are some of the key players in this segment.
Our test prep and publication and content development businesses also face significant competition from online
content provided by through internet websites, including embibe.com (which offers engineering and medical test
prep courses) and studycopter.com (which offers management test prep courses).
In the K-12 as well as higher education segment, especially in metropolitan and other larger cities and towns in
India and among the more affluent section of society, we believe that we face greater competitive pressures
from private schools and educational institutions (relative to Government schools and colleges).
The vocational training business is generally driven by programs launched by, and under the aegis of, various
State and Central Governments in India in a need-based manner, wherein contracts are awarded through the
tender process where we face competition from other players including Aptech, Centum Learning, Pratham
Institute, ICA Infotech, Speakwell, ICA Infotech, IFBI, IL&FS Training. We also conduct recruitment, training
and event management services for corporates in the private sector, where we also face competitive pressures
from corporates who may undertake to recruit and train their own staff, as well as conducting in-house event
management activities.
While it is possible that some of our competitors may have the benefit of, among other things, greater financial
and other resources than we currently enjoy, we believe that favorable age demographics and rising household
income in India, as well as rising employment opportunities and other positive industry trends, will allow us to
continue to compete effectively in the future.
Employees
As on March 31, 2014, our Company had 362 employees, of whom 358 employees are postgraduates or
professionals such as chartered accountants and company secretaries or who have obtained educational degrees;
and including a large pool of faculty of 84 instructors for our test prep business. We also have an in-house
content development team of 60 members with domain and subject expertise of which 56 are employees of CL
Media.
In our test prep business, for centers operated by our business partners, the teaching and non-teaching staff is
employed by our business partners. In our K-12 schools business, the teaching and non-teaching staff is
employed by the respective school trusts that operate and manage the Indus World Schools.
Our employees are not unionized and our operations have not been interrupted by any work stoppage, strike,
demonstration or other labour or industrial disturbance in the past.
In our K-12 schools business, Indus World Schools were ranked among the top 100 organizations to work for in
India, in the Great Place to Work India survey 2013, and among the top 50 organizations to work for in India as
well as the second best in the education sector, in the Great Place to Work India survey 2012.
Insurance
132
We maintain standard insurance coverage for our corporate offices, K-12 schools under the owned infrastructure
and infrastructure partnership models and our employees, including vehicle insurance, standard fire and special
SHULOV LQVXUDQFH GLUHFWRUV¶ DQG RIILFHUV¶ OLDELOLW\ LQVXUDQFH SXEOLF OLDELOLW\ LQVXUDQFH PHGLFDO LQVXUDQFH DQG
special contingency insurance for burglary, theft and larceny as well as money insurance for cash in transit and
cash in safe for our Company and certain Subsidiaries. We also maintain professional indemnity insurance and
commercial general liability insurance for our Subsidiary, Kestone.
In addition, our business partners for our test prep centers, as well as our educational partners in the K-12
schools business, are obligated to maintain adequate insurance coverage for the respective assets owned and
operated by them at such centers, and we seek to obtain standard indemnities and other contractual protections
against any insurance-related risks arising in relation to business operations conducted by us under the
partnership model.
Intellectual Property
We have registered domain names for our websites including www.cleducate.com, www.careerlauncher.com,
gkpublications.org, www.indusworldschool.com and kestone.in.
We also have 17 registered trademarks in various classes, including for Career Launcher, Career Launcher ±
compassbox.com and Career Launcher - PDP. We have applied for registration of 17 trademarks in various
classes. In addition, our Subsidiary, CLIP has applied for the registration of the trademark µAnanda ± the joy of
OHDUQLQJ¶DQGµIndus World School ± know thyself¶
In addition, in connection with our acquisitions in the past, we have acquired rights over certain trade names and
trademarks, including intellectual property of KITS including the trademark KITS, as well as the intellectual
property of ARC including the brand and trade name Arun Roy Classes. We are in the process transferring the
six trademarks registered in the name of LST, in various classes to our Company.
Immovable Property
OuU &RPSDQ\¶V UHJLVWHUHG RIILFH VLWXDWHG DW '7- '/) 7RZHU-B, Jasola District Centre, New Delhi, 110
025, India, is occupied by us under a three year lease entered into by us with Ms. Anjali Puri, with effect from
0D\2XU&RPSDQ\¶VFRUSRUDWHRIfice, situated at 15-A, Knowledge Park-II, Greater Noida, 201 310,
Uttar Pradesh, India, is occupied by us under a lease deed for 90 years entered into by us with the Greater Noida
Industrial Development Authority, for an area of approximately 20,000 square meters, with effect from July 20,
2004.
The premises at which our owned test prep centers are located are either leased by us from various parties and
for varying terms, or are owned by us. As on March 31, 2014, we had 76 owned test prep centers (of which 14
DUHWHPSRUDU\µ6PDUW&DUHHU&HQWHUV¶, situated in various parts of India. The premises at which test prep centers
operated by our business partners are located are owned or leased, as the case may be, by the respective business
partners, and are not provided by us. As on March 31, 2014, there were 88 test prep centers being operated by
our business partners, situated in various parts of India.
The premises at which our publication business is located in Salempur, Rajputana, Roorkee, Uttarakhand,
occupied by us under a five-year lease with effect from November 1, 2011, for an area of approximately 460
square meters.
The premises at which the Indus World Schools being operated, XQGHU WKH µ2ZQHG-,QIUDVWUXFWXUH¶ PRGHO, are
provided by us, at Indore (Jhalaria), Madhya Pradesh and Raipur, Chhattisgarh, respectively. The premises at
ZKLFK WKH ,QGXV :RUOG 6FKRROV RSHUDWHG XQGHU WKH µ,QIUDVWUXFWXUH 3DUWQHUVKLS¶ PRGHO DQG µ(GXFDWLRQDO
3DUWQHUVKLS¶ PRGHOV DUH ORFDWHG DUH OHDVHG E\ WKH UHVSHFWLYH VFKRol trusts (other than in the case of the Indus
World School in Gurgaon, Haryana, where the land is leased by our Subsidiary, CLEIS), and are not provided
by us. As on March 31, 2014, there were six ,QGXV :RUOG 6FKRROV EHLQJ RSHUDWHG XQGHU WKH µ,QIUDVWUXFWXre
3DUWQHUVKLS¶ PRGHO DQG two ,QGXV :RUOG 6FKRROV EHLQJ RSHUDWHG XQGHU WKH µ(GXFDWLRQDO 3DUWQHUVKLS¶ PRGHO
respectively, situated in various parts of India.
133
The premises at which our vocational training programs under Government schemes are conducted are generally
occupied by us pursuant to short-term lease, licence or similar arrangements, for the duration of the respective
programs in various States.
134
REGULATIONS AND POLICIES IN INDIA
The following description is a summary of certain sector-specific laws currently in force in India, which are
applicable to our Company. The information detailed in this chapter has been obtained from publications
available in the public domain. The description below may not be exhaustive, and is only intended to provide
general information to investors, and is neither designed as, nor intended to substitute, professional legal
advice. Judicial and administrative interpretations are subject to modification or clarification by subsequent
legislative, judicial or administrative decisions.
Overview
Education is one of the items on the Concurrent List (List III) of the Seventh Schedule to the Constitution of
India, meaning that both the Central and State Governments are empowered to legislate in this sector. Education
was transferred from the State List (List II) to the Concurrent List (List III) by the 24 th Amendment to the
Constitution of India in 1971.
Further, the 86th Amendment to the Constitution of India in 2002 recognized the right to free and compulsory
education (for children of the ages six to 14 years) as a Fundamental Right under Article 21A, as well as the
right to education (for children up to the age of six) as a Directive Principle under Article 45. The Supreme
Court of India has also recognized the right to education as a Fundamental Right under Articles 19 and 21 of the
Constitution of India.
The Ministry of Human Resource Development, GoI plays a central role in governing education in India,
through its two nodal agencies ± the Department of School Education and Literacy, responsible for disbursing
Central grants to States for building educational infrastructure at the K-12 level, and the Department of Higher
Education, responsible for governing higher education.
The Ministry of Labour and Employment, GoI, formulated the National Skill Development Policy (the
³NSDP´LQZLWKDQREMHFWLYHRIHVWDEOLVKLQJDQDWLRQDOVNLOOGHYHORSPHQWLQLWLDWLYHZKLFKZLOOHPSRZHU
all individuals through improved skills, knowledge, nationally and internationally recognized qualifications to
JDLQ DFFHVV WR GHFHQW HPSOR\PHQW DQG HQVXUH ,QGLD¶V FRPSHWLWLYHQHVV LQ WKH JOREDO PDUNHW The Prime
0LQLVWHU¶V 1DWLRQDO &RXQFLO RQ 6NLOO 'HYHORSPHQW VHW D WDUJHW RI LPSDUWLQJ VNLOOV WUDLQLQJ WR PLOOLRQ
persons, by 2022. The NSDP has allocated targets for different ministries, departments and organizations based
on projected employment potential in the concerned sectors, which are to be reviewed from time to time
according to growth of sectors and their actual workforce requirement. The objectives of NSDP, are to, among
other things, create opportunities for all to acquire skills throughout life, especially for youth, women and
disadvantaged groups; promote commitment by all stakeholders to own skill development initiatives; develop a
high-quality skilled workforce/entrepreneur relevant to current and emerging employment market needs; enable
the establishment of flexible delivery mechanisms that respond to the characteristics of a wide range of needs of
stakeholders; and enable effective coordination between different ministries, the Center and the States and
public and private providers. The NSDP envisages the use of public-private partnerships in achieving the
objectives set out, through government financial support complemented by private investment.
The Right of Children to Free and Compulsory Education Act, 2009, which came into force from April 1, 2010,
provides for free and compulsory education to children in India of the ages six to 14 years.
Schools that are not Government funded are required to admit, to the extent of at least 25% of the strength of the
class, children from the weaker and disadvantaged section of society in the neighborhood, and to provide free
and compulsory elementary education to such students. Such schools may receive reimbursement from the State
or applicable local authority for per-child expenditure, or such expenses may be set off against any land,
building, equipment or other facilities provided to the school by the State or local authority (either free of cost or
at a concessional rate).
135
National Policy on Education
The NPE, together with the National Literacy Mission, identifies, among other things, focal areas such as adult
education (including post literacy, continuing education and vocational and skill training programs), open and
distance learning, and technical and management education. The NPE contemplates an ongoing review of its
implementation on a five-yearly basis.
The two national-level organizations that supervise and monitor K-12 level educational institutions in India are
WKH &HQWUDO %RDUG RI 6HFRQGDU\ (GXFDWLRQ WKH ³CBSE´ DQG WKH &RXQFLO IRU WKH ,QGLDQ 6FKRRl Certificate
Examination.
The CBSE prepares the syllabus for students from lower kindergarten to senior school level, for affiliated
VFKRROV,WDOVRFRQGXFWVWZRQDWLRQDOH[DPLQDWLRQVWKHµ$OO,QGLD6HFRQGDU\6FKRRO([DPLQDWLRQ¶IRU&ODVV;
HTXLYDOHQW WR µ2¶ OHYHO LQ RWKHU MXULVGLFWLRQV DQG WKH µ$OO ,QGLD 6HQLRU 6FKRRO &HUWLILFDWH ([DPLQDWLRQ¶ IRU
Class ;,,HTXLYDOHQWWRµ$¶OHYHOLQRWKHUMXULVGLFWLRQVIRUDIILOLDWHGVFKRROV
The CBSE Affiliation Bye-laws (the ³CBSE Bye-laws´, first introduced in 1988 provide for, among other
things, affiliation (for a fee payable to the CBSE) of private unaided schools (i.e., schools run by a duly
constituted and registered society or trust, not receiving any regular grants-in-aid from any Government
sources), either on a provisional or permanent basis. Schools that are not managed directly by public sector
undertakings ³PSUs´or reputed societies under the financial control of PSUs may apply to the CBSE only for
provisional affiliation in the first instance, subject to prior recognition or no-objection granted by the relevant
State (or Union Territory) Government. After the expiry of the provisional affiliated period of three years
(which may be extended by the CBSE in its discretion), such a school may apply to the CBSE for permanent
affiliation.
x the school must have a minimum land area, as prescribed for various categories of affiliation, for various
regions, and up to various classes/levels, as applicable;
x the salary and admissible allowances of the teaching and non-teaching staff must be commensurate to the
prescribed pay scale and admissible allowances payable to corresponding categories of Government
employees;
x the trust, society or management of the school should be of non-proprietary character (i.e., control may
not vest in a single individual or members of a family) and should run the school on a not-for-profit basis
(i.e., any savings after meeting required expenses and making required contributions must be utilized in
WKH VFKRRO¶V RSHUDWLRQV DQG SURPRWLRQ DQG PD\ QRW EH GLYHUWHG WR DQ\ LQGLYLGXDO LQ WKH VFKRRO
management committee, society or trust or to any other person) as a community service and not as a
business;
136
x the school must have at least the prescribed infrastructure for building and classrooms, libraries,
laboratories and extra-curricular activities;
x WKHVFKRRO¶V admissions and withdrawal registers as well as VHUYLFHUHFRUGVRIWKHVFKRRO¶Vteaching and
non-teaching staff must be duly maintained and updated;
x no teachers are to be appointed by the school on ad hoc basis;
x the school must have adequate teaching staff possessing necessary qualifications prescribed by the CBSE
for various subjects and posts;
x the pupil to teacher ratio should not exceed 30:1 and there must be at least 1.5 teachers per section to
teach various subjects;
x no capitation fee or voluntary donation for gaining admission to the school may be collected or charged
LQ WKH QDPH RI WKH VFKRRO DQG SULYDWH XQDLGHG VFKRROV PXVW FRQVXOW SDUHQWV¶ UHSUHVHQWDWLYHV SULRU WR
revision of school fees, provided that school fees may not be revised mid-session; and
x the school must maintain a reserve fund at a prescribed scale, depending on the number of students
enrolled.
CBSE-affiliated schools are open to inspection by the inspection committee deputed by the CBSE or the
education department of the State or Union Territory in which they are situated, and may be subject to audit by
the CBSE, if the CBSE deems it necessary to ensure that school funds/fees are not diverted for non-permitted
uses, staff salaries are paid as prescribed, and that there is no other financial irregularity. CBSE affiliation may
be withdrawn in the event of any sale or transfer of the school or school property, or any other misconduct,
irregularity or violation from prescribed byelaws.
The Indian &RS\ULJKW $FW WKH ³Copyright Act´ SURYLGHV IRU UHJLVWUDWLRQ RI FRS\ULJKWV WUDQVIHU RI
ownership and licensing of copyrights, and infringement of copyrights and remedies available in that respect.
The Copyright Act affords copyright protection to original literary, dramatic, musical or artistic works,
cinematograph films, and sound recordings. Once registered, copyright protection lasts for 60 years, subsequent
to which the work falls in the public domain and any act of reproduction of the work by any person other than
the author would not amount to infringement. The remedies available in the event of infringement of copyright
include civil proceedings for damages, account of profits, injunction and the delivery of infringing copies to the
copyright owner, as well as criminal remedies, including imprisonment of the accused and imposition of fines
and seizure of infringing copies. While copyright registration is not a prerequisite for acquiring or enforcing a
copyright, registration creates a presumption favoring ownership of the copyright by the registered owner.
Following the issuance of the International Copyright Order, 1999, subject to certain exceptions, the provisions
of the Copyright Act apply to nationals of all member states of the World Trade Organization.
The Press and Registration of Books Act, 1867 provides for, among other things, the regulation of printing
presses, preservation of copies of books (including any volume, part and division of any volume or pamphlet, in
any language) published in India, and registration of such books with the officer appointed by the relevant State
Government, for publication of prescribed details (including the title, language, subject, name of printer and
publisher, date of issue or publication, name and address of copyright holder, etc.) in the Catalogue of Books.
Other Laws
In addition to the foregoing, taxation statutes such as the Income Tax Act, 1961, Central Sales Tax Act, 1956,
Finance Act, 1994, and applicable local sales tax statutes, as well as labour and employment-related statutes
such as the Shops and Establishments Act, 1958 (as applicable in various States in India), (PSOR\HHV¶ State
Insurance Act, 1948, (PSOR\HHV¶ 3URYLGHQW )XQGV DQG 0LVFHOODQHRXV 3URYLVLRQV Act, 1952, Minimum Wages
Act, 1948, Payment of Bonus Act, 1965, Payment of Wages Act, 1936, Contract Labour (Regulation and
Abolition) Act, 1970 and Payment of Gratuity Act, 1972, and intellectual property-related statutes such as the
Trade Marks Act, 1999, and, among other laws, the Companies Act, Indian Contract Act, 1872, and Information
Technology Act, 2000, apply to us as to any other Indian company.
137
HISTORY AND CERTAIN CORPORATE MATTERS
For information on our activities, courses, services, market of each segment, growth, technology, market,
managerial competence and capacity built-up, our standing with reference to our prominent competitors,
management, major suppliers, customers and details of our borrowings, VHH ³Our Management´ ³Our
Business´, ³Industry Overview´ DQG ³Financial Indebtedness´ on pages 144, 117, 95 and 390, respectively.
)RUGHWDLOVRIVKDUHKROGLQJRIRXU3URPRWHUVVHH³Capital Structure´RQSDJH61.
Our Company has 128 equity shareholders, as at the date of filing of this Draft Red Herring Prospectus.
Set forth below are details of the changes in the registered office of our Company.
Date of change Change in the address of our Registered Office Reason for Change
July 1, 1998 From Flat No. 1275, Sector D, Pocket-1, Vasant Kunj, New Delhi, To enable greater operational
India to R-90, Greater Kailash, Part-I, New Delhi 110 048 efficiency
July 28, 2008 From R-90, Greater Kailash, Part-I, New Delhi 110 048 to R-90, To enable greater operational
First Floor, Greater Kailash Part 1, New Delhi 110 048, India efficiency
July 3, 2014 From R-90, First Floor, Greater Kailash Part 1, New Delhi 110 048, To enable greater operational
India to DTJ 925, DLF Tower-B, Jasola District Centre, New Delhi efficiency
110 025, India
Major Events
The main objects of our Company as contained in our Memorandum of Association are as follows:
To conduct educational and consulting programs relating to various education and career opportunities viz.
primary, secondary and higher education, teaching, supplementary and preparatory classes, online training,
138
counseling, university admission services, administrative training, educational consultancy, human resource
consultancy, management consultancy, placement services, public relation exercise and software consultancy
including providing content and expertise on the internet.
Since our incorporation, the following changes have been made to the Memorandum of Association:
Date of Amendment
Amendment/Shareholders
Resolution
October 1, 1999 The authorized share capital of our Company of ` 500,000 divided into 50,000 equity shares
` 10 each was increased to ` 1,000,000 divided into 100,000 equity shares of ` 10 each.
April 25, 2000 The authorized share capital of our Company of ` 1,000,000 divided into 100,000 equity
shares ` 10 each was increased to ` 10,000,000 divided into 1,000,000 equity shares of ` 10
each.
Our Company was converted into a public company and the name of our Company was
changed from µ&DUHHU /DXQFKHU ,QGLD 3ULYDWH /LPLWHG¶ WR µ&areer Launcher (India)
/LPLWHG¶
September 10, 2001 The authorized share capital of our Company was altered by way of subdivision to `
10,000,000 divided into 5,000,000 equity shares of ` 2 each, whereby one equity share of `
10 each was sub-divided into five Equity Shares of ` 2 each.
November 22, 2003 The main objects (Clause III (A)) of our Company was changed from:
³7RFRQGXFWHGXFDWLRQDOSURJUDPPHUHODWLQJWRYDULRXVFDUHHURSSRUWXQLWLHVYL]WHDFKLQJ
counseling, KXPDQUHVRXUFHFRQVXOWDQF\SODFHPHQWVHUYLFHVDQGSXEOLFUHODWLRQH[HUFLVH´,
to the following:
³7RFRQGXFWHGXFDWLRQDODQGFRQVXOWLQJSURJUDPVUHODWLQJWRYDULRXVHGXFDWLRQDQGFDUHHU
opportunities viz. primary, secondary and higher education, teaching, supplementary and
preparatory classes, online training, counseling, university admission services,
administrative training, educational consultancy, human resource consultancy, management
consultancy, placement services, public relation exercise and software consultancy including
SURYLGLQJFRQWHQWDQGH[SHUWLVHRQWKHLQWHUQHW´
August 10, 2004 The authorized share capital of our Company of ` 10,000,000 divided into 5,000,000 equity
shares of ` 2 each was increased to ` 50,000,000 divided into 25,000,000 equity shares of `
2 each.
February 7, 2007 The authorized share capital of our Company was altered by way of consolidation to `
50,000,000 divided into 5,000,000 equity shares of ` 10 each, whereby five Equity Shares of
` 2 each were consolidated into one Equity Share of ` 10 each.
The authorized share capital of our Company of ` 50,000,000 divided into 5,000,000 equity
shares of ` 10 each was increased to ` 100,000,000 divided into 10,000,000 equity shares of
` 10 each.
March 31, 2008 The authorized share capital of our Company of ` 100,000,000 divided into 10,000,000
equity shares of ` 10 each was increased to ` 150,000,000 divided into 15,000,000 equity
shares of ` 10 each.
March 18, 2011 The name of our Company was changed from µCareer Launcher (India) Limited¶ to µCL
Educate Limited¶.
The authorized share capital of our Company of ` 150,000,000 divided into 15,000,000
equity shares of ` 10 each was reclassified to ` 150,000,000 divided into 13,000,000 equity
shares of ` 10 each and 2,000,000 preference shares of ` 10 each.
September 5, 2014 The authorized share capital of our Company of ` 150,000,000 divided into 13,000,000
equity shares of ` 10 each and 2,000,000 preference shares of ` 10 each was reclassified and
increased to ` 160,000,000 divided into 16,000,000 equity shares of ` 10 each.
Our Company is not operating under any injunction or restraining order as at the date of this Draft Red Herring
Prospectus.
Holding Company
139
Our Company does not have a holding company.
Subsidiaries
Our Company has seven subsidiaries (including two indirect subsidiaries), as on the date of this Draft Red
Herring Prospectus.
Kestone IntHJUDWHG 0DUNHWLQJ 6HUYLFHV 3ULYDWH /LPLWHG ³Kestone´ ZDV LQFRUSRUDWHG DV .HVWRQH 5HVHDUFK
Private Limited under the Companies Act 1956 on February 3, 1997. Its corporate identification number is
U73100DL1997PTC186183. Kestone is currently engaged in the business of providing vocational training
services, recruitment, training and event management services.
Kestone became our wholly-owned Subsidiary pursuant to a share purchase agreement dated April 1, 2008
among our Company, Jayaram Krishnan, N. Mahalakshmi, R. Krishnan, Shantha Krishnan and Kestone, as
amended on March 29, 2009. Our Company acquired 1,000,000 equity shares of Kestone for an aggregate
purchase price of ` 69.1 million, of which, ` 19.6 million was paid by way of issue of 56,000 Equity Shares of
our Company, to Jayaram Krishnan and N. Mahalakshmi, on April 28, 2008 and May 30, 2009. For more
informationVHH³Capital Structure´RQSDJH61. The authorized share capital of Kestone is ` 10 million divided
into 1 million equity shares of ` 10 each and as of March 31, 2014, the paid up share capital of Kestone is ` 10
million divided into 1 million equity shares of ` 10 each. Our Company holds 1 million equity shares of ` 10
each in Kestone including through its nominee, which is equivalent to 100% of the issued and paid up capital of
Kestone.
There are no accumulated profits or losses of Kestone not accounted for by our Company.
GKP became our Subsidiary pursuant to an agreement dated November 12, 2011 among our Company, Rakesh
Mittal, Poonam Mittal and GKP as amended on September 29, 2013. Our Company acquired 190,000 equity
shares of GKP for an aggregate purchase price of ` 337.19 million, of which, ` 57.74 million was paid by way
of issue of 106,590 Equity Shares of our Company, to Rakesh Mittal and Poonam Mittal on May 1, 2012,
October 31, 2012 and September 5, 2014, and the rest was paid in cash. For more information VHH ³Capital
Structure´RQSDJH61. The authorized share capital of GKP is ` 2.50 million divided into 250,000 equity shares
of ` 10 each and as of March 31, 2014, the paid up share capital of GKP is ` 1.90 million divided into 190,000
equity shares of ` 10 each. Our Company holds 190,000 equity shares of ` 10 each in GKP, which is equivalent
to 100% of the issued and paid up capital of GKP.
There are no accumulated profits or losses of GKP not accounted for by our Company.
&DUHHU /DXQFKHU (GXFDWLRQ ,QIUDVWUXFWXUH DQG 6HUYLFHV /LPLWHG ³CLEIS´ ZDV LQFRUSRUDWHG DV Career
Launcher Infrastructure Private Limited under the Companies Act 1956 on June 16, 2005. Its corporate
identification number is U70101DL2005PLC137699. CLEIS is currently engaged in the business of providing
educational services for K-12 schools including brand licensing and providing education soft skills under the
brand Indus World Schools.
The authorized share capital of CLEIS is ` 100 million divided into 10 million equity shares of ` 10 each and as
of March 31, 2014, the paid up share capital of CLEIS is ` 94.30 million divided into 9,435,106 equity shares of
` 10 each. Our Company holds 9,248,053 equity shares of ` 10 each in CLEIS, which is equivalent to 98.02% of
the issued and paid up capital of CLEIS.
There are no accumulated profits or losses of CLEIS not accounted for by our Company.
140
4. CL Media Private Limited
CL Media was incorporated as CL Media Private Limited under the Companies Act 1956 on February 1, 2008.
Its corporate identification number is U74300DL2008PTC173449. CL Media is currently engaged in the
business of content development for study material, publishing study material and books.
The authorized share capital of CL Media is ` 0.1 million divided into 10,000 equity shares of ` 10 each and as
of March 31, 2014, the paid up share capital of CL Media is ` 0.1 million divided into 10,000 equity shares of `
10 each. Our Company holds 10,000 equity shares of ` 10 each in CL Media through its two nominees, which is
equivalent to 100% of the issued and paid up capital of CL Media.
There are no accumulated profits or losses of CL Media not accounted for by our Company.
The authorized share capital of CLIP is ` 3 million divided into 0.1 million equity shares of ` 10 each and 0.2
million preference shares of ` 10 each as of March 31, 2014, the paid up share capital of CLIP is ` 2.48 million
divided into 98,468 equity shares of ` 10 each and 150,000 preference shares of ` 10 each. CLEIS holds 98,468
equity shares of ` 10 each and 150,000 preference shares of ` 10 each in CLIP including through its nominee,
which is equivalent to 100% of the issued and paid up capital of CLIP.
There are no accumulated profits or losses of CLIP not accounted for by our Company.
The authorized share capital of CLHES is ` 0.1 million divided into 10,000 equity shares of ` 10 each and as of
March 31, 2014, the paid up share capital of CLHES is ` 0.1 million divided into 10,000 equity shares of ` 10
each. Our Company holds 6,576 equity shares of ` 10 each in CLHES, which is equivalent to 65.76% of the
issued and paid up capital of CLHES.
There are no accumulated profits or losses of CLHES not accounted for by our Company.
Kestone Asia was incorporated as CL Veritas Asia Pte. Limited under the Companies Act, Cap. 50, Singapore
on August 16, 2007. Its company number is 200715067R. Kestone Asia is currently engaged in providing
recruitment, training and event management services for corporates.
Kestone Asia was incorporated pursuant to a joint venture agreement between our Company and Veritas LLC
dated August 10, 2007 and became our wholly-owned subsidiary pursuant to a deed of transfer entered into
between our Company and Veritas LLC whereby our Company acquired 7,000 ordinary shares of Kestone Asia
for a consideration of $ 57,000. Subsequently, our Company transferred its entire shareholding in Kestone Asia
to Kestone. The paid up share capital of Kestone Asia is SGD 14,001 divided into 14,001 equity shares of SGD
1 each. 3XUVXDQW WR WKH WUDQVIHU RI RXU &RPSDQ\¶V shareholding in Kestone Asia to Kestone, Kestone holds
14,000 equity shares of SGD 1 each in Kestone Asia, which is equivalent to 99.99% of the issued and paid up
capital of Kestone Asia.
There are no accumulated profits or losses of Kestone Asia not accounted for by our Company.
141
Except as disclosed below, neither our Promoters, nor the members of our Promoter Group or our Directors and
their relatives have sold or purchased securities of our Subsidiaries during the six months preceding the date of
this Draft Red Herring Prospectus.
Price at
Number
Name of Promoter/ Number of which
of
S. Promoter/Promoter Director/ Name of Equity Equity Date on which Equity
Equity
No. Group/Directors/Relatives Promoter Subsidiary Shares Shares Shares Acquired/Sold
Shares
of Directors Group Acquired Acquired/
Sold
Sold
1 Satya Narayanan .R Promoter CLEIS Nil 28,125 281 September 5, 2014
2 Gautam Puri Promoter CLEIS Nil 28,125 281 September 5, 2014
3 Bilakes Promoter CLEIS Nil 962,500 281 September 5, 2014
Profit-making Subsidiaries
Details of profit-making Subsidiaries that contributed more than 5% of the revenue, profits or assets of the
Company on a consolidated basis in fiscal 2014, is set forth below:
(` in million)
CL Media CLIP CLEIS GKP Kestone
Share Capital as on March 31, 2014 0.10 2.48 94.35 1.90 10.00
Turnover for fiscal 2014 292.09 38.78 65.56 185.81 765.59
Profit after Tax for fiscal 2014 83.78 (4.16) 26.16 11.45 33.00
Shareholding of our Company as on
the date of the Draft Red Herring 100% 98.02%* 98.02% 100% 100%
Prospectus
Listing status Unlisted Unlisted Unlisted Unlisted Unlisted
*Through CLEIS, which holds 100% of the issued and paid up capital of CLIP.
Shareholders¶ Agreements
6KDUH VXEVFULSWLRQ DQG VKDUHKROGHUV¶ DJUHHPHQW GDWHG 6HSWHPEHU EHWZHHQ *3( ,QGLD /LPLWHG
Mauritius, our individual Promoters and our Company, as amended on March 9, 2011, November 2, 2012
and August 12, 2014; share subscription agreement dated September 20, 2007 between Gaja Capital India
Fund ± I, our individual Promoters and our Company as amended on February 11, 2008, March 9, 2011,
March 29, 2011 and November 2, 2012; and share subscription and shareholdeUV¶ DJUHHPHQW GDWHG
September 20, 2007 between Shantanu Prakash, our individual Promoters and our Company
In accordance with the terms of the Gaja SHAs, the Investors have certain preferential rights, including
restriction of transfer of shares of each of our individual Promoters, certain pre-emptive rights if our individual
Promoters seek to effect any transfer of shares, rights of co-sale and right of first refusal. Further, the Investors
have the right to appoint a nominee to our Board of Directors and any committees thereof.
In addition, the Company shall not, without the affirmative vote of (i) a nominee of the Investors on the Board
of Directors in case of a meeting of the Board of Directors; and (ii) two nominees of the Investors, in case of a
general meeting of the shareholders of our Company, take any action for, among other things, changing rights,
preferences and privileges of the ,QYHVWRUV¶ Subscription Shares; authorizing, creating or issuing shares having
preferences superior to or on parity with the InvestorV¶ Subscription Shares; amending the MoA or AoA which
142
adversely impacts the rights of the Investors; sale of all or substantially all of our Company or any of our
6XEVLGLDULHV¶DVVets; liquidation or dissolution of our Company; declaration of payment of dividend exceeding
RI RXU &RPSDQ\¶V GLVWULEXWDEOH SURILWV DQ\ VLJQLILFDQW FRUSRUDWH WUDQVDFWLRQV ZKLFK would adversely
impact the debt equity ratio beyond 2.5:1 and financial stability of our Company or is dilutive of the InvestorV¶
Subscription Shares; adoption of any employee stock option plan which is dilutive of the InvestorV¶ Subscription
Shares; DQ\ FKDQJH LQ RXU &RPSDQ\¶V ILQDQFLDO WD[ RU DFFRXQWLQJ SROLFLHV which adversely impacts our
&RPSDQ\¶V profit by more than 10%; change in business of our Company or entering into any unrelated
business; any related party transactions or transactions not at arms length; any proposal for effecting a public
offering or listing of securities of our Company; and, any proposal or consolidation of our Company with one or
more other companies which LVYDOXHGLPLQLVKLQJIURPWKH,QYHVWRUV¶LQYHVWPHQWSHUVSHFWLYH.
All of these above preferential rights RWKHU WKDQ WKH ,QYHVWRUV¶ ULJKW WR DSSRLQW D QRPLQHH WR RXU %RDUG RI
Directors and any committees thereof) shall automatically terminate with effect from the date of listing and
commencement of trading of our Equity Shares on the Stock Exchanges.
6KDUHKROGHUV¶ DJUHHPHQW GDWHG 6HSWHPEHU EHWZHHQ +RXVLQJ 'HYHORSPHQW )LQDQFH &RUSRUDWLRQ
Limited, our Company and our individual Promoters
In accordance with the terms of the HDFC SHA, HDFC has certain preferential rights, including restriction of
transfer of shares of each of our individual Promoters, certain pre-emptive rights if our individual Promoters
seek to effect any transfer of shares, rights of co-sale and right of first refusal. Further, HDFC has the right to
appoint a nominee to our Board of Directors and any committees thereof.
In addition, the Company shall not, without the affirmative vote of (i) a nominee of HDFC on the Board of
Directors in case of a meeting of the Board of Directors; and (ii) a representative of HDFC, in case of a general
meeting of the shareholders of our Company, take any action for, among other things, changing rights,
preferences and privileges of the HDFC Subscription Shares; authorizing, creating or issuing shares having
preferences superior to or on parity with the HDFC Subscription Shares; amending the MoA or AoA which
adversely impacts the rights of HDFC; sale of all or substantially all of RXU&RPSDQ\RUDQ\RIRXU6XEVLGLDULHV¶
assets; liquidation or dissolution of our Company; declaration of payment of dividend exceeding 50% of our
&RPSDQ\¶VGLVWULEXWDEOHSURILWVDQ\VLJQLILFDQWFRUSRUDWHWUDQVDFWLRQVZKLFK would adversely impact the debt
equity ratio beyond 2.5:1 and financial stability of our Company or is dilutive of the HDFC Subscription Shares;
adoption of any equity incentive plan or employee stock option plan which is dilutive of the HDFC Subscription
Shares; change in authorized share capital; DQ\FKDQJHLQRXU&RPSDQ\¶VILQDQFLDOWD[RUDFFRXQWLQJSROLFLHV
which adversely impacts oXU &RPSDQ\¶V profit by more than 10%; change in business of our Company or
entering into any unrelated business; any related party transactions or transactions not at arms length; any
proposal for effecting a public offering or listing of securities of our Company; and, any proposal or
consolidation of our Company with one or more other companies which is value diminishing from +')&¶V
investment perspective.
All of these above preferential rights shall automatically terminate with effect from the date of listing and
commencement of trading of our Equity Shares on the Stock Exchanges.
As at the date of this Draft Red Herring Prospectus, our Company is not a party to any material agreements
which have not been entered into in the ordinary course of business.
As at the date of this Draft Red Herring Prospectus, our Company does not have any strategic or financial
partners.
143
OUR MANAGEMENT
Our Articles of Association enables us to have upto 15 Directors. We presently have 10 Directors on our Board,
which includes, three executive Directors, five Independent Directors, one Director nominated pursuant to the
Gaja SHAs and one Director nominated pursuant to the HDFC SHA. Our Board also has one alternate Director
for one of our Independent Directors. Our Board includes two women Directors as on the date of this Draft
Prospectus (other than Talat Hasan, who serves as an alternate Director).
Set forth below are the details regarding our Board as on the date of this Draft Red Herring Prospectus:
DIN: 00033404
Gopal Jain 43 1/E, First Floor, x Bonanza Portfolio Limited;
Ramalyam, 46 Peddar x Career Launcher Education
Designation: Nominee Director Road, Mumbai 400 026, Infrastructure and Services
Maharashtra, India Limited;
Occupation: Professional x Career Launcher Infrastructure
Private Limited;
Term: Non-retiring
144
Name, Designation, Age (years) Address Other Directorships
Occupation, Term and DIN
x EK Education and Research
DIN: 00032308 Foundation;
x Euroschool Foundation;
x Eurokids International Private
Limited;
x Euroschool International Private
Limited;
x Gaja Advisors Private Limited;
x IIJT Education Private Limited;
x Shivani Mercantile Private
Limited;
x TeamLease Education
Foundation; and
x Team Lease Services Private
Limited.
Madhumita Ganguli 58 R-302, Greater Kailash x Career Launcher Education
Part 1, New Delhi 110 Infrastructure and Services
Designation: Nominee Director 048, India Limited; and
x Purearth Infrastructure Limited.
Occupation: Professional
Term: Non-retiring
DIN: 00676830
Sridar A. Iyengar 67 85, Fair Oaks Lane, x Aver Q Inc.;
Athereton, CA 94027, x Cleartrip Inc.;
Designation: Independent United States of x Cleartrip Private Limited;
Director America x 'U 5HGG\¶V /DERUDWRULHV
Limited;
Occupation: Professional x 'U5HGG\¶V/DERUDWRULHV6$
x ICICI Venture Funds
Term: Five years with effect Management Company Limited;
from September 5, 2014 x iYogi Limited;
x Kovair Software Inc.;
DIN: 00278512
x Mahindra Holidays & Resorts
India Limited;
x Rediff.com India Limited; and
x Rediff Holdings Inc.
Safir Anand 43 1, Jaipur Estate, x Kimaya Fashions Private
Nizamuddin East, New Limited; and
Designation: Independent Delhi 110 013, India x Valinus Consultants Private
Director Limited.
Occupation: Professional
DIN: 02117658
Viraj Tyagi 44 Building No. 9, Flat No. x Net Positive Business Analytics
G-01, Palm Springs, 16th Private Limited; and
Designation: Independent Main, 7th Cross, 4th x Spire Technologies & Solutions
Director Block, Koramangala, Private Limited.
Bengaluru 560 034,
Occupation: Professional India.
DIN: 01760948
Kamil Hasan 70 12182, Parker Ranch x XStor Medical Systems Inc.
Road, Saratoga, CA
145
Name, Designation, Age (years) Address Other Directorships
Occupation, Term and DIN
Designation: Independent 95070, United States of
Director America
Occupation: Professional
DIN: 03457252
Sangeeta Bhagwatiprasad 44 Flat No. 16, Retreat 1, x Access Asset Managers Private
Modi Saraswat Colony, Limited; and
Opposite HDFC Bank, x Access Trusteeship Company
Designation: Independent Santacruz West, Private Limited.
Director Mumbai 400 054,
Maharashtra, India
Occupation: Professional
DIN: 03278272
Talat Hasan, aged 62 years, DIN ± 02821005, residing at 12182, Parker Ranch Road, Saratoga, CA 95070,
United States of America, has been appointed as an alternate Director to Kamil Hasan.
Except Kamil Hasan and Talat Hasan who are U.S. nationals and are married to each other, all our Directors are
Indian nationals and none of our Directors are related to each other.
Satya Narayanan .R, aged 44 years, is our Chairman and Executive Director. He holds a EDFKHORU¶VGHJUHHLQ
FRPSXWHUVFLHQFHVIURP6W6WHSKHQ¶V&ROOHJH8QLYHUVLW\RI'HOKLDQGDpost graduate diploma in management
IURP WKH ,QGLDQ ,QVWLWXWH RI 0DQDJHPHQW %DQJDORUH +H KDV RYHU \HDUV¶ RI H[SHULHQFH LQ WKH HGXFDWLRQ
sector. He has been a Director on our Board since incorporation and was last re-appointed as an Executive
Director of our Company with effect from April 1, 2014. He KDV FRPSOHWHG WKH SURJUDP µKXPDQ LQWHUDFWLRQ
ODERUDWRU\¶IURPWKHNTL Institute for Applied Behavioural Sciences and has received various awards, including
the Karamveer Puraskar in 2009-10 by iCONGO and the Most Promising Entrepreneur Award in the Asia
Pacific Entrepreneurship Awards 2009.
Gautam Puri, aged 49 years, is our Vice Chairman and Managing Director. He KROGVD EDFKHORU¶VGHJUHHLQ
chemical engineering from Punjab Engineering College, Chandigarh and a post graduate diploma in
management DGPLQLVWUDWLRQ IURP WKH ,QGLDQ ,QVWLWXWH RI 0DQDJHPHQW %DQJDORUH +H KDV RYHU \HDUV¶ RI
experience in the education sector. He has been a Director on our Board since incorporation and was last re-
appointed as the Vice Chairman and Managing Director with effect from April 1, 2014.
Nikhil Mahajan, aged 43 years, is our Executive Director and Chief Financial Officer. He holds DEDFKHORU¶V
degree in electrical engineering from Benaras Hindu University, Varanasi and a post graduate diploma in
management administration from the Indian Institute of Management, Bangalore. He has over 17 \HDUV¶ RI
experience in the field of finance and the education sector. He joined our Board on October 12, 2001 and was
last re-appointed as a whole-time director with effect from April 1, 2014.
Gopal Jain, aged 43 years, is our Nominee Director, nominated pursuant to Gaja SHAs. He holds a EDFKHORU¶V
degree in electrical engineering from the Indian Institute of Technology, Delhi. He is one of the co-founders of
Gaja Capital. He has over 21 \HDUV¶H[SHULHQFHLQWKHSULYDWHHTXLW\DQGILQDQFLDOVHUYLFHVLQGXVWU\LQ,QGLD+H
joined our Board on March 6, 2008.
Madhumita Ganguli, aged 58 years, is our Nominee Director, nominated pursuant to the HDFC SHA. She
KROGVDEDFKHORU¶VGHJUHHLQ science from Delhi University. She is a member of the executive management of
146
HDFC Limited. She has over 33 years of experience in the financial sector. She joined our Board on September
16, 2014.
Sridar A. Iyengar, aged 67 years, is our Independent Director. He is a fellow of the Institute of Chartered
Accountants in England and Wales. He is a member on the board of the American India Foundation. From 1968
until his retirement in March 2002, he was employed by KPMG, retiring as the Partner-in-Charge of KPMGs
Emerging Business Practice. He has been the chairman and CEO of KPMGs India operations. He has an
experience of over 34 years in the financial sector. He joined our Board on October 17, 2007 and was re-
appointed on September 5, 2014.
Viraj Tyagi, aged 44 years, is our Independent Director. He holds a post graduate diploma in management
administration from the Indian Institute of Management, Bangalore. He is the co-founder and managing director
of NettPositive Business Intelligence Solutions Private Limited. He has previously worked at Standard
Chartered Bank, India, Halifax Bank of Scotland and American Express, Europe. He has over 20 years of
experience in the financial services industry. He joined our Board on April 28, 2008 and was re-appointed on
September 5, 2014.
Sangeeta Bhagwatiprasad Modi, aged 44 years, is our Independent Director. She holds a post graduate
diploma in management administration from the Indian Institute of Management, Bangalore. She is presently
associated with Access Assets Managers Private Limited and Access Trusteeship Company Private Limited. She
is the co-founder of Access Asset Managers Private Limited. Prior to this, she worked as a consultant with
Aureos India and as Assistant Vice President at GE Capital and management trainee at American Express Bank.
She has over 21 years of experience in the financial sector. She joined our Board on August 11, 2014.
Further Confirmations
None of our Directors is or was a director of any listed companies during the five years immediately preceding
the date of filing of this Draft Red Herring Prospectus and until date, whose shares have been or were suspended
from being traded on any stock exchange during the term of their directorship in such companies.
None of our Directors is or was a director on any listed companies which have been or were delisted from any
stock exchange during the term of their directorship in such companies.
Set forth below is the remuneration received by our Directors in fiscal 2014.
147
S. No. Name of Director Remuneration paid in fiscal
2014 (in `)
3. Nikhil Mahajan 5,459,352
4. Gopal Jain Nil
5. Madhumita Ganguli Nil
6. Sridar A. Iyengar 43,801
7. Safir Anand 26,280
8. Viraj Tyagi 26,280
9. Kamil Hasan 26,280
10. Sangeeta Bhagwatiprasad Modi Nil*
* Sangeeta Bhagwatiprasad Modi joined our Board in fiscal 2015 and therefore did not receive any remuneration in fiscal 2014.
**Gopal Jain and Madhumita Ganguli are nominee Directors and do not receive any remuneration from the Company.
Our Company has not entered into any service contract with any Director providing for benefits upon
termination of directorship.
Pursuant to a resolution passed by our shareholders on February 24, 2014, we shall pay our whole-time
Directors, either by way of a monthly payment, or at a specified percentage of the net profits of our Company,
or partly by one way and partly by the other, in case our Company makes profits in that financial year, provided
that such remuneration shall not exceed 10% (or such other maximum permissible limits under Companies Act)
of the net profits, for all of them together. Further, the actual remuneration to be paid, within the overall range,
VKDOO EH GHFLGHG E\ WKH %RDUG RU RXU &RPSDQ\¶V PDQDJHPHQW LQ FRQVXOtation with and keeping in view the
recommendations of the Nomination, Remuneration and Compensation Committee.
Satya Narayanan .R was appointed as our Executive Director pursuant to a resolution passed by our
shareholders on February 24, 2014, for a period of three years with effect from April 1, 2014 at a remuneration
by way of monthly salary, commission and other perquisites as may be approved by our shareholders. Pursuant
to a resolution passed by way of circulation on March 31, 2014, adopted at the meeting of the Board held on
April 29, 2014, our Board approved a total compensation of ` 8.24 million, comprising fixed compensation of `
5.60 million and variable compensation of ` 2.64 million, payable to Satya Narayanan .R, for fiscal 2014.
Gautam Puri
Gautam Puri was appointed as our Managing Director pursuant to a resolution passed by our shareholders on
February 24, 2014, for a period of three years with effect from April 1, 2014 at a remuneration by way of
monthly salary, commission and other perquisites as may be approved by our shareholders. Pursuant to a
resolution passed by way of circulation on March 31, 2014, adopted at the meeting of the Board held on April
29, 2014, our Board approved total compensation of ` 8.24 million, comprising fixed compensation of ` 5.60
million and variable compensation of ` 2.64 million, payable to Gautam Puri, for fiscal 2014.
Nikhil Mahajan
Nikhil Mahajan was appointed as our Executive Director pursuant to a resolution passed by our shareholders on
February 24, 2014, for a period of three years with effect from April 1, 2014 at a remuneration by way of
monthly salary, commission and other perquisites as may be approved by our shareholders. Pursuant to a
resolution passed by way of circulation on March 31, 2014, adopted at the meeting of the Board held on April
29, 2014, our Board approved total compensation of ` 8.00 million, comprising fixed compensation of ` 5.45
million and variable compensation of ` 2.55 million, payable to Nikhil Mahajan, for fiscal 2014.
The remuneration payable to Satya Narayanan .R, Gautam Puri and Nikhil Mahajan in fiscals 2015, 2016 and
2017, as approved by our shareholders on February 24, 2014, is set forth below:
In addition, Satya Narayanan .R, Gautam Puri and Nikhil Mahajan are entitled to certain benefits, including
contributions for provident funds, gratuity, leave encashment and accident insurance.
Pursuant to a resolution passed by our shareholders on February 24, 2014, we may pay remuneration by way of
commission, up to 1% of the net profit in any financial year, and/or reimbursements in relation to attending
board meetings to Kamil Hasan, Safir Anand, Sridar Iyengar Viraj Tyagi and Gopal Jain, divided in such
proportion as may be determined by the Board of Directors, for a period of three years with effect from April 1,
2014. Further, pursuant to resolution passed by the Board on September 22, 2014, Kamil Hasan, Safir Anand
and Viraj Tyagi are entitled to 0.15% and Sridar Iyengar is entitled to 0.25% commission, for fiscal 2015.
Presently, other than reimbursement of expenses incurred, no remuneration is paid to the nominee Directors of
our Company.
Our Articles of Association, subject to relevant provisions of the Companies Act, 2013, authorize our Board to
raise or borrow money or secure the payment of any sum or sums of money for the purposes of our Company.
Pursuant to a resolution passed at our extra-ordinary general meeting dated May 31, 2008, our shareholders
authorized our Board to borrow from time to time such sums of money as may be required, provided that such
amount shall not exceed ` 1,000 million.
Corporate Governance
The provisions of the Equity Listing Agreements to be entered into with the Stock Exchanges with respect to
corporate governance will be applicable to us immediately upon the listing of our Equity Shares with the Stock
Exchanges. We believe we are in compliance with the requirements of the applicable regulations, including the
Companies Act, the Equity Listing Agreements with the Stock Exchanges and the SEBI ICDR Regulations, in
respect of corporate governance including constitution of our Board and committees thereof. The corporate
JRYHUQDQFHIUDPHZRUNLVEDVHGRQDQHIIHFWLYHLQGHSHQGHQW%RDUGVHSDUDWLRQRIWKH%RDUG¶VVXSHUYLVRU\UROH
from the executive management team and constitution of the Board Committees, as required under law.
Our Board is constituted in compliance with the provisions of the Companies Act, 2013 and the Equity Listing
Agreements. Our Board functions either directly, or through various committees constituted to oversee specific
operational areas.
As on date, our Board has 10 Directors, of which two are women (other than Talat Hasan, who serves as an
alternate Director) and five are independent Directors.
Our Board has constituted the following committees including those for compliance with corporate governance
requirements:
a. Audit Committee
Our Audit Committee was last re-constituted pursuant to resolution of our Board dated September 5, 2014. The
Audit Committee comprises:
149
1. Sridar A. Iyengar (Independent Director)- Chairman
2. Kamil Hasan (Independent Director)- Member;
3. Viraj Tyagi (Independent Director)- Member; and
4. Gopal Jain (Nominee Director)- Member.
Set forth below are the scope, functions and the terms of reference of our Audit Committee, in accordance with
Section 177 of the Companies Act, 2013 and Clause 49 of the Equity Listing Agreements.
x 2YHUVLJKWRIWKHFRPSDQ\¶VILQDQFLDOUHSRUWLQJSURFHVVDQGWKHGLVFORVXUHRILWVILQDQFLDOLQIRUPDWLRQWR
ensure that the financial statements are correct, sufficient and credible;
x Recommendation for appointment, remuneration and terms of appointment of auditors of the company;
x Approval of payment to statutory auditors for any other services rendered by the statutory auditors;
x Reviewing, with the management, the annual financial statements and auditor's report thereon before
submission to the Board for approval, with particular reference to:
(a) 0DWWHUV UHTXLUHG WR EH LQFOXGHG LQ WKH 'LUHFWRU¶V 5HVSRQVLELOLW\ 6WDWHPHQW WR EH LQFOXGHG LQ WKH
%RDUG¶VUHSRUWLQWHUPVRIFODuse (c) of sub-section 3 of section 134 of the Companies Act, 2013;
(b) Changes, if any, in accounting policies and practices and reasons for the same;
(c) Major accounting entries involving estimates based on the exercise of judgment by management;
(d) Significant adjustments made in the financial statements arising out of audit findings;
(e) Compliance with listing and other legal requirements relating to financial statements;
(f) Disclosure of any related party transactions; and
(g) Qualifications in the draft audit report.
x Reviewing, with the management, the quarterly financial statements before submission to the Board for
approval;
x Reviewing, with the management, the statement of uses / application of funds raised through an issue
(public issue, rights issue, preferential issue, etc.), the statement of funds utilized for purposes other than
those stated in the offer document / prospectus / notice and the report submitted by the monitoring
agency monitoring the utilization of proceeds of a public or rights issue, and making appropriate
recommendations to the Board to take up steps in this matter;
x 5HYLHZLQJ DQG PRQLWRULQJ WKH DXGLWRU¶V independence and performance, and effectiveness of audit
process;
x Approval of any subsequent modification of transactions of the company with related parties;
Explanation: The term "related party transactions" shall have the same meaning as provided in Clause
49(VII) of the Listing Agreements.
x Scrutiny of inter-corporate loans and investments;
x Valuation of undertakings or assets of the company, wherever it is necessary;
x Evaluation of internal financial controls and risk management systems;
x Reviewing, with the management, performance of statutory and internal auditors and the adequacy of the
internal control systems;
x Reviewing the adequacy of internal audit function, if any, including the structure of the internal audit
department, staffing and seniority of the official heading the department, reporting structure coverage and
frequency of internal audit;
150
x Discussion with internal auditors of any significant findings and follow up there on;
x Reviewing the findings of any internal investigations by the internal auditors into matters where there is
suspected fraud or irregularity or a failure of internal control systems of a material nature and reporting
the matter to the Board;
x Discussion with statutory auditors before the audit commences, about the nature and scope of audit as
well as post-audit discussion to ascertain any area of concern;
x Looking into the reasons for substantial defaults in the payment to depositors, debenture holders,
shareholders (in case of non-payment of declared dividends) and creditors;
x Reviewing the functioning of the whistle blower mechanism;
x Approval of appointment of CFO (i.e., the whole-time finance director or any other person heading the
finance function or discharging that function) after assessing the qualifications, experience and
background, etc. of the candidate;
x Carrying out any other function as is mentioned in the terms of reference of the Audit Committee.
Further, the Audit Committee shall mandatorily review the following information:
As required under the Equity Listing Agreements, the Audit Committee shall meet at least four times in a year,
and not more than four months shall elapse between two meetings. The quorum shall be two members present,
or one third of the members, whichever is greater, provided that there should be a minimum of two independent
directors present.
b. 6WDNHKROGHUV¶5HODWLRQVKLS&RPPLWWHH
x &RQVLGHULQJDQGUHVROYLQJJULHYDQFHVRIVKDUHKROGHUV¶GHEHQWXUHKROGHUVDQGRWKHUVHFXULW\KROGHUV and
x Redressal of grievances of the security holders of the Company, including complaints in respect of
transfer of shares, non-receipt of declared dividends, balance sheets of the Company, etc.
The 6WDNHKROGHUV¶5HODWLRQVKLS&RPPLWWHHshall meet at least four times a year with maximum interval of four
months between two meetings and shall report to our Board on a quarterly basis regarding the status of
redressal of complaints received from the shareholders of our Company. The quorum shall be two members
present.
The Nomination, Remuneration and Compensation Committee was last re-constituted pursuant to a resolution
of our Board dated August 11, 2014. The Nomination, Remuneration and Compensation Committee comprises:
x Formulation of the criteria for determining qualifications, positive attributes and independence of a director
and recommend to the Board a policy relating to the remuneration of the directors, key managerial
personnel and other employees;
x Formulation of criteria for evaluation of independent directors and the Board;
x Devising a policy on Board diversity;
x Identifying persons who are qualified to become directors and who may be appointed in senior
management in accordance with the criteria laid down, and recommend to the Board their appointment and
removal; and
x Implementation and administration of the amended Career Launcher Employee Stock Option Plan 2008.
The Nomination, Remuneration and Compensation Committee shall meet at least four times a year with
maximum interval of four months between two meetings. The quorum shall be two members present. The ESOP
2008 is administered by the Nomination, Remuneration and Compensation Committee of our Board. For more
informationVHH³Capital Structure´RQSDJH61.
The CSR Committee was constituted pursuant to a resolution of our Board dated April 29, 2014. The CSR
Committee comprises:
Set forth below are the terms of reference of the CSR Committee.
x formulating and recommending to our Board, a corporate social responsibility policy which will indicate
the activities to be undertaken by our Company, in accordance with Schedule VII of the Companies Act,
2013;
x recommending the amount of expenditure to be incurred on such activities; and
x monitoring the corporate social responsibility policy of our Company.
The Corporate Social Responsibility Committee shall meet at least four times a year with maximum interval of
four months between two meetings. The quorum shall be two members present.
The Risk Management Committee was constituted pursuant to a resolution of our Board dated August 11, 2014.
The Risk Management Committee comprises:
Set forth below are the terms of reference of the Risk Management Committee.
x review annually and recommend to the Board the Corporate Risk Management Policy;
x define risk management accountabilities;
x review the status of key corporate risks at every meeting and report to the Board;
x review risk assessments of major corporate strategies and report to the Board;
x provide direction to the risk manager on risk-related issues, and support the development and continuous
improvement of risk management practices;
x work with the audit committee on shared risk issues;
x review and report to the Board on the adequacy of the reinsurance protection of the corporation;
x review RXU&RPSDQ\¶Vbusiness continuity plan;
152
x UHYLHZRXU&RPSDQ\¶VUHSRUWRIRXWVWDQGLQJOLWLJDWLRQH[FOXGLQJFODLPVOLWLgation and report to the Board
as appropriate;
x review and report to the Board on corporate liability protection programmes for directors and officers and,
as required, recommend to the Board changes to the programmes; and
x review at least every three years in conjunction charged with corporate governance and report to the Board
RQWKHDGHTXDF\RIWKH&RPPLWWHH¶VWHUPRIUHIHUHQFH
The Risk Management Committee shall meet at least once a year. The quorum shall be two members present.
Our Articles of Association do not require our Directors to hold qualification shares. As on date of filing of this
Draft Red Herring Prospectus, our Directors hold the following number of Equity Shares of our Company:
As on date of filing of this Draft Red Herring Prospectus, our Directors hold the following number of Equity
Shares of our Subsidiaries:
Our whole-time Directors may be deemed to be interested to the extent of remuneration paid to them for
services rendered as a Director of our Company and reimbursement of expenses payable to them. For details see
³-Details of terms and conditions of employment of our whole-time Directors´ above. Further, all our
independent Directors are entitled to receive commission for attending the Board/committee meetings within the
limits laid down in the Companies Act and as decided by our Board. Other than reimbursement of expenses
incurred, no remuneration is paid to the nominee Directors of our Company. Satya Narayanan .R, Gautam Puri
and Nikhil Mahajan are interested to the extent of being Promoters of our Company. For more information, see
³Our Promoters and Group Entities´RQSDJH160.
Our Directors may also be interested to the extent of Equity Shares, if any, held by them or held by the entities
in which they are associated as promoters, directors, partners, proprietors or trustees or held by their relatives or
that may be subscribed by or allotted to the companies, firms, ventures, trusts in which they are interested as
promoters, directors, partners, proprietors, members or trustees, pursuant to the Offer. Our Director, Kamil
Hasan, is interested to the extent of being a partner of Granite Hill India Opportunities Fund, an affiliated entity
of GHIOF Mauritius, a shareholder of our Company. Our nominee Directors, Gopal Jain and Madhumita
Ganguli, nominated pursuant to the terms of the Gaja SHAs and the HDFC SHA, respectively, and are
interested to the extent of the shareholding of such entities in our Company. Further, our Directors (except our
Promoter Directors who have undertaken not to participate in the Offer) may also be deemed to be interested to
the extent of Equity Shares that may be subscribed for and allotted to them, out of the present Offer. Such
Directors may also be deemed to be interested to the extent of any dividend payable to them and other
distributions in respect of the said Equity Shares and any employee stock options that may be granted to them
under ESOP 2008. For more information on ESOP VHH³Capital Structure´RQSDJH61.
153
Our Directors have no interest in any property acquired by our Company within two years of the date of this
Draft Red Herring Prospectus or proposed to be acquired by it.
([FHSWDVVWDWHGLQWKH³Financial Statements´RQSDJH167, our Directors do not have any other interest in the
business of our Company.
Set forth below are the details of the relatives of our Directors who have been appointed to a place or office of
profit in our Company:
The changes in our Board during the last three years are as follows:
154
Satya Narayanan .R
Chairman
Sujit Bhattacharya
COO & Whole-Time
Director CLEIS
Himanshu Jain Sanjeev Srivastava Piyush Gupta Vivek Garg Ajit Kumar K12
Senior Vice President President, Emerging President Business Senior Vice President General Manager
Network Business Group Operations, Kestone Finance Business
Development
Set forth below are the details of our key managerial personnel as on the date of filing of this Draft Red Herring
Prospectus.
R. Shiva Kumar, aged 43 years, is a whole-time director on the board of directors of CLEIS and also the Chief
Academic Officer of the group+HKROGVDEDFKHORU¶VGHJUHHLQWHFKQRORJ\IURPIndian Institute of Technology,
0DGUDVDQGDPDVWHU¶VGHJUHHLQPDQDJHPHQWIURP,QGLDQ,QVWLWXWHRI0DQDJHPHnt, Kolkata. He has more than
17 years of experience in the private education sector. He has been involved with our Company since 1997,
holding various designations and joined CLEIS in August 2011. He received a gross remuneration of ` 4.85
million in fiscal 2014.
Sreenivasan .R, aged 48 years, is the Chief Incubation Officer (New Projects) of the group and an employee of
CL Media +H KROGV D EDFKHORU¶V GHJUHH LQ science from 0HHUXW 8QLYHUVLW\ D PDVWHU¶V GHJUHH LQ WHFKQRORJ\
from the Jawahar Lal Nehru University, New Delhi DQG D PDVWHU¶V GHJUHH LQ business administration from
Indian Institute of Management, Bangalore. He has more than 14 years of experience in the education sector. He
has been involved with our Company since 2000, holding various designations. He received a gross
remuneration of ` 3.90 million in fiscal 2014.
Sujit Bhattacharyya, aged 47 years, is the Chief Operating Officer of the group and a whole-time director on
the board of directors of CLEIS. He holds a bachelor of technology degree in electrical engineering from Indian
Institute of Technology, Kharagpur and a post graduate diploma in management from Indian Institute of
Management, Bangalore. He has more than 14 years of experience in the education sector. He has been involved
with our Company since 2001, holding various designations and joined CLEIS in March 2008. Prior to his
association with our Company, he worked with Wipro and Dharma Systems. He received a gross remuneration
of ` 4.85 million in fiscal 2014.
Sanjeev Srivastava, aged 54 years, is the President - Emerging Business Groups of our Company. He holds a
EDFKHORU¶VGHJUHHLQHFRQRPLFVIURP+DQV5DM&ROOHJH8QLYHUVLW\RI'HOKLDQGDPDVWHU¶VGHJUHHLQVRFLRORJ\
from University of Rajasthan. He has 19 years of experience in the banking sector. He joined our Company in
October 2010. Prior to joining our Company, he has worked with Allahabad Bank, Bank of Punjab, the Times
Bank and HDFC Bank Limited. He received a gross remuneration of ` 4.67 million in fiscal 2014.
Ajit Kumar, aged 44 years, is the General Manager - Business Development of our Company. He holds a
EDFKHORU¶V GHJUHH LQ commerce from Osmania University, Hyderabad, a diploma in marketing management
from the Osmania University, Hyderabad and a diploma in sales management from Manukau Institute of
Technology, New Zealand and a diploma in information and systems management from Aptech Computer
Education, Hyderabad. He has more than 14 years of experience in the fields of strategic planning,
organizational development and sales management. He joined our Company in April 2008. Prior to joining our
Company, he was associated with T.I.M.E. He received a gross remuneration of ` 2.85 million in fiscal 2014.
Himanshu Jain, aged 42 years, is the Senior Vice President - Network RIRXU&RPSDQ\+HKROGVDEDFKHORU¶V
degree in commerce from Dyal Singh College, University of Delhi, a diploma in management and a post
graduate diploma in marketing management from India Gandhi National Open University, New Delhi and a
diploma in information and systems management from Aptech Computer Education, New Delhi. He has more
than 21 years of experience in the field of marketing and sales. He joined our Company in September 2011.
Prior to joining our Company, he was associated with karROX Technologies Limited, iProf Learning Solutions
India Limited, Sri Sidharth Industries and STG International Limited. He received a gross remuneration of `
2.30 million in fiscal 2014.
Vivek Garg, aged 42 years, is the Senior Vice President - Finance of our Company. He holds a baFKHORU¶V
degree in commerce from University of Delhi and a chartered accountant registered with the Institute of
Chartered Accountants of India. He joined our Company in April 2013. Prior to joining our Company, he was
associated with Global Indian Foundation- Global Indian International School and Eye-Q Vision Private
Limited. He received a gross remuneration of ` 2.13 million in fiscal 2014.
Ruchika, aged 30 years, is the Chief Manager - Finance of our Company. ShH KROGV D EDFKHORU¶V GHJUHH LQ
commerce from the University of Delhi and a post graduate diploma in management from Indian Institute of
Management, Lucknow. She has more than 7 years of experience in the finance sector. She joined our Company
in March 2011. Prior to joining our Company, she was associated with HSBC Bank. She received a gross
remuneration of ` 1.92 million in fiscal 2014.
Rachna Sharma, aged 38 years, is the Manager - Company Secretary and Compliance Officer of our Company.
She is an associate of the Institute of Company Secretaries of India and holds a PDVWHUV¶GLSORPD LQEXVLQHVV
administration from Symbiosis Institute of Management Studies, Pune. She has over 14 years of experience in
secretarial functions. She joined our Company in March 2009. Prior to joining our Company, she has worked
with Himachal Futuristic Communications Limited, Jindal Leasefin Limited, UKLI Real Estate Private Limited.
She received a gross remuneration of ` 1.14 million in fiscal 2014.
Unless otherwise specified, the aforesaid key managerial personnel are permanent employees of our Company.
The term of office of our employees, including our key managerial personnel, is until the attainment of 58 years
of age.
Except for R. 6KLYD .XPDU ZKR LV 6DW\D 1DUD\DQDQ 5¶V EURWKHU-in-law and Sreenivasan .R who is Satya
1DUD\DQDQ 5¶V EURWKHU QRQH RI RXU NH\ PDQDJHULDO SHUVRQQHO DUH UHODWHG WR HDFK RWKHU or to any of our
Directors.
Except as disclosed below, none of our key managerial personnel hold any Equity Shares of our Company. Also
VHH³Employee Stock Option or Stock Purchase Scheme´EHORZ
Name of Key Managerial Personnel Number of Equity Shares Percentage (in Number of Equity
(Pre-Offer) %) Shares (Post-Offer)
R. Shiva Kumar 449,698 3.86% 364,698
Sreenivasan .R 449,698 3.86% 399,698
Sujit Bhattacharyya 303,062 2.60% 228,062
Sanjeev Srivastava 2,381 0.02% 2,381
Ajit Kumar 1,000 0.01% 1,000
Rachna Sharma 250 Negligible 250
Total 1,203,708 10.33% 993,708
FoUGHWDLOVVHH³Capital Structure´RQSDJH61.
Our key managerial personnel may be interested to the extent of Equity Shares, if any, held by them. Other than
to the extent of the remuneration or benefits to which they are entitled to as per their terms of appointment or to
the extent of any employee stock options that may be granted to them pursuant to ESOP 2008, our key
managerial personnel do not have any other interest in the business of our Company. Additionally, Mr. Ajit
Kumar and Mr. Sanjeev Srivastava are interested in outstanding loans or advances of ` 125,316 and ` 700,000,
respectively, as on August 31, 2014, given to them by the Company. Further, R. Shiva Kumar, Sreenivasan .R
and Sujit Bhattacharya are interested to the extent of being Promoters of our Company. For more information,
VHH³Our Promoters and Group Entities´RQSDJH160.
157
Our key managerial personnel may also be deemed to be interested to the extent of Equity Shares that may be
subscribed for and allotted to them, pursuant to this Offer. Such key managerial personnel may also be deemed
to be interested to the extent of any dividend payable to them and other distributions in respect of the said
Equity Shares.
None of our key managerial personnel has been paid any consideration of any nature, other than their
remuneration.
Set forth below are the changes in our key managerial personnel in the last three years:
ESOP 2008
As on September 22, 2014, 55,111 have lapsed, 167,932 have vested, 7,675 have been exercised and 209,682
are oustanding. For more information on (623VHH³Capital Structure´RQSDJH61.
Some of our employees have EHHQ JUDQWHG RSWLRQV XQGHU WKH (PSOR\HH 6WRFN 2SWLRQ 3ODQ ³CLEIS
ESOP 2008´ZKLFKZDVDGRSWHGE\&/(,6RQRIRXU6XEVLGLDULHVLQ6HSWHPEHUWRJUDQWRSWLRQVDJDLQVW
the equity shares of CLEIS to its employees and the employees of its holding company. The CLEIS ESOP 2008
is intended to reward the option holders for their contribution and services.
As on March 31, 2014, 25,000 options were granted under the CLEIS ESOP, all of which were granted to the
employees of our Company. Further as on March 31, 2014, 20,000 options against the equity shares of CLEIS
were outstanding under the CLEIS ESOP 2008.
Except as stated otherwise in this Draft Red Herring Prospectus and performance based bonus or variable
payment made to our employees and any statutory payments made by our Company, no non-salary amount or
benefit has been paid, in two preceding years, or given or is intended to be paid or given to any of our
&RPSDQ\¶V RIILFHUV H[FHSW UHPXQHUDWLRQ RI Vervices rendered as Directors, officers or employees of our
Company. However, our Company from time to time, extends discounts on our services to employees of the
Company and their relatives.
Except statutory benefits upon termination of their employment in our Company or superannuation, no officer
RIRXU&RPSDQ\LVHQWLWOHGWRDQ\EHQHILW XSRQWHUPLQDWLRQRIVXFKRIILFHU¶VHPSOR\PHQWLQRXU &RPSDQ\RU
superannuation. Contributions are made by our Company towards provident fund, gratuity fund and employee
state insurance.
Except as stated in the ³Financial Statements´ on page 167, none of the beneficiaries of loans and advances and
sundry debtors are related to our Company, our Directors or our Promoter.
None of our key managerial personnel or Directors has been appointed pursuant to any arrangement or
understanding with our major shareholders, customers, suppliers or others, except for our nominee Directors,
158
Gopal Jain and Madhumita Ganguli, nominated pursuant to the terms of the Gaja SHAs and the HDFC SHA,
respectively. For more information on the Gaja SHAsVHH³History and Certain Corporate Matters´RQSDJH
138.
159
OUR PROMOTERS AND GROUP ENTITIES
Our Promoters are Satya Narayanan .R, Gautam Puri, Nikhil Mahajan, R. Shiva Kumar, Sreenivasan .R, Sujit
Bhattacharya and Bilakes Consulting Private Limited. As on date of this Draft Red Herring Prospectus, our
Promoters hold, in aggregate, 7,642,626 Equity Shares, representing 65.63% of the issued and paid-up Equity
Share capital of our Company.
Satya Narayanan .R
Gautam Puri
Gautam Puri, aged 49 years, is our Vice Chairman and Managing Director.
+LVYRWHU¶VLGHQWLILFDWLRQQXPEHULVNEC1437169.
+LVGULYHU¶VOLFHQVHQXPEHULVNT-3065/ GZB.
Nikhil Mahajan
Nikhil Mahajan, aged 43 years, is our Executive Director and Chief Financial
Officer.
+LVYRWHU¶VLGHQWLILFDWLRQQXPEHULVYSN0170811.
+LVGULYHU¶VOLFHQVHQXPEHULV6916/F/2005.
R. Shiva Kumar
160
R. Shiva Kumar aged 43 years, is a whole-time director on the board of
directors of CLEIS and also the Chief Academic Officer of the group.
Residential Address: Aster 42/1, Vatika City, Sohna Road, Sector 49, Gurgaon
121 018, India
Sreenivasan .R
Sreenivasan .R, aged 48 years, is the Chief Incubation Officer (New Projects) of
our Company.
Residential Address: 82, Ground Floor, Block-1, Eros Garden, Surajkund Road,
Faridabad 121 009, India.
Sujit Bhattacharyya
Residential Address: A-703, Sarita Vihar, New Delhi 110 044, India
+LVYRWHU¶VLGHQWLILFDWLRQQXPEHULVNWD1196674.
+LVGULYHU¶VOLFHQVHQXPEHULVDL-0320100157052.
We confirm that the PAN, bank account numbers and passport numbers of our Promoters will be submitted to
the Stock Exchanges, at the time of filing this Draft Red Herring Prospectus with the Stock Exchanges.
%LODNHV&RQVXOWLQJ3ULYDWH/LPLWHG³%LODNHV´
161
Our Promoters, Satya Narayanan .R and Gautam Puri, and their respective spouses, Uma Ramachandran and
Sapna Puri, are the promoters of Bilakes. There has been no change in the control of Bilakes during the last
three years immediately preceding the date of filing of this Draft Red Herring Prospectus.
As on the date of this Draft Red Herring Prospectus, the equity shares of Bilakes are not listed on any stock
exchanges in India or abroad.
Shareholding Pattern
Set forth below is the shareholding pattern of Bilakes as on the date of this Draft Red Herring Prospectus.
Board of Directors
As on the date of this Draft Red Herring Prospectus, the board of directors of Bilakes comprises:
Financial Information
Set forth below are the audited financial results of Bilakes for fiscal 2014, 2013 and 2012.
We confirm that the PAN, bank account numbers, company registration number and the address of the registrar
of companies where our corporate Promoter is registered will be submitted to the Stock Exchanges at the time of
filing of this Draft Red Herring Prospectus with them.
162
Our Promoters are interested in our Company to the extent of their shareholding in our Company and in any
dividend distribution which may be made by our Company in future. For more information on RXU3URPRWHUV¶
VKDUHKROGLQJ VHH ³Capital Structure´ RQ SDJH 61. Our individual Promoters are also interested to the extent
they are the Directors or key managerial personnel of our Company as well as any remuneration of expenses
payable to them. For more information VHH ³Our Management ± Interest of our Directors´ DQG ³Our
Management ± Interest of Key Managerial Personnel´RQSDJHV153 and 157, respectively.
Further, our Promoters and Group Entities confirm that they have no interest in any property acquired by our
Company during the two years preceding the date of filing of this Draft Red Herring Prospectus or any property
proposed to be acquired by our Company or in any transaction in the acquisition of land, construction of
building or supply of machinery. None of our Promoters are interested as a member of a firm or company, and
no sum has been paid or agreed to be paid to our Promoters or to the firm or company in cash or shares or
otherwise by any person either to induce any of our Promoters to become, or to qualify such Promoters as, a
director, or otherwise for services rendered by such Promoters or by the firm or company, in connection with the
promotion or formation of our Company.
Group Entities
Career Launcher Employees Welfare Society ³CLEWS´, was registered as a society under the Societies
Registration Act, 1860, on July 1, 2004. The main objects of CLEWS are to, among others, provide financial
assistance for the maintenance and education of employees of or persons associated as consultants or retainers
with our Company and their relatives. Gautam Puri and Nikhil Mahajan are the members of the managing
committee of CLEWS.
CLEWS is not required to, and does not, prepare audited financial statements.
Financial Information
The audited financials of CLEGGT for fiscal 2014, 2013 and 2012 are set forth below:
(` in million)
Fiscal 2014 Fiscal 2013 Fiscal 2012
Capital Fund 1.15 2.03 1.96
Total Income 0.17 0.18 0.19
Excess of Income over 0.16 0.18 0.19
expenditure
Gautam Puri HUF is a Hindu Undivided Family represented by Gautam Puri as its karta. Gautam Puri HUF¶V
PAN is AACHG4390R.
Financial Information
The audited summary financials of Gautam Puri HUF for fiscals 2013, 2012 and 2011 are set forth below.
(` in million)
Fiscal 2014 Fiscal 2013 Fiscal 2012
Capital Account 4.72 4.64 4.49
Total Income 0.20 0.15 0.49
Net Profit 0.08 0.15 0.49
163
4. Nikhil Mahajan HUF
Nikhil Mahajan HUF is a Hindu Undivided Family represented by Nikhil Mahajan as its karta. Nikhil Mahajan
HUF¶V3$1LVAAFHN8211B.
Financial Information
The audited summary financials of Nikhil Mahajan HUF for fiscals 2014, 2013 and 2012 are set forth below.
(` in million)
Fiscal 2014 Fiscal 2013 Fiscal 2012
Capital Account 1.65 0.85 0.78
Total Income 0.94 0.07 0.77
Excess of Income over 0.94 0.07 0.77
Expenditure
The equity shares of our Group Entities are not listed on any stock exchanges and they have not made any
public or rights issue of securities in the preceding three years.
None of our Group Entities had a negative net worth in the last fiscal year.
Our Promoters have not disassociated themselves as a promoter(s) from any company in the three years
immediately preceding the date of this Draft Red Herring Prospectus.
Other Confirmations
Common Pursuits
There are no common pursuits among our Group Entities and our Company. However, we have in the past
entered, and expect to continue to enter, into transactions with certain related parties in the ordinary course of
our business, including due to the industry and regulatory framework in which we operate. While we believe
WKDWDOORXUUHODWHGSDUW\WUDQVDFWLRQVKDYHEHHQFRQGXFWHGRQDUP¶VOHQJWKEDVLV our Promoter and members of
the Promoter Group have interests in other companies and entities that may compete with us. For more
LQIRUPDWLRQVHH³Risk Factors´RQSDJH11 and ³Financial Statements´RQSDJH167.
Each of our individual Promoters, have given undertakings dated September 24, 2014, that so long as they are in
employment of our Company, including as a Director or consultant of our Company, and for a period of two years
thereafter, they will not, directly or indirectly (including through a holding company or through members of his
family or otherwise), engage in any business if such business, in whole or in part deals with or offers same or
similar test preparation courses and vocational services, publishes educational books and content, and provides
infrastructure and educational services for K-12 schools in India.
None of our Group Entities have any business or other interest in our Company except for business conducted
RQDQDUPV¶OHQJWKEDVLVRUWRWKHH[WHQWRIDQ\(TXLW\6KDUHVKHOGE\WKHP)RU more information on business
transactions with our Group Entities and their significance on oXU ILQDQFLDO SHUIRUPDQFH VHH ³Financial
Statements´RQSDJH167.
164
Further, except as stated in ³Financial Statements´ on page 167, our Company does not have any
sales/purchase arising out of any transaction with any Group Company exceeding, in aggregate, 10% of the total
sales or purchases of our Company.
Our Promoters, directors of our Group Entities and our Group Entities have confirmed that they have not been
declared as wilful defaulters by the RBI or any other governmental authority and there are no violations of
securities laws committed by them in the past and no proceedings pertaining to such penalties are pending
against them.
For more information relating to legal proceedings involving our Promoters and Group Entities, see
³Outstanding Litigation and Material Developments´RQSDJH393.
As on the date of this Draft Red Herring Prospectus, our Promoters, members of our Promoter Group and Group
Entities are not prohibited from accessing or operating in the capital markets, or restrained from buying, selling
or dealing in securities under any order or direction passed by SEBI or any other regulatory or governmental
authority. Further, none of our Promoters was or is a promoter or person in control of any other company that is
debarred from accessing the capital markets under any order or direction made by SEBI or any other authority.
None of the companies forming part of our Group Entities has become sick companies under the Sick Industrial
Companies (Special Provisions) Act, 1985 and no winding up proceedings have been initiated against them.
Further, none of our Group Entities has become defunct and no application has been made in respect of any of
them, to the respective registrar of companies where they are situated, for striking off their names, in the five
years immediately preceding the date of this Draft Red Herring Prospectus.
165
DIVIDEND POLICY
The declaration and payment of dividend on our Equity Shares will be recommended by our Board and
approved by our shareholders, at their discretion, and will depend on a number of factors, including but not
limited to applicable law, our profits, capital requirements, contractual obligations, restrictive covenants under
our loan and financing arrangements and the overall financial condition of our Company.
No dividends have been declared on the Equity Shares by our Company during the last five years.
However, our dividend history is not necessarily indicative of our dividend policy, in the future. Future
dividends, if any, will depend on our revenues, profits, cash flow, financial condition, capital requirements and
other factors.
166
SECTION V ± FINANCIAL INFORMATION
FINANCIAL STATEMENTS
To,
The Board of Directors
CL Educate Limited
DTJ 925, DLF Tower - B
Jasola District Centre,
New Delhi - 110025
India
Dear Sirs,
1. We have examined the financial information of CL Educate Limited (“the Company”) for the purpose of
its inclusion in the Draft Red Herring Prospectus(“DRHP”) prepared by the Company in connection with
its proposed Initial Public Offering (“IPO”). Such financial information comprises of (A) Fi nancial
Information as per Restated Summary Financial Statements and (B) Other Financial Information , which
have been approved by the Board of Directors of the Company and prepared in accordance with the
requirements of:
(a) section 26(1)(b) of the Companies Act, 2013 (“the Act”) read with Rule 4 of the Companies
(Prospectus and Allotment of Securities) Rules, 2014 ; and
(b) the Securities and Exchange Board of India (Issue of Capital and Disclosure Requirements)
Regulations, 2009, as amended (“SEBI Regulations”).
a. the terms of reference agreed with the Company vide engagement letter dated August 18, 2014
relating to work to be performed on such financial information, proposed to be included in the
DRHP of the Company in connection with its proposed IPO; and
b. the Guidance Note (Revised) on Reports in Company Prospectuses issued by the Institute of
Chartered Accountants of India.
3. Financial Information
The financial information referred to above, relating to assets and liabilities, profits and losses, and
cash flows of the Company is contained in the following annexure to this report (collectively
referred to as the “Restated Summary Financial Statements”):
a) Annexure I containing the “Restated Summary Statement of Assets and Liabilities” as at March 31,
2014, 2013, 2012, 2011 and 2010.
b) Annexure II containing the “Restated Summary Statement of Profit and Loss ” for the years ended
March 31, 2014, 2013, 2012, 2011 and 2010.
c) Annexure III containing the “Restated Summary Statement of Cash Flows” for the years ended
March 31, 2014, 2013, 2012, 2011 and 2010.
167
e) Annexure V to XXXIV and XLVIII containing the Annexure to Restated Summary Financial
Statements.
The aforesaid Restated Summary Financial Statements have been prepared by the Management from the
audited financial statements of the Company as at and for each of the years ended March 31, 2014,
2013, 2012, 2011 and 2010, prepared in accordance with accounting principles generally accepted in
India at the relevant time and approved by the Company in its Board meetings held on August 11, 2014,
July 26, 2013, July 30, 2012, July 26, 2011 and September 8, 2010 respectively.
The audited financial statements of the Company as at and for the year ended on March 31, 2010,
prepared in accordance with the accounting principles generally accepted in India at the relevant time
and approved by the Company in its Board meeting held on September 8, 2010 which was audited by
Deloitte Haskins & Sells, Chartered Accountants and has been relied upon by us.
Other Financial Information, relating to the Company which is based on the Restated Summary
Financial Statements / audited financial statements, prepared by the management and approved by
the Board of Directors, is attached in Annexure XXXV to XLVII and XLIX to LI to this report and listed
hereunder:
5. Management Responsibility on the Restated Summary Financial Statements and Other Financial
Information
Management is responsible for the preparation of Restated Summary Financial Statements and Other
Financial Information relating to the Company in accordance with section 26(1)(b) of the Act read with
Rule 4 of the Companies (Prospectus and Allotment of Securities) Rules, 2014 and the SEBI Regulations.
6. Auditors’ Responsibility
Our responsibility is to express an opinion on the Restated Summary Financial Statements based on our
procedures, which were conducted in accordance with Standard on Auditing (SA) 810, “Engagement to
Report on Summary Financial Statements” issued by the Institute of Chartered Accountants of India.
7. Opinion
In our opinion, the financial information of the Company as stated in Para 3 above and Other Financial
Information as stated in Para 4 above, read with the Statement of Significant Accounting Policies
enclosed in Annexure IV (1) to this report, after making such adjustments/restatements and
regroupings as considered appropriate, as stated in Statement on Adjustments to Audited Financial
Statements enclosed in Annexure IV (2), have been prepared in accordance with section 26(1)(b) of
the Act read with Rule 4 of the Companies (Prospectus and Allotment of Securities) Rules, 2014 and
the SEBI Regulations.
The Restated Summary Financial Statements have been arrived at after making such adjustments and
regroupings as, in our opinion, are appropriate and more fully described in the Statement on
Adjustments to Audited Financial Statements in Annexure IV (2) [read with significant accounting
policies in Annexure IV (1)] to this report. Based on our examination of the same, we confirm and
state that:
a) adjustments for the material amounts in the respective financial years to which they relate to
have been adjusted in the attached Restated Summary Financial Statements;
b) there are no changes in accounting policies adopted by the Company during year ended March 31,
2014 which requires adjustments in the Restated Summary Financial Statements;
c) upto the financial year ending March 31, 2011, the Company had a policy of charging off its
inventory to the statement of profit and loss. Effective financial year ended March 31, 2012 the
Company started recognising inventory in the balance sheet based on actual inventory lying with
the Company at the year end. The impact of such change in accounting policy on the profit as per
restated summary of profit and loss for the years ended March 31, 2010 and 2011 is
unascertainable;
d) there are no extraordinary items that are required to be disclosed in the Restated Summary
Financial Statements;
e) qualifications in respect of matters specified in paragraphs 4 and 5 of Companies (Auditors’
Report) Order, 2004 and which form part of Independent Auditors’ reports to the financial
statements for the years ended March 31, 2014, 2013, 2012, 2011 and 2010, which have been
adjusted to the restated summary financial statements are as below:
(Amounts below have been converted into Rs. in millions for purpose of examination report only).
Name of the entity Maximum amount Year-end
outstanding during the balance
year
The Company has also granted interest bearing unsecured loan to G.K. Publications Private Limited,
a company covered in the register maintained under Section 301 of the Act. The maximum amount
involved during the year was Rs. 25.17 million and the year-end balance of loan granted to such
party was Rs. 20.65 million.
In our opinion and according to the information and explanations given to us, the rate of
interest and other terms and conditions for loans given to CL Media Private Limited, Career
Launcher Asia Educational Hub Pte. Ltd., Career Launcher USA Inc. are prima facie,
prejudicial to the interest of the Company. The year-end balance of such loans was Nil, Rs.
9.36 million and Rs. 38.39 million respectively. Maximum amount involved during the year
on such loans was Rs. 47.76 million, Rs. 9.36 million and Rs. 38.39 million respectively.
During the year, the Company has fully written off loan granted in earlier years to Career
Launcher Education Foundation aggregating Rs. 112.88 million. Accordingly, in our opinion
such loan was prejudicial to the interest of the Company.
In our opinion and according to the information and explanations given to us, the rate of
interest and other terms and conditions for loans given to other companies and parties
covered in the register maintained under section 301 of the Companies Act, 195 are prima
facie, not prejudicial to the interest of the Company.
In our opinion and according to the information and explanations given to us, the rate of
interest and other terms and conditions for such loans given to CL Media Private Limited
and Career Launcher Asia Educational Hub Pte. Ltd., wholly owned subsidiaries of the
Company, are prima facie, prejudicial to the interests of the Company.
In our opinion and according to the information and explanations given to us, the rate of
interest and other terms and conditions for such loans given to parties other than above,
are prima facie, not prejudicial to the interest of the Company.
For the year ending March 31, 2014
During the year, the Company has fully written off accumulated interest on loan granted in earlier
years to Career Launcher Education Foundation, an entity over which key management personnel
have significant influence, aggregating Rs. 15.48 million. Accordingly, in our opinion such loan is
prejudicial to the interest of the Company.
In our opinion and according to the information and explanations given to us, the rate of interest,
wherever charged, and the other terms and conditions of loans granted to other parties except
Career Launcher Education Foundation are not, prima facie, prejudicial to the interest of the
Company.
The Company is regular in depositing with appropriate authorities undisputed statutory dues
including provident fund, investor education and protection fund, employees’ state insurance and
other material statutory dues applicable to it. However, there are slight delays in depositing
undisputed statutory dues in respect of tax deducted at source and service tax.
According to the information and explanations given to us and on the basis of examination of the
records of the Company, no undisputed amount payable in respect of provident fund, investor
education and protection fund, wealth tax, service tax, employees’ state insurance, income-tax and
other undisputed statutory dues were outstanding, at the year end, for a period of more than six
months from the date they became payable.
In our opinion, the Company is not maintaining proper records of inventory. Further, in the
absence of proper records, the discrepancies, if any, between the book records and the physical
verification cannot be ascertained. However, as explained, the Company has initiated the process
of implementing software to maintain records of inventory.
In our opinion and according to the information and explanations given to us, there exists an
adequate internal control system commensurate with the size of the Company and the nature of its
business with regard to purchase of fixed assets and with regard to the sale of goods and services.
During the course of our audit, we have not observed any continuing failure to correct major
weakness in internal control system of the Company in this regard.
In our opinion, the internal control system with regard to purchase of inventory needs to be
strengthened to be commensurate with the size of the Company and nature of its business.
According to the information and explanations given to us, the Company has initiated the process of
rectifying such weakness in internal controls related to purchase of inventory and accordingly, we
have not observed continuing failure to correct major weakness in internal control system of the
Company in this regard.
(iii) Clause 4(ix)(a)
The Company is regular in depositing with appropriate authorities undisputed statutory dues
including provident fund, investor education and protection fund, employees’ state insurance,
income-tax and other material statutory dues applicable to it. However, there have been delays in
depositing undisputed statutory dues in respect of service tax.
Statutory dues including sales tax, wealth tax, custom duty, cess payable under section 441 A of the
Companies Act, 1956 and excise duty are currently not applicable to the Company.
In our opinion and according to the information and explanations given to us, there exists an
adequate internal control system commensurate with the size of the Company and nature of its
business with regard to purchase of fixed assets and with regard to sale of goods and services.
During the course of our audit, we have not observed any continuing failure to correct weakness in
internal control system of the Company.
However, internal control system with regard to purchase of inventory needs to be strengthened in
order to be commensurate with the size of the Company and the nature of its business. The
Company is in the process of rectifying such weaknesses subsequent to the reporting date.
In our opinion and according to the information and explanations given to us, there exists an
adequate internal control system commensurate with the size of the Company and the nature of its
business with regard to purchase of fixed assets and with regard to the sale of services. There are
no transactions in respect of purchase of inventories and for sale of goods.
In our opinion internal controls relating to accounting of revenue, discount for course fees and
refunds are inadequate and requires strengthening. There has been a continuing failure to correct
major weaknesses in internal controls in accounting of discount for course fees.
Except for delays in deposit of taxes deducted at source, Service Tax, Income Tax and Professional
Tax, the Company is generally regular in depositing statutory dues payable in respect of provident
fund, employees’ state insurance, Value added tax, Cess and other material statutory dues
applicable to it with the appropriate authorities.
There were no undisputed amounts payable in respect of Taxes deducted at source, Income Tax,
Service Tax, Provident Fund, Value added Tax, Professional Tax and other material statutory dues in
arrears as at 31st March 2010 for a period more than six months from the date they became
payable.
The company has not paid service tax aggregating Rs. 0.066 million on royalty payments made to a
foreign party in respect of intellectual property service.
8. The figures included in the Restated Summary Financial Statements and Other Financial Information do
not reflect the events that occurred subsequent to the date of the audit reports on the respective
years referred to above.
9. This report should not in any way be construed as a reissuance or redating of the previous audit reports
nor should this be construed as a new opinion on any of the financial statements referred to herein.
Reading the Restated Summary Financial Statements is not a substitute for reading the audited
financial statements of the Company.
10. We did not perform audit tests for the purposes of expressing an opinion on individual balances or
summaries of selected transactions, and accordingly, we express no such opinion thereon.
11. We have no responsibility to update our report for events and circumstances occurring after the date of
the report.
12. This report is issued at the specific request of the Company for your information and inclusion in the
DRHP to be filed by the Company with SEBI and Stock Exchanges in connection with the proposed IPO of
equity shares of the Company. This report may not be useful for any other purpose.
CL Educate Limited
Annexure I - Restated summary statement of assets and liabilities
` in Million
Particulars Annexures As at March 31
2014 2013 2012 2011 2010
EQUITY AND LIABILITIES
Shareholders’ funds
Share capital V 99.18 99.18 93.35 94.35 87.49
Reserves and surplus VI 1,031.28 1,005.95 805.21 751.87 548.21
1,130.46 1,105.13 898.56 846.22 635.70
Non-current liabilities
Long-term borrowings VIII 18.88 36.26 117.47 125.92 197.59
Deferred tax liabilities (net) IX 17.81 4.30 - 0.51 3.31
Long-term provisions X 13.58 8.35 7.04 8.51 6.16
50.27 48.91 124.51 134.94 207.06
Current liabilities
Short-term borrowings XI 240.66 234.45 163.17 19.81 88.88
Trade payables XII 112.15 55.27 97.24 96.01 42.83
Other current liabilities XIII 288.38 336.02 392.82 293.73 293.53
Short-term provisions X 0.46 1.47 1.15 - 0.36
641.65 627.21 654.38 409.55 425.60
Total Liabilities.. 1,836.24 1,781.25 1,706.90 1,491.02 1,268.36
ASSETS
Non-current assets
Fixed assets
- Tangible assets XIV 336.79 349.30 411.41 424.50 180.69
- Intangible assets XV 110.75 123.37 136.78 25.93 28.98
- Capital work-in-progress XVI - 0.09 - - 195.89
Non-current investments XVII 453.28 406.01 364.45 274.51 214.51
Deferred tax assets (net) IX - - 33.32 - -
Long-term loans and advances XVIII 82.99 91.01 70.43 71.22 83.16
Other non-current assets XIX 132.43 150.91 4.13 54.84 32.24
1,116.24 1,120.69 1,020.52 851.00 735.47
Current assets
Current investments XX - - - - -
Inventories XXI 33.65 24.28 12.50 - -
Trade receivables XXII 358.92 312.98 264.02 200.19 184.86
Cash and bank balances XXIII 44.66 65.29 157.98 129.79 127.69
Short-term loans and advances XXIV 204.91 189.07 233.79 295.82 200.44
Other current assets XXV 77.86 68.94 18.09 14.22 19.90
720.00 660.56 686.38 640.02 532.89
Total assets.. 1,836.24 1,781.25 1,706.90 1,491.02 1,268.36
Footnotes:
1) The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and loss
and cash flow.
2) Refer Annexure IV(2) for material adjustments.
This is the restated summary statement of assets and liabilities referred to in our report of even date.
CL Educate Limited
Annexure II - Restated summary statement of profit and loss
` in Million
Particulars Annexures For the year ending March 31
2014 2013 2012 2011 2010
Income
Revenue from operations XXVI 1,194.10 1,164.08 911.70 852.23 845.29
Other income XXVII 52.38 191.15 110.04 86.64 67.60
Total Revenue 1,246.48 1,355.23 1,021.74 938.87 912.89
Expenses
Purchases of traded goods XXVIII 117.41 103.34 52.56 28.52 37.20
(Increase) in inventory of traded goods XXIX (9.37) (11.78) (12.50) - -
Cost of services XXX 477.07 487.41 378.14 362.62 365.80
Employee benefits expense XXXI 220.58 196.41 184.68 141.94 149.62
Finance costs XXXII 44.13 59.07 40.61 31.41 16.08
Depreciation and amortisation expenses XXXIII 37.48 37.21 28.27 22.03 19.13
Other expenses XXXIV 305.70 380.70 245.19 209.15 232.33
Total expenses 1,193.00 1,252.36 916.95 795.67 820.16
Restated profit before exceptional expenses and tax 53.48 102.87 104.79 143.20 92.73
Exceptional expenses XLVIII 15.49 - 196.62 17.13 -
Restated profit/(loss) before tax 37.99 102.87 (91.83) 126.07 92.73
Income tax expense:
- Current tax 7.67 - 7.28 45.34 25.94
- Minimum alternate tax ('MAT') credit (7.67) - (7.28) - -
- Deferred tax charge/(benefit) IX 13.51 37.62 (33.82) (2.81) 7.53
Total tax expenses 13.51 37.62 (33.82) 42.53 33.47
Restated net profit/(loss) after tax 24.48 65.25 (58.01) 83.54 59.26
Footnotes:
1) The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and loss and
cash flow.
2) Refer Annexure IV(2) for material adjustments.
This is the restated summary statement of profit and loss referred to in our report of even date.
CL Educate Limited
Annexure III - Restated summary statement of cash flow
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Adjustments for:
Depreciation and amortisation on fixed assets 37.48 37.23 28.28 22.03 19.13
Depreciation and amortisation on Investments property 0.21 0.21 0.21 - -
Finance costs (except loan processing charges) 42.56 52.13 39.38 31.41 14.07
Loan processing charges 1.54 6.16 1.21 - 1.99
Interest income (28.59) (32.18) (47.51) (32.27) (16.11)
Loss/(Profit) on sale of fixed assets - (0.13) 0.13 (2.01) -
(Profit) on sale of investments - - - - (7.68)
Rent income on investments property (0.29) (0.60) (0.80) - (1.76)
Fixed assets written off 0.68 0.61 1.07 - 1.70
Advances written off 0.51 120.02 0.04 2.63 0.04
Bad debts written off 39.00 31.90 40.90 26.35 11.95
Deposits written off - 0.39 - - 0.21
Miscellaneous balances written off 1.62 2.40 1.41 0.11 0.67
Provision for doubtful advances 0.34 2.00 - - -
Provision for impairment of investment - 0.07 - - -
Provision no longer required written back - (112.88) - - -
Liability no longer required written back (16.64) (31.58) (16.29) (2.14) (8.97)
Bad debts recovered (0.81) (0.57) (0.72) (0.53) (0.27)
Transfer to stock options outstanding 0.85 3.44 4.23 (0.46) 2.13
Exceptional non cash items: - - - - -
-Provision for doubtful advances - - 135.92 17.13 -
- Advances written off 15.49 - 60.70 - -
- Provision for impairment of investment - - 0.38 - -
Unrealised foreign exchange gain (1.53) (0.35) (5.43) (0.10) 0.56
Realised foreign exchange gain on sale of investment (0.24) - - - -
Operating profit before working capital changes 130.16 181.13 151.24 188.22 110.40
Cash generated from/(used in) operations 111.56 61.66 (43.23) 111.70 270.18
Net cash generated from/(used in) operating activities 104.78 55.52 (25.41) 67.26 239.67
CL Educate Limited
Annexure III - Restated summary statement of cash flow
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Net cash generated from/(used in) investing activities 1.94 (90.04) (156.56) (154.36) (124.36)
Net cash generated/(used in) from financing activities (91.47) 34.08 159.99 75.49 (90.72)
Net increase/(decrease) in cash and cash equivalents 15.25 (0.44) (21.98) (11.61) 24.59
Cash and cash equivalents at beginning of the year 19.68 19.98 41.47 53.08 28.49
Cash and cash equivalents at end of the year 34.93 19.68 19.98 41.47 53.08
continued to next page….
CL Educate Limited
Annexure III - Restated summary statement of cash flow
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Add:
Fixed deposits shown under other Cash and bank
balances
– Deposits with original maturity for more than 3 months 6.00 45.56 - - -
but less than 12 months from the reporting date
Footnotes:
1) The above restated summary statement of cash flows has been prepared under the 'Indirect Method' as set out in the
Accounting Standard - 3 on 'Cash Flow Statements' [notified under the Companies Act, 1956 read with General Circular 15/2013
dated September 13, 2013, issued by the Ministry of Corporate Affairs, in respect of Section 133 of the Companies Act, 2013].
2) The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and
loss and cash flow.
3) The above restated summary statement of cash flows has been compiled from and is based on the restated summary
statement of assets and liabilities as at March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011 and March 31, 2010
and the related restated summary statement of profit and loss for the years ended on that date.
4) Refer Annexure IV(2) for material adjustments.
This is the restated summary statement of cash flows referred to in our report of even date.
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
1. Corporate information
CL Educate Limited (‘the Company’) was incorporated in India on April 25, 1996 to conduct various
educational and consulting programmes.
The accompanying restated summary statement of assets and liabilities, profit and loss and cash flows
reflects results of activities undertaken by the Company during the period of 5 years ending March 31,
2014, March 31, 2013, March 31, 2012, March 31, 2011 and March 31, 2010.
The ‘Restated summary statement of the assets and liabilities’ of the Company as at March 31, 2014,
2013, 2012, 2011 and 2010, the ‘Restated summary statement of profits and losses’ and the ‘Restated
statement of cash flows’ for the years ended March 31, 2014, 2013, 2012, 2011 and 2010 (collectively
referred to as ‘Restated Summary Statements’) have been prepared specifically and solely for the
purpose of inclusion in the offer document to be filed by the Company with the Securities and
Exchange Board of India (‘SEBI’) in connection with the proposed Initial Public Offering of the equity
shares of the Company (hereinafter referred to as ("IPO").
The Restated Summary Statements have been prepared to comply with the Accounting Standards
notified under section 211 (3C) of the Companies Act, 1956 read with the General Circular 15/2013
dated 13 September 2013 of the Ministry of Corporate Affairs in respect of section 133 of the
Companies Act, 2013 (‘the Act’). The restated summary statements have been prepared on a going
concern basis under the historical cost convention on accrual basis.
The Restated Summary Statements of the Company have been prepared to comply in all material
respects with the requirements of Part I of Chapter III to the Companies Act, 2013 and Securities and
Exchange Board of India (Issue of Capital and Disclosure Requirements) Regulations, 2009 issued by
SEBI, as amended from time to time.
These Restated Summary Statements and other financial information have been prepared after
incorporating:
(a) Adjustments for the material amounts in respective years to which they relate.
(b) Adjustments for reclassification of the corresponding items of income, expenses, assets and
liabilities, in order to bring them in line with the groupings as per the audited financial
statements of the Company as at and for the year ended 31 March 2014 (prepared in accordance
with Revised Schedule VI of the Company’s Act, 1956) and the requirements of the SEBI
Regulations.
These Restated Summary Financial Statements and Other Financial Information were approved by the
Board of Directors on September 22, 2014.
The preparation of financial statements in conformity with Generally Accepted Accounting Principles
requires management to make judgements, estimates and assumptions that affect the reported
amounts of assets, liabilities and contingent liabilities at the reported date and the reported amounts
of revenues and expenses during the reporting period. Although these estimates are based on the
managements’ best knowledge of current events and actions, actual results could differ from these
estimates and will be accounted for accordingly in the relevant period.
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
Revenue is recognised to the extent that it is probable that the economic benefit will flow to the
Company and revenue can be reliably measured.
Educational and training businesses of the Company include revenue from services and sales of text
books.
Revenue in respect of educational and training fees received from students is recognised on time
basis over the period of the course. Fees are recorded at invoice value excluding taxes and net of
discounts and taxes, if any.
Revenue in respect of vocational training is recognised over the period of the training period.
However, taking into account the uncertainty involved in conditions to be fulfilled under the terms of
the contract, portion of such revenue depending upon such uncertainty is deferred till the fulfilment
of conditions of the contract.
Sale of text books for full course is recognised at the time of receipt of first payment on account of
test preparation services provided by the Company and is exclusive of taxes, if any, and is the net of
discounts.
- Revenue in respect of one-time license fee received from the franchisees is recognised on
execution of the contract.
- Revenue from licensing of content given for a long term period and dependent on percentage of
revenue earned by the licensee is recognised as and when the right to receive payment is
established.
- Revenue from consultancy services and seminar and alliance income is recognised as and when
services are actually rendered.
- Revenue from advertising income is recognised on percentage completion basis as per the
terms of agreement.
- Revenue from infrastructure fees is recognised on the basis of time period over the period of
contract.
- Revenue from royalty is recognised on an accrual basis in accordance with the terms of the
relevant agreement.
- Revenue from campus placement is recognised upon provision of services as per the terms of
agreement.
Grant income
Government grants available to the Company are recognised when both the following conditions are
satisfied:
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
(a) where there is reasonable assurance that the Company will comply with the conditions attached
to them; and
(b) where such benefits have been earned by the Company and it is reasonably certain that the
ultimate collection will be made.
Grants related to specific fixed assets are shown as a deduction from the gross value of the asset
concerned in arriving at its book value. The grant is thus recognised in the restated summary
statement of profit and loss over the useful life of a depreciable asset by way of a reduced
depreciation charge. Where the grant equals the whole, or virtually the whole, of the cost of the
asset, the asset is shown in the Restated summary statement of assets and liabilities at a nominal
value. Grants for various government projects carried out by the Company are disclosed in other
operating income as grant income.
Unbilled revenue
Unbilled revenue, included in other current assets, represents amounts recognised based on services
performed in advance of billing in accordance with service terms.
Unearned revenue
Amounts billed and received or recoverable prior to the reporting date for services to be performed
after the reporting date are recorded as unearned revenue in other current liabilities.
Interest
Revenue from interest on time deposits and inter-corporate loans is recognised on the time
proportion method taking into consideration the amount outstanding and the applicable interest
rates.
Rent income
Dividend
Dividends income is recognised when the right to receive the same is established.
Tangible assets
Tangible fixed assets are stated at cost of acquisition net of recoverable taxes (wherever applicable),
less accumulated depreciation and impairment losses, if any. Cost comprises the purchase price, non
refundable taxes and any cost directly attributable to bringing the assets to its working condition for
its intended use. Trade discounts and rebates are deducted in arriving at the purchase price.
Subsequent expenditure related to an item of fixed asset is added to its book value only if it
increases the future benefits from the existing asset beyond its previously assessed standard of
performance. All other expenses on existing fixed assets, including day to day repair and
maintenance and cost of replacing parts, are charged to the restated summary statement of profit
and loss for the period during which such expenses are incurred.
Fixed assets retired from active use and held for disposal are stated at lower of book value and net
realisable value as estimated by the Company and are shown separately in the financial statements
under other current assets. Loss determined, if any, is recognised immediately in the restated
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
summary statement of profit and loss, whereas profit and sale of such assets is recognised only upon
completion of sale thereof.
Intangible assets
An intangible asset is recognized when it is probable that the future economic benefits attributable
to the asset will flow to the enterprise and where its cost can be reliably measured. Intangible assets
are stated at cost of acquisition less accumulated amortisation and accumulated impairment losses, if
any. Cost comprises the purchase price and any cost attributable to bringing the assets to its working
condition for its intended use.
Gains or losses arising from retirement/disposal of an intangible asset are determined as the
difference between the net disposal proceeds and the carrying amount of asset and is recognised as
income or expense in the restated summary statement of profit and loss in the year in which the
asset is derecognised.
Capital work-in-progress
Capital work-in-progress comprises cost of acquired or self generated tangible\intangible fixed assets
that are not yet ready for their intended use at the balance sheet date. Capital work in progress is
stated at cost.
Depreciation and amortisation has been calculated on Straight Line Method at the following useful
lives, based on management estimates, which are equal to or higher than the rates specified as per
schedule XIV to the Act, which in the opinion of the management are reflective of the estimated
useful lives of fixed assets:
Depreciation and amortisation on addition to fixed assets is provided on pro-rata basis from the date
the assets are ready for intended use. Depreciation and amortisation on sale/discard from fixed
assets is provided for upto the date of sale, deduction or discard of fixed assets as the case may be.
All assets, except chairs, costing ₹ 5,000 or below are depreciated in full by a one-time depreciation
charge unless used as project assets under infrastructure projects. Chairs costing ₹ 5,000 or below are
charged to the restated summary statement of profit and loss on the date of their acquisition.
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
The carrying amounts of assets are reviewed at each Restated summary statement of assets and
liabilities date to determine if there is any indication of impairment based on internal/external
factors. An impairment loss is recognised wherever the carrying amount of an asset exceeds its
recoverable amount. The recoverable amount is the greater of the asset’s net selling price and value
in use. In assessing value in use, the estimated future cash flows are discounted to their present value
at the weighted average cost of capital.
After impairment, depreciation/amortisation is provided on the revised carrying amount of the asset
over its remaining useful life.
Borrowing cost includes interest, amortisation of ancillary costs incurred in connection with the
arrangement of borrowings.
(viii) Leases:
Finance leases, which effectively transfer to the Company substantially all the risks and benefits
incidental to ownership of the leased item, are capitalized at the inception of the lease term at the
lower of the fair value of the leased property and present value of minimum lease payments. Lease
payments are apportioned between the finance charges and reduction of the lease liability so as to
achieve a constant rate of interest on the remaining balance of the liability. Finance charges are
recognised as finance costs in the restated summary statement of profit and loss. Lease management
fees, legal charges and other initial direct costs of lease are capitalised.
A leased asset is depreciated on a straight-line basis over the useful life of the asset as determined by
the management or the useful life envisaged in Schedule XIV to the Act, whichever is lower. However,
if there is no reasonable certainty that the Company will obtain the ownership by the end of the lease
term, the capitalised asset is depreciated on a straight-line basis over the shorter of the estimated
useful life of the asset, the lease term and the useful life envisaged in Schedule XIV to the Act.
Leases, where the lessor effectively retains substantially all the risks and benefits of ownership of the
leased item, are classified as operating leases. Operating lease payments are recognised as an
expense in the restated summary statement of profit and loss on a straight-line basis over the lease
term.
Leases in which the Company transfers substantially all the risks and benefits of ownership of the
asset are classified as finance leases. Assets given under finance lease are recognised as a receivable
at an amount equal to the net investment in the lease. After initial recognition, the Company
apportions lease rentals between the principal repayment and interest income so as to achieve a
constant periodic rate of return on the net investment outstanding in respect of the finance lease.
The interest income is recognised in the restated summary statement of profit and loss. Initial direct
costs such as legal costs, brokerage costs, etc. are recognised immediately in the restated summary
statement of profit and loss.
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
Leases in which the Company does not transfer substantially all the risks and benefits of ownership of
the asset are classified as operating leases. Assets subject to operating leases are included in fixed
assets. Lease income on an operating lease is recognised in the restated summary statement of profit
and loss on a straight-line basis over the lease term. Costs, including depreciation, are recognised as
an expense in the restated summary statement of profit and loss. Initial direct costs such as legal
costs, brokerage costs, etc. are recognised immediately in the restated summary statement of profit
and loss.
An investment in land or buildings, which is not intended to be occupied substantially for use by, or in
the operations of, the Company, is classified as investment property. Investment properties are
stated at cost, net of accumulated depreciation and accumulated impairment losses, if any.
The cost comprises purchase price and directly attributable cost of bringing the investment property
to its working condition for the intended use. Any trade discounts and rebates are deducted in
arriving at the purchase price.
On disposal of an investment, the difference between its carrying amount and net disposal proceeds
is charged or credited to the restated summary statement of profit and loss.
Accounting treatment
Investments, which are readily realisable and intended to be held for not more than one year from the
date on which such investments are made, are classified as current investments. All other investments
are classified as long-term investments.
On initial recognition, all investments are measured at cost. The cost comprises purchase price and
directly attributable acquisition charges such as brokerage, fees and duties. If an investment is
acquired, or partly acquired, by issue of shares or other securities, the acquisition cost is the fair value
of the securities issued. If an investment is acquired in exchange for another asset, the acquisition is
determined by reference to the fair value of the asset given up or by reference to the fair value of the
investment acquired, whichever is more clearly evident.
Current investments are carried in the financial statements at lower of cost and fair value determined
on an individual investment basis. Long-term investments are carried at cost. However, provision for
diminution in value is made to recognise a decline other than temporary in the value of long term
investments on individual investment basis.
On disposal of an investment, the difference between its carrying amount and net disposal proceeds is
charged or credited to the restated summary statement of profit and loss.
Investments that are realisable within the period of twelve months from the restated summary statement
of assets and liabilities date are classified as current investment. All other investments are classified as
non-current investments.
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
(xi) Inventories
Inventories comprising traded goods are valued at the lower of cost and net realisable value. Cost
comprises all costs of purchases and other costs incurred in bringing the inventory to their present
location and condition. Cost is determined on first in first out basis. Net realisable value is the estimated
selling price in the ordinary course of business, less estimated costs of completion and estimated costs
necessary to make the sale. The comparison of cost and net realisable value is made on individual item
basis.
All employee benefits payable wholly within twelve months of rendering the service are classified as
short term employee benefits. Benefits such as salaries, wages, and bonus etc are recognised in the
restated summary statement of profit and loss in the period in which the employee renders the
related service.
All employees of the Company are entitled to receive benefits under the Provident Fund, which is a
defined contribution plan. Both the employee and the employer make monthly contributions to the
plan at a predetermined rate as per the provisions of The Employees Provident Fund and
Miscellaneous Provisions Act, 1952. These contributions are made to the fund administered and
managed by the Government of India.
Employees whose wages/salary are within the prescribed limit in accordance with the Employee State
Insurance Act, 1948, are covered under this scheme. These contributions are made to the fund administered
and managed by the Government of India.
The Company's contributions to these schemes are expensed off in the restated summary statement
of profit and loss. The Company has no further obligations under these plans beyond its monthly
contributions.
The Company provides for retirement benefits in the form of Gratuity. Benefits payable to eligible
employees of the company with respect to gratuity, a defined benefit plan is accounted for on the basis
of an actuarial valuation as at the restated summary statement of assets and liabilities date. In
accordance with the Payment of Gratuity Act, 1972, the plan provides for lump sum payments to vested
employees on retirement, death while in service or on termination of employment in an amount
equivalent to 15 days basic salary for each completed year of service. Vesting occurs upon completion of
five years of service. The present value of such obligation is determined by the projected unit credit
method and adjusted for past service cost and fair value of plan assets as at the restated summary
statement of assets and liabilities date through which the obligations are to be settled. The resultant
actuarial gain or loss on change in present value of the defined benefit obligation or change in return of
the plan assets is recognised as an income or expense in the restated summary statement of profit and
loss. The expected return on plan assets is based on the assumed rate of return of such assets. The
Company contributes to a trust set up by the Company which further contributes to a policy taken from
the Life Insurance Corporation of India.
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
Benefits under the Company’s leave encashment scheme constitute other employee benefits. The
liability in respect of leave encashment is provided on the basis of an actuarial valuation done by an
independent actuary at the end of the year. Actuarial gain and losses are recognised immediately in
the restated summary statement of profit and loss.
The Employee Stock Option Scheme (‘the Scheme’) provides for the grant of equity shares of the
Company to its employees. The Scheme provides that employees are granted an option to acquire
equity shares of the Company that vests in a graded manner. The options may be exercised within a
specified period. The Company follows the fair value method to account for its stock-based employee
compensation plans. Compensation cost is measured using independent valuation by a firm of
Chartered Accountants using Black-Scholes model in accordance with the guidance note issued by the
Institute of Chartered Accountants of India. Compensation cost, if any is amortised over the vesting
period.
Transactions in foreign currency are recorded at the exchange rate prevailing at the date of the
transaction. Exchange differences arising on foreign currency transactions settled during the year are
recognized in the restated summary statement of profit and loss.
Monetary assets and liabilities denominated in foreign currencies as at the restated summary statement
of assets and liabilities date, not covered by forward exchange contracts, are translated at year end
rates. The resultant exchange differences are recognized in the restated summary statement of profit
and loss. Non-monetary assets and liabilities are recorded at the rates prevailing on the date of the
transaction.
The financial statements of an integral foreign operation are translated as if the transactions of the
foreign operations have been those of the Company itself.
In case of a non-integral foreign operation, the assets and liabilities (except share capital which is taken
at historical cost) both monetary and non-monetary, of the non-integral foreign operation are translated
at the closing rate. Income and expense items of the non-integral foreign operation are translated at
average rates at the date of transaction. All resulting exchange differences are accumulated in a foreign
currency translation reserve until the disposal of the net investment, at which time the accumulated
amount is recognized as income or as expense.
When there is a change in the classification of a foreign operation, the translation procedures applicable
to the revised classifications are applied from the date of the change in the classified.
(xiv) Taxation
Tax expense for the year comprising current tax, deferred tax charge or benefit and MAT credit
entitlement is included in determining the net profit for the year.
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
Current tax
Current income tax is measured at the amount expected to be paid to the tax authorities in
accordance with the Indian Income Tax Act, 1961.
Deferred tax
Deferred tax charge or credit reflects the tax effects of timing differences between accounting
income and taxable income for the period. The deferred tax charge or credit and the corresponding
deferred tax liabilities or assets are recognised using the tax rates that have been enacted or
substantively enacted by the restated summary statement of assets and liabilities date. Deferred tax
assets are recognised only to the extent there is reasonable certainty that the assets can be realized
in future; however, where there is unabsorbed depreciation or carry forward of losses, deferred tax
assets are recognised only if there is a virtual certainty backed by convincing evidence of realisation
of such assets. Deferred tax assets are reviewed at each Restated summary statement of assets and
liabilities date and are written-down or written-up to reflect the amount that is reasonably / virtually
certain (as the case may be) to be realised.
The break-up of the major components of the deferred tax assets and liabilities as at Restated
summary statement of assets and liabilities date has been arrived at after setting off deferred tax
assets and liabilities where the entity has a legally enforceable right to set-off assets against
liabilities and where such assets and liabilities relate to taxes on income levied by the same governing
taxation laws.
Minimum alternate tax (MAT) under the Income Tax Act, 1961, payable for the year is charged to the
restated summary statement of profit and loss as current tax. The company recognizes MAT credit
available as an asset only to the extent that there is convincing evidence that the Company will pay
normal income tax during the specified period, i.e., the period for which MAT credit is allowed to be
carried forward. In the year in which the Company recognizes MAT credit as an asset in accordance with
the Guidance Note on accounting for credit available in respect of Minimum Alternative Tax under the
Income-tax Act, 1961, the said asset is created by way of credit to the restated summary statement of
profit and loss and shown as “MAT Credit Entitlement.” The Company reviews the “MAT credit
entitlement” asset at each reporting date and writes down the asset to the extent the Company does
not have convincing evidence that it will pay normal tax during the specified period.
Provision
The Company creates a provision when there is present obligation as a result of a past event that
probably requires an outflow of resources and a reliable estimate can be made of the amount of
obligation.
Contingent liabilities
A disclosure for a contingent liability is made when there is a possible obligation or a present
obligation that probably will not require an outflow of resources or where a reliable estimate of the
obligation cannot be made.
Contingent assets
Contingent assets are neither recorded nor disclosed in the financial statements.
CL Educate Limited
Annexures to restated summary statements of assets and liabilities, profit and loss and cash flows
Annexure IV (1) – Restated summary statement of significant accounting policies
Cash and cash equivalents include cash in hand, demand deposits with banks, other short term highly
liquid investments with original maturities of three months or less.
(xvii) Exceptional items
Items of income or expense from ordinary activities which are of such size, nature or incidence that,
their disclosure is relevant to explain the performance of the enterprise for the period, are disclosed
separately in the restated summary statement of profit and loss.
Basic earnings per share are calculated by dividing the net profit or loss for the year attributable to
equity shareholders by the weighted average number of equity shares outstanding during the year.
The weighted average numbers of equity shares outstanding during the year are adjusted for events
such as bonus issue, share split or consolidation of shares.
For calculating diluted earnings per share, the net profit or loss for the year attributable to equity
shareholders and the weighted average number of shares outstanding during the year are adjusted for
the effects of all dilutive potential equity shares. The dilutive potential equity shares are deemed
converted into equity shares as at the beginning of the year, unless they have been issued at a later
date.
The Company identifies primary segments based on the dominant source, nature of risks and returns and
the internal organisation and management structure. The operating segments are the segments for
which separate financial information is available and for which operating profit/loss amounts are
evaluated regularly by the executive Management in deciding how to allocate resources and in assessing
performance.
'The accounting policies adopted for segment reporting are in line with the accounting policies of the
Company. Segment revenue, segment expenses, segment assets and segment liabilities have been
identified to segments on the basis of their relationship to the operating activities of the segment.
Inter-segment revenue is accounted on the basis of transactions which are primarily determined based
on market / fair value factors.
Revenue, expenses, assets and liabilities which relate to the Company as a whole and are not allocable
to segments on reasonable basis have been included under “unallocated revenue / expenses / assets /
liabilities”.
Share issue expenses are adjusted against the securities premium account as permissible under Section
78 of the Act, to the extent balance is available for utilization in the securities premium account. The
balance of share issue expenses in excess of securities premium account, if any, are charged to restated
summary statement of profit and loss.
Material events occurring after the restated summary statement of assets and liabilities date are
taken into cognizance.
CL Educate Limited
Annexure IV(2) -Restated summary statement of material adjustments
Summary of results of restated audited statement of company for the respective years on (loss)/profit of the Company
` in Million
Particulars For the Year ending March 31 Adjustments in Surplus
2014 2013 2012 2011 2010 in the statements of
profit and loss as at
March 31, 2009
A) Net profit/(loss) after tax as per audited 17.49 58.87 (56.29) 75.01 60.79
financials statements
B) Adjustments
Recognition of interest income on loan given to 10.33 7.18 7.02 - -
related party
Adjustment due to provision of expenses pertaining 0.48 2.55 (5.44) 2.41 -
to earlier years
Adjustment due to correction in ESOP Expenses - - 1.67 0.46 (2.13)
Adjustment due to capitalization of asset and its (6.84) 0.84 1.32 1.80 2.88
amortisation pertaining to earlier years
Adjustment due to change in provision of (0.05) (0.02) - (0.04) -
independent director remuneration
Total adjustments before tax 10.76 2.87 4.09 4.14 -.33 2.88
Restated profit/(loss) before tax adjustments 28.25 61.74 (52.20) 79.15 60.46 145.43
Restated profit/(loss) after tax adjustments 24.49 65.23 (58.04) 83.54 59.28 142.06
Footnotes:
1) Recognition of interest income on loan given to related party
The Company has given interest free unsecured loans to its related parties in the financial years ending on March 31, 2014, March 31,
2013 and March 31, 2012. The Company has not recognised interest income on such loans in the Statement of Profit and Loss of the
respective years. The Company has now recognised interest income on said loans at the interest rate of 14.50% per annum considering
the average rate of interest paid by it on the various loans availed by it from banks.
` in Million
Company Name Interest Amount
CL Educate Limited
Annexure IV(2) -Restated summary statement of material adjustments
For the purpose of the restated summary statements, such revenue for interest income has been appropriately adjusted in the
respective years to which the transactions pertains to.
During the financial year ended March 31, 2008, the Company has introduced "Employees Stock Option Plan 2008 (CL ESOP - 2008)"
which provides for the issue of 250,000 stock options to directors and employees the Company. The Company had 157,796 and
159,456 options outstanding to directors and employees in the financial years ending March 31, 2011 and March 2010 respectively. The
Company has not valued the outstanding options and accordingly has not recorded expenses of INR 2.13 million and (0.46) million in
the statement of profit and loss of years ending March 31, 2011 and March 31, 2010 respectively.
For the purpose of the restated summary statements, such expenses has been appropriately adjusted in the respective years to which
the transactions pertain to.
The Company pays commission to independent directors' at a certain percentage of net profit of the relevant financial year. The
amount payable to independent directors have been recomputed based on the restated profits of the respective financial years.
For the purpose of the restated summary statements, such provision for expenses have been appropriately adjusted in the respective
years to which the transactions pertain to.
Company had recorded various prior period income/ Expenses due to short/excess in providing provision for expenses during various
relevant financial years
For the purpose of the restated summary statements, such provision for expenses has been appropriately adjusted in the respective
years to which the transactions pertain to.
5) Adjustment due to capitalization of asset & its amortisation pertaining to earlier years
Company had entered into a contract with its subsidiary CL media private limited during earlier years for purchase of content
developed and maintained by it. Before financial year 2012-13 company used to expense off related amount in its financials. However
during financial year 2012-13 the said amount was capitalized and relevant adjustment was given in prior period income/expense.
For the purpose of the restated summary statements, such expenses/fixed asset has been appropriately adjusted in the respective
years to which the transactions pertain to.
CL Educate Limited
Annexure V - Restated summary statement of share capital
` in Million
Particulars As at March 31, 2014 As at March 31, 2013 As at March 31, 2012 As at March 31, 2011 As at March 31, 2010
Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions
Authorised
Equity shares of ₹ 10 each with equal voting 13,000,000 130.00 13,000,000 130.00 13,000,000 130.00 13,000,000 130.00 13,000,000 130.00
rights
Preference shares of ₹ 10 each 2,000,000 20.00 2,000,000 20.00 2,000,000 20.00 2,000,000 20.00 2,000,000 20.00
Issued, subscribed and fully paid up - - - -
Equity shares of ₹ 10 each with equal voting 9,417,810 94.18 9,417,810 94.18 9,334,706 93.35 8,749,003 87.49 8,749,003 87.49
rights (Class -I)
Compulsorily convertible 0.01% non 411,045 4.11 411,045 4.11 - - - - - -
cumulative preference shares (CCPS) of ₹10
each (Class -II)
Optionally convertible 0.01% non cumulative 88,955 0.89 88,955 0.89 - - - -
preference shares (OCPS) of ₹10 each (Class -
III)
Compulsorily convertible 0.01% non - - - - - - 686,245 6.86 - -
cumulative preference shares (CCPS) of ₹10
each (Class -IV)
Total issued, subscribed and fully paid-up 9,917,810 99.18 9,917,810 99.18 9,334,706 93.35 9,435,248 94.35 8,749,003 87.49
share Capital
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The Company has four classes of shares i.e. equity shares (Class-I), compulsorily convertible 0.01% non cumulative preference shares (CCPS)(Class -II), optionally convertible 0.01% non
cumulative preference shares (OCPS)(Class- III) and compulsorily convertible 0.01% non cumulative preference shares (CCPS) (Class -IV). Each class of shares is having a par value of ₹ 10 per
share.
3) Terms/rights attached to shares
A) Voting
1) Class-I shares-Equity shares: Each holder of this class of shares is entitled to one vote per share held.
2) Class-II shares-CCPS: This class of shares do not carry any voting rights.
3) Class-III shares-OCPS: This class of shares do not carry any voting rights.
4) Class-IV shares-CCPS: This class of shares do not carry any voting rights.
B) Dividends
1) Class-I shares-Equity shares: The Company declares and pays dividend in Indian rupees. The dividend proposed by the Board of Directors is subject to approval of the shareholders in ensuing
Annual General Meeting except in the case where interim dividend is distributed.
2) Class-II shares-CCPS: The Company declares and pays dividend in Indian rupees. CCPS has preferential right of dividend over equity shares in event of declaration of dividend. These shares
carry dividend rate of 0.01%. The dividend is payable only when the Company declares dividend during a particular financial year.
3) Class-III shares-OCPS: The Company declares and pays dividend in Indian rupees. OCPS has preferential right of dividend over equity shares in event of declaration of dividend. These shares
carry dividend rate of 0.01%. The dividend is payable only when the Company declares dividend during a particular financial year.
4) Class-IV shares-CCPS: The Company declares and pays dividend in Indian rupees. CCPS has preferential right of dividend over equity shares in event of declaration of dividend. These shares
carry dividend rate of 0.01%. The dividend is payable only when the company declares dividend during a particular financial year.
CL Educate Limited
Annexure V - Restated summary statement of share capital
4) Reconciliation of shares outstanding as at the beginning and at the end of the reporting period
Particulars March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions
At the beginning of year 9,417,810 94.18 9,334,706 93.35 8,749,003 87.49 8,749,003 87.49 8,743,003 87.43
Add: Share issued during the year by way of: - - - - - -
-Allotment of share for a consideration - - 83,104 0.83 - - - - 6,000 0.06
otherwise than in cash
- Employee stock option plan - - - - 4,775 0.05 - - - -
-conversion of Compulsorily convertible - - - - 580,928 5.81 - - - -
0.01% non cumulative preference shares
(CCPS) of ₹10 each (previous year ₹10)
(Class -IV)
Outstanding at the end of the year 9,417,810 94.18 9,417,810 94.18 9,334,706 93.35 8,749,003 87.49 8,749,003 87.49
B) Class-II shares-CCPS
Particulars March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions
At the beginning of the year 411,045 4.11 - - - - - - - -
Add: Share issued during the year - - 411,045 4.11 - - - - - -
Outstanding at the end of the year 411,045 4.11 411,045 4.11 - - - - - -
C) Class-III shares-OCPS
Particulars March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions
At the beginning of the year 88,955 0.89 - - - - - - - -
Add: Share issued during the year - - 88,955 0.89 - - - - - -
Outstanding at the end of the year 88,955 0.89 88,955 0.89 - - - - - -
D) Class-IV shares-CCPS
Particulars March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions Numbers ₹ in Millions
CL Educate Limited
Annexure V - Restated summary statement of share capital
5) Shares held by the holding company/ultimate holding company and/or their associates/ subsidiaries and shareholders holding more than 5% shares in the Company.
Name of share holders March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Numbers % held Numbers % held Numbers % held Numbers % held Numbers % held
Mr. Gautam Puri 2,549,186 27.07% 2,549,186 27.07% 2,549,186 27.31% 2,549,186 29.14% 2,549,186 29.14%
Mr. Satya Narayanan R 2,549,186 27.07% 2,549,186 27.07% 2,549,186 27.31% 2,549,186 29.14% 2,549,186 29.14%
Bilakes Consulting Private Limited 786,859 8.36% 786,859 8.36% 786,859 8.43% 786,859 8.99% 786,859 8.99%
GPE (India) Limited 765,747 8.13% 765,747 8.13% 765,747 8.20% 575,807 6.58% 575,807 6.58%
Mr. Sreenivasan R 449,698 4.77% 449,698 4.77% 449,698 4.82% 449,698 5.14% 449,698 5.14%
Mr. Shivakumar R 449,698 4.77% 449,698 4.77% 449,698 4.82% 449,698 5.14% 449,698 5.14%
7,550,374 80.17% 7,550,374 80.17% 7,550,374 80.89% 7,360,434 84.13% 7,360,434 84.13%
B) Class-II shares-CCPS
Name of share holders March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Numbers % held Numbers % held Numbers % held Numbers % held Numbers % held
GPE (India) Limited 411,045 100.00% 411,045 100.00% - - - - - -
411,045 100.00% 411,045 100.00% - - - - - -
As per records of the Company, including its register of shareholders/members, the above shareholding represents both legal and beneficial ownerships of shares.
C) Class-III shares-OCPS
Name of share holders March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Numbers % held Numbers % held Numbers % held Numbers % held Numbers % held
Gaja Trustee Company Private Limited 88,955 100.00% 88,955 100.00% - - - - - -
88,955 100.00% 88,955 100.00% - - - - - -
As per records of the Company, including its register of shareholders/members, the above shareholding represents both legal and beneficial ownerships of shares.
CL Educate Limited
Annexure V - Restated summary statement of share capital
6) Cumulative number of shares issued for consideration other than cash during the preceding five years and outstanding as at the end of each year:
Particulars As at March 31
2014 2013 2012 2011 2010
Equity shares allotted as fully paid-up 670,032 670,032 636,928 56,000 56,000
pursuant to contracts for consideration other
than cash
Total 670,032 670,032 636,928 56,000 56,000
In addition, the Company has issued 4,775 equity shares of ₹ 10 each fully paid up during the period of five years on exercise of options granted under the employee stock option plans wherein
part consideration was received in form of employee services.
7) No class of shares have been bought back by the Company during the period of five years.
The Company has one stock option plan. Employee stock options are convertible into equity shares in accordance with the respective employees’ stock option plan.
Pursuant to the resolution passed by the Board of Directors at its meeting on March 6, 2008 and the Special Resolution passed by the members in the EGM held on March 31, 2008, the Company
introduced “Career Launcher Employee Options Plan 2008” which provides for the issue of 250,000 equity shares to employees of the Company and its subsidiaries. All the above options granted
are planned to be settled in equity at the time of exercise and have maximum vesting period of 3 years from the date of respective grants. As at March 31, 2014 March 31, 2013, March 31, 2012,
March 31, 2011 and March 31, 2010 the Company had 56,143; 66,268; 35,032; 72,532 and 54,520 number of shares reserved for issue under the scheme respectively.
Pursuant to the Special Resolution passed by the members in the extraordinary general meeting held on May 29, 2013, and the resolution passed by the Board of Directors at its meeting on
January 28, 2014 the Company renewed “Career Launcher Employee Stock Options Plan 2008” for a further period of one year i.e. May 30, 2014 and March 31, 2015 respectively.
CL Educate Limited
Annexure V - Restated summary statement of share capital (contd.)
C) Liquidation
1) Class-I shares-Equity shares: In the event of liquidation of the Company, the holders of equity shares shall be entitled to
receive all of the remaining assets of the Company, after distribution of all preferential amounts, if any. Such distribution
amounts will be in proportion to the number of equity shares held by the shareholders.
2) Class-II shares-CCPS: In the event of liquidation of the Company, the holders of CCPS shall be entitled to receive all of
the remaining assets of the Company, after distribution of all preferential amounts, if any and before payment to equity
shareholders. Such distribution amounts will be in proportion to the number of CCPS held by the shareholders upto the
extent of agreed conversion amount of such shares.
3) Class-III shares-OCPS: In the event of liquidation of the Company, the holders of OCPS shall be entitled to receive all of
the remaining assets of the Company, after distribution of all preferential amounts, if any and before payment to equity
shareholders. Such distribution amounts will be in proportion to the number of OCPS held by the shareholders upto the
extent of agreed redemption/conversion amount of such shares.
4) Class-IV shares-CCPS: In the event of liquidation of the Company, the holders of CCPS shall be entitled to receive all of
the remaining assets of the Company, after distribution of all preferential amounts and before payment to equity
shareholders, if any. Such distribution amounts will be in proportion to the number of CCPS held by the shareholders upto
the extent of agreed conversion amount of such shares.
If the Consolidated audited EBITDA of the Company for the year ended March 31, 2013 is less than ₹ 360.00 million or if
audited consolidated financial statements are not made available to shareholder by September 30, 2013, shareholder shall
have right, exercisable at its sole discretion at any time by written notice to the Company and the founders and the
Company, to require the Company to convert all of their shareholding as Class-II shares-CCPS into such number of equity
shares that ensures shareholder an internal rate of return of 15% on the investment amount calculated from the closing
date upto the date of such conversion.Founders and the Company, jointly and severally undertake and agree to
shareholder, to procure third parties to acquire and purchase of all of the Class-II shares-CCPS held by shareholder at
conversion price arrived in accordance with the shareholder agreement. In event such purchase by third party doesn't
happen in 60 days of conversion, founders and the Company are jointly and severally liable to purchase the same at above
mentioned conversion price 3)
CL Educate Limited
Annexure V - Restated summary statement of share capital (contd.)
If for any reason whatsoever under applicable laws the Company is unable to undertake the conversion, shareholder shall
have the right to seek the conversion of these shares at a price per equity share of ₹ 425.If the Company subsequently
raises additional fund through issue of new shares at a price per share lower than above conversion price, the the following
conditions shall apply: i. If shareholder has already exercised its options under above then the founders shall procure the
Company to, and the Company shall take all reasonable steps to issue such number of additional equity shares to the
shareholder as if the Class-II shares-CCPS had converted at a price per share equal to the price per share of such new
shares. Such additional equity shares shall, subject to applicable laws be issued at no further cost to shareholder. ii. If
shareholder has not exercised its options under Conversion Price 1 and Conversion Price 2, then at shareholder's options,
CCPS may be converted into equity shares of the Company at a price per share equal to the price of such new share.
2) During the year ended March 31 2013, On December 14, 2012, 88,955 class-II, 0.01% OCPS of ₹10 each. Each share holder
of OCPS has to get his share converted into equity share or redeemed in cash as per price of conversion mentioned in
conditions at any time. Conversion option available to shareholder's were 1) If Company raises additional funds of a
minimum of ₹100.00 million through the issue of new shares within a period of 90 days i.e. Feb 7, 2013 from the closing
date i.e. November 9, 2012, the OCPS shall be converted into equity shares at a price per share equal to the price per
share of the new shares so issued in a manner to yield an IRR of 15% per annum, calculated on daily basis for the period
from the closing date till the date on which the New Shares are so issued.2) If the Company does not raise additional funds
within 90 days from the closing date or if the Company raises additional funds of less than ₹100.00 million through the issue
of new shares within a period of 90 business days from the closing date, the OCPS shall be converted into equity shares at a
price per share based on aggregate equity valuation of such fund raised of less than ₹100.00 million or 12.5 multiplied by
the EBITDA as per audited consolidated financial statements of the Company and its subsidiaries for the twelve month
period ended March 31, 2013, whichever is lower.
If the Consolidated audited EBITDA of the Company for the year ended March 31, 2013 is less than ₹ 360.00 million or if
audited consolidated financial statements are not made available to shareholder by September 30, 2013, shareholder shall
have right, exercisable at its sole discretion at any time by written notice to the Company and the founders and the
Company, to require the Company, to redeem all of their shareholding as Class-III shares-OCPS at a price that ensures
shareholder an internal rate of return of 15% on the investment amount calculated from the closing date upto the date of
such redemption. Founders and the Company, jointly and severally undertake and agree to shareholder, to procure third
parties to acquire and purchase of all of the Class-III shares-OCPS held by shareholder at conversion price arrived in
accordance with shareholder agreement. In event such purchase by third party doesn't happen in 60 days of conversion,
founders and the Company are jointly and severally liable to purchase the same at above mentioned conversion price 3.
If for any reason whatsoever under applicable laws the Company is unable to undertake the conversion/redemption,
shareholder shall have the right to seek the conversion of these shares at a price per equity share of ₹ 425.If the Company
subsequently raises additional fund through issue of new shares at a price per share lower than above conversion price, the
the following conditions shall apply: i. If shareholder has already exercised its options under above then the founders shall
procure the Company to, and the Company shall take all reasonable steps to issue such number of additional equity shares
to shareholder as if the Class-III shares-OCPS had converted at a price per share equal to the price per share of such new
shares. Such additional equity shares shall, subject to applicable laws be issued at no further cost to shareholder. ii. If
shareholder has not exercised its options under Conversion Price 1 and Conversion Price 2, then at shareholder's options,
The Class-III shares-OCPS may be converted into equity shares of the Company at a price per share equal to the price of
such new share.
CL Educate Limited
Annexure V - Restated summary statement of share capital (contd.)
3) During the year ending March 31 2012 company issued 525,000 0.01% Class-IV shares-CCPS. Each share holder of these
CCPS had to get his share converted into equity share at the end of one year or the happening of Initial Public Offerings
(IPO) whichever is earlier. If any dividend is paid prior to the conversion of these CCPS, then the dividend on these shares
shall be payable based on the notional number of equity shares to be issued upon the conversion of these CCPS into equity
shares at ₹ 417 per share. The CCPS had to be adjusted for bonus, splits, rights and any other corporate actions applicable
to equity shares. These shares were converted into 251,796 equity shares of ₹ 10 each at a premium of ₹ 407 per share
during financial year 2011-12.
4) During the year ending March 31 2011 company had issued 686,245 0.01% Class-IV shares-CCPS. Each share holder of
these CCPS had to get his share converted into equity share at the end of one year or the happening of Initial Public
Offerings (IPO) whichever is earlier. If any dividend is paid prior to the conversion of these CCPS, then the dividend on
these shares shall be payable based on the notional number of equity shares to be issued upon the conversion of these CCPS
into equity shares at ₹ 417 per share. The CCPS had to be adjusted for bonus, splits, rights and any other corporate actions
applicable to equity shares. These shares were converted into 329,132 equity shares of ₹ 10 each at a premium of ₹ 407 per
share during financial year 2011-12.
9) Summary of significant changes in capital structure of the Company subsequent to March 31, 2014
a) Pursuant to a resolution passed by the Board of Directors in its meeting held on September 5, 2014, the Company has
increased its authorised equity share capital from `130.00 million to `160.00 million.
b) The Company has issued 12,917 and 10,569 equity shares of ` 10 each at a premium of ` 580 per share, on September 5,
2014 to former promoters of G.K. Publications Private Limited, Rakesh Mittal and Poonam Mittal respectively, pursuant to
investment agreement dated November 12, 2011 regarding acquisition of equity shares held by them in G.K.Publications
Private Limited.
c) Pursuant to Employee Stock Option Plan 2008 (CL ESOP -2008) the Company has issued 2,400 and 500 equity shares of ₹ 10
each to independent directors and employees respectively.
d) Pursuant to a resolution passed in the board meeting held on July 22, 2014, the Company on September 5, 2014 converted
411,045 class- II, 0.01% CCPS and 88,955 class- III, 0.01% OCPS of ₹ 10 each to 193,433 and 41,861 Class-I equity shares of ₹
10 each respectively on the basis of terms and conditions as stipulated in the agreements executed between the preference
shareholders and the Company.
e) Pursuant to a resolution passed in the board meeting held on August 11, 2014, the Company on September 5, 2014 swapped
its shares with the shareholders of its subsidiary, CLEIS in the share swap ratio of 2.10:1. The same has resulted in issue of
904,139 equity shares of ₹ 10 each of the Company against 1,898,684 equity shares of ₹ 10 each of CLEIS. The said shares
were issued at a premium of ₹ 580 per share. Now the Company holds 98.02% shares in CLEIS.
f) On September 5, 2014, the Company has issued 230,000 and 594,233 equity shares of ₹ 10 each at a premium of ` 580 per
share through preferential allotment of shares to GPE (India) Limited and HDFC Limited respectively.
g) On September 16, 2014, the Company has issued 237,293 equity shares of ₹ 10 each at a premium of ` 580 per share
through preferential allotment of shares to GPE (India) Limited.
10) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
11) The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and
loss and cash flow.
CL Educate Limited
Annexure VI - Restated summary statement of reserves and surplus
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
VI.A Securities premium account
Opening balance 693.70 567.53 459.54 338.95 336.91
(+) Share premium received/adjusted
-on issue of CCPS in cash - 16.90 99.74 130.39 -
-on issue of OCPS in cash - 78.10 - - -
-on issue of equity shares - 43.05 - - 2.04
-on conversion of CCPS in equity shares - - 6.30 - -
-on issue of ESOP - - 1.08 - -
-transfer from employee stock option outstanding account - - 0.87 - -
(-) Share issue expenses - (6.00) - (9.80) -
(-) Transfer to Class-II shares-CCPS conversion reserve - (4.83) - - -
(-) Transfer to Class-III shares-OCPS redemption/conversion reserve - (1.05) - - -
Note:
1. The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and loss and
cash flow.
CL Educate Limited
Annexure VII -Restated summary statement of share application money pending allotment
1) The share application money of ` 13.86 million outstanding as at March 31, 2014 represents part consideration towards investment in
G.K. Publications Private Limited as stipulated in the investment agreement entered on November 12, 2011 with the promoters of G.K.
Publications Private Limited.
The consideraion is discharged by way of issue of 12,917 and 10,569 equity shares of ` 10 each at a premium of ` 580 per share, on
September 5, 2014 to former promoters of G.K. Publications Private Limited, Rakesh Mittal and Poonam Mittal respectively (refer
annexure XVII).
2) Share application money of ` 29.45 million outstanding as at March 31, 2012 represents part consideration towards investment in
G.K. Publications Private Limited as stipulated in the investment agreement entered on November 12, 2011 with the promoters of G.K.
Publications Private Limited. The Company issued 47,416 equity shares of ` 10 each at a premium of ₹ 611 each on May 1, 2012.
3) During the year ended March 31, 2011, the Company received an amount of ₹ 100.31 million towards share application money for
issue of 501,537; 0.01% compulsorily convertible non cumulative preference shares of ₹ 10 each to be issued at a premium of ₹ 190 per
share. The Company issued 525,000; 0.01% compulsorily convertible non cumulative preference shares of ₹ 10 each at a premium of ₹
190 per share on April 29, 2011.
4) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
5) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and
cash flow.
CL Educate Limited
Annexure VIII - Restated summary statement of long-term borrowings
` in Million
Particulars Non-current portion Current maturities
As at March 31 As at March 31
2014 2013 2012 2011 2010 2014 2013 2012 2011 2010
Term loans (secured)
-From banks
a) Vehicle loans (refer footnote 3 and 4) 1.48 2.33 3.24 0.92 1.16 0.85 0.91 1.36 0.89 1.16
b) Other term loans (refer footnote 5) 17.40 33.93 - - - 47.72 97.11 - - -
-From Others
a) Term loan (refer footnote 6) - - 114.23 125.00 196.43 - - 101.61 71.43 53.57
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
3) Vehicle loans from banks are secured against hypothecation of concerned vehicles.
4) The repayment terms of the vehicle loans are as follows:
(₹ in Million)
Loan Rate of EMI Date of Last EMI Outstanding Amount as at March 31,
Interest 2014 2013 2012 2011 2010
CL Educate Limited
Annexure VIII - Restated summary statement of long-term borrowings (contd.)
2) Primary security
This loan is secured by way of first and exclusive charge on all present and future current and moveable assets including
moveable fixed assets of the Company.
3) Collateral security
The loan is further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
- Lien over fixed deposits of ₹ 130.00 million.
The above mentioned properties are common collateral for exposure of the bank in CL Media Private Limited (a wholly
owned subsidiary company) for overdraft limit of ₹ 25.00 million for year ending March 2013.
All secured loans are further secured by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan
(promoters and directors).
CL Educate Limited
Annexure VIII - Restated summary statement of long-term borrowings (contd.)
2) Primary security
This loan is secured by way of first and exclusive charge on all present and future current and moveable assets including
moveable fixed assets of the Company.
3) Collateral security
The loan is further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
- Lien over fixed deposits of ₹ 145.00 million.
The above mentioned properties are common collateral for exposure of the bank in CL Media Private Limited (a wholly
owned subsidiary company) for overdraft limit of ₹ 25.00 million for year ending.
All secured loans are further secured by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan
(promoters and directors).
CL Educate Limited
Annexure VIII - Restated summary statement of long-term borrowings (contd.)
During the financial year 2011-12 secured term loans were taken from L & T Finance Limited comprising of two loans of
₹ 100.00 million and ₹ 142.85 million. Both loans carry interest @ 14% per annum. Year end balances of both the loans
were for financial year ending March 31, 2012 were ₹ 215.84 million.
The loan of ₹ 100.00 million was repayable in 36 equal monthly instalments of ₹ 3.41 million (inclusive of interest) for
which November 10, 2014 is the last instalment date. The loan of ₹ 142.85 million was repayable in 24 monthly
instalments of equal principal of ₹ 5.95 million each along with interest thereon for which December 1, 2013 was the
last instalment date. However, the loan was fully prepaid during the financial year 2012-13.
This loan is secured by way of first pari passu charge on all immovable and movable fixed assets and all the current
assets of the Company. All secured loans are further secured by way of personal guarantees of Satyanarayan R., Gautam
Puri and Nikhil Mahajan (promoters and directors).
The loan is further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
The loan is further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
During the financial year 2009-10 secured term loan of ₹ 250.00 million was taken from L & T Finance Limited carrying
an interest rate of 12.50% payable in 42 equal instalments of ` 5.95 million each along with interest thereon for which
December 1, 2013 was the last instalment date. This loan was secured by way of first pari passu charge on all
immovable and movable fixed assets and all the current assets of the Company. All secured loans were further secured
by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan (promoters and directors). However,
the loan was fully prepaid during the financial year 2012-13.
The loan is further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
CL Educate Limited
Annexure IX- Restated summary statement of deferred tax assets/liabilities (net)
Net deferred tax liabilities /(assets) 17.81 13.51 4.30 37.62 (33.32) (33.82) 0.51 (2.81) 3.31
Note:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
3) The Company has recognised deferred tax liability of ₹ 7.53 million during the financial year 2009-10 which has been recognised as charge in the
restated summary statement of profit and loss in accordance with Accounting Standard 22 on ‘Accounting for Taxes on Income'. The net deferred
tax asset as on March 31, 2009 was Rs. 4.22 million.
CL Educate Limited
Annexure X- Restated summary statement of provisions
` in Million
Particulars Long-term Short term
As at March 31 As at March 31
2014 2013 2012 2011 2010 2014 2013 2012 2011 2010
Provision for employees benefits
Provision for gratuity 6.51 3.26 3.19 3.59 1.88 0.15 0.64 - - 0.14
Provision for leave encashment 7.07 5.09 3.85 4.92 4.28 0.31 0.83 1.15 - 0.22
Total 13.58 8.35 7.04 8.51 6.16 0.46 1.47 1.15 - 0.36
Note:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
3) Refer annexure XXXVII on employee benefit for further details.
CL Educate Limited
Annexure XI - Restated summary statement of short term borrowings
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Secured, from bank, repayable on demand
-Cash credit (refer footnote 4) 240.66 233.56 163.17 19.81 88.88
Unsecured from related parties (refer footnote 3) - - - - -
Career Launcher Employee Welfare Society (refer annexure XLVI) - 0.89 - - -
Total 240.66 234.45 163.17 19.81 88.88
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss
and cash flow.
3) Represents interest free loan repayable on demand.
4) Details of borrowings are as follows:
CL Educate Limited
Annexure XI - Restated summary statement of short term borrowings (contd.)
CL Educate Limited
Annexure XII- Restated summary statement of trade payable
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Trade payables
- Related parties (refer annexure XLVI) 64.20 13.61 29.77 24.43 18.19
- Others 47.95 41.66 67.47 71.58 24.64
112.15 55.27 97.24 96.01 42.83
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss
and cash flow.
3) Refer Annexure XLV for disclosure relating to suppliers registered under Micro, Small and Medium Enterprise Development Act,
2006
CL Educate Limited
Annexure XIII-Restated summary statement of other current liabilities
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Current maturities of long term borrowing
Term Loans- secured
- From Banks-Vehicle loan (Refer footnote 3 and 4 of annexure VIII) 0.85 0.91 1.36 0.89 1.16
- From Banks- Term loan (Refer footnote 5 of annexure VIII) 47.72 97.11 - - -
- From Others- Term loan (Refer footnote 6 of annexure VIII) - - 101.61 71.43 53.57
- - - - -
Interest accrued but not due on borrowings 0.30 0.88 2.04 2.29 -
Unearned revenue on education and training programmes 129.81 125.68 177.48 150.03 161.66
Unclaimed dividend - 0.03 0.05 0.05 0.05
Security deposit - - - 0.05 0.05
Book overdraft - 1.18 - - -
Other payables - - - - -
- Payable on purchase of fixed assets (refer annexure XLV) 0.36 18.12 40.70 7.52 13.13
- Payables on investments made (refer annexure XLV) - 12.64 8.48 - -
- Employee related payables (for related party refer annexure XLVI) 18.17 23.31 7.74 19.53 5.35
- Statutory dues payable 10.87 18.07 14.19 23.94 24.16
Payables for expenses (refer annexure XLV) - - - - -
- Related party (refer annexure XLVI) 34.66 7.03 1.49 0.66 0.83
- Others 45.64 31.06 37.68 17.34 33.57
Total 288.38 336.02 392.82 293.73 293.53
Footnotes:
1. The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and
loss and cash flow.
CL Educate Limited
Annexure XIV- Restated summary statement of tangible fixed assets *
` in Million
Particulars Land Land Buildings Plant Leasehold Furniture Office Computers Vehicles Total
freehold leasehold & Improvements & Fixture Equipments
Machineries
Gross block( at cost) as at March
31, 2014
Closing balance - 20.04 303.76 8.00 19.55 5.36 20.60 28.13 12.61 418.05
Deletion/adjustments - - - 0.38 4.02 0.36 0.73 1.51 - 7.00
Additions - - - - 3.53 0.14 0.91 1.19 - 5.77
Opening balance - 20.04 303.76 8.38 20.04 5.58 20.42 28.45 12.61 419.28
Accumulated depreciation as at
March 31, 2014 -
Closing balance - 2.15 20.49 5.28 14.46 3.33 8.80 21.01 5.74 81.26
Deletion/adjustments - - - 0.24 4.02 0.31 0.45 1.32 - 6.34
Additions - 0.22 4.95 0.59 3.88 0.37 2.03 4.32 1.26 17.62
Opening balance - 1.93 15.54 4.93 14.60 3.27 7.22 18.01 4.48 69.98
Net Block as at March 31, 2014 - 17.89 283.27 2.72 5.09 2.03 11.80 7.12 6.87 336.79
-
Gross block( at cost) as at March
31, 2013 -
Closing balance - 20.04 303.76 8.38 20.04 5.58 20.42 28.45 12.61 419.28
Deletion/adjustments 51.86 - - 0.02 1.34 0.30 0.83 1.72 - 56.07
Additions - - - 0.04 2.53 0.11 1.55 3.05 1.23 8.51
Opening balance 51.86 20.04 303.76 8.36 18.85 5.77 19.70 27.12 11.38 466.84
Accumulated depreciation as at
March 31, 2013 -
Closing balance - 1.93 15.54 4.93 14.60 3.27 7.22 18.01 4.48 69.98
Deletion/adjustments - - - 0.02 1.00 0.15 0.24 1.05 - 2.46
Additions - 0.22 4.95 0.59 3.07 0.37 1.91 4.64 1.26 17.01
Opening balance - 1.71 10.59 4.36 12.53 3.05 5.55 14.42 3.22 55.43
Net Block as at March 31, 2013 - 18.11 288.22 3.45 5.44 2.31 13.20 10.44 8.13 349.30
-
Gross block( at cost) as at March
31, 2012 -
Closing balance 51.86 20.04 303.76 8.36 18.85 5.77 19.70 27.12 11.38 466.84
Deletion/adjustments - - 13.11 0.30 8.96 0.95 2.01 4.94 3.03 33.30
Additions - - - - 6.24 0.61 1.28 6.22 4.70 19.05
Opening balance 51.86 20.04 316.87 8.66 21.57 6.11 20.43 25.84 9.71 481.09
Accumulated depreciation as at
March 31, 2012 -
Closing balance - 1.71 10.59 4.36 12.53 3.05 5.55 14.42 3.22 55.43
Deletion/adjustments - - 0.77 0.15 8.41 0.66 0.64 4.51 2.09 17.23
Additions - 0.22 4.95 0.59 2.81 0.37 1.89 4.26 0.97 16.06
Opening balance - 1.49 6.41 3.92 18.13 3.34 4.30 14.67 4.34 56.60
Net Block as at March 31, 2012 51.86 18.33 293.17 4.00 6.32 2.72 14.15 12.70 8.16 411.41
CL Educate Limited
Annexure XIV- Restated summary statement of tangible fixed assets *
` in Million
Particulars Land Land Buildings Plant Leasehold Furniture Office Computers Vehicles Total
freehold leasehold & Improvements & Fixture Equipments
Machineries
Accumulated depreciation as at
March 31, 2011 -
Closing balance - 1.49 6.41 3.92 18.13 3.34 4.30 14.67 4.34 56.61
Deletion/adjustments - - 0.18 0.01 2.16 0.23 0.37 1.09 1.31 5.35
Additions - 0.22 3.77 0.62 5.74 0.24 1.03 3.76 0.92 16.29
Opening balance - 1.27 2.82 3.31 14.55 3.33 3.64 12.00 4.73 45.65
-
Net Block as at March 31, 2011 51.86 18.55 310.46 4.74 3.44 2.77 16.13 11.17 5.37 424.50
-
Gross block( at cost) as at March
31, 2010 -
Closing balance 51.86 20.04 60.76 8.72 22.95 5.37 19.55 26.20 10.87 226.32
Deletion/adjustments - - - 0.11 6.65 0.72 0.75 1.63 - 9.87
Additions - - - - 5.20 0.12 0.46 4.32 0.82 10.93
Opening balance 51.86 20.04 60.76 8.83 24.40 5.97 19.84 23.51 10.05 225.27
Accumulated depreciation as at
March 31, 2010 -
Closing balance - 1.27 2.82 3.31 14.55 3.33 3.64 12.00 4.73 45.65
Deletion/adjustments - - - 0.06 5.89 0.45 0.31 1.47 - 8.17
Additions - 0.22 0.99 0.62 5.90 0.88 1.00 3.18 0.97 13.75
Opening balance - 1.05 1.83 2.73 14.54 2.90 2.95 10.29 3.76 40.06
Net Block as at March 31, 2010 51.86 18.77 57.94 5.41 8.40 2.04 15.91 14.20 6.14 180.69
*Tangible assets are subject to first pari passu charge to secure the Company's borrowings referred in footnotes as secured term loan from banks and bank
overdrafts in relevant years (refer annexure VIII and XI).
Footnotes:
i. Building includes 5 shares of ₹ 50 each being the cost of shares in Tardeo Air conditioned Market Building Cooperative Society Limited, Mumbai.
ii. Land measuring 20,007 square metres has been acquired by the Company under a lease agreement with Greater Noida Industrial Development Authority for
a lease period of 90 years commencing from July 20, 2004. The premium paid on the land and other expenses incidental to the acquisition are amortised over
the period of the lease.
iii. Pursuant to the board resolution dated October 31, 2012, the Company had classified freehold land of ₹ 51.86 million located at Faridabad, as fixed assets
held for sale under other current assets. (refer annexure XXV)
iv.The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
v.The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
CL Educate Limited
Annexure XV- Restated summary statement of intangible fixed assets
` in Million
Particulars Goodwill Intellectual Computer Content License fees CAT online Total
property rights softwares development module
Accumulated amortisation -
as at March 31, 2013
Closing balance - 51.93 8.98 5.40 0.04 1.83 68.18
Deletion/adjustments 2.88 15.56 - - - - 18.44
Additions - 15.54 0.75 2.04 0.04 1.83 20.20
Opening balance 2.88 51.95 8.23 3.36 - - 66.42
Net Block as at March 31,
- 114.22 1.39 7.20 0.56 - 123.37
2013
-
Gross block( at cost) as at
-
March 31, 2012
Closing balance 2.88 180.19 9.93 10.20 - - 203.20
Deletion/adjustments - - 0.74 - - - 0.74
Additions - 120.00 0.66 2.40 - - 123.06
Opening balance 2.88 60.19 10.01 7.80 - - 80.88
Accumulated amortisation -
as at March 31, 2012
Closing balance 2.88 51.95 8.23 3.36 - - 66.42
Deletion/adjustments - - 0.74 - - - 0.74
Additions - 9.49 1.16 1.56 - - 12.21
Opening balance 2.88 42.46 7.81 1.80 - - 54.95
Net Block as at March 31,
- 128.24 1.70 6.84 - - 136.78
2012
Continued to next page……
CL Educate Limited
Annexure XV- Restated summary statement of intangible fixed assets
` in Million
Particulars Goodwill Intellectual Computer Content License fees CAT online Total
property rights softwares development module
Accumulated amortisation -
as at March 31, 2010
Closing balance 2.88 38.97 6.64 0.72 - - 49.21
Deletion/adjustments - - - - - - -
Additions 0.05 3.53 1.20 0.60 - - 5.38
Opening balance 2.83 35.44 5.44 0.12 - - 43.83
Net Block as at March 31,
- 21.22 3.08 4.68 - - 28.98
2010
Footnotes:
1. The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
3.Intangible assets are subject to first pari passu charge to secure the Company's borrowings referred in footnotes as secured term loan from
banks and bank overdrafts in relevant years (refer annexure VIII and XI).
CL Educate Limited
Annexure XVI- Restated summary statement of capital work in progress
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Opening balance 0.09 - - 195.89 40.57
Add: Additions during the year - 0.09 - - 155.69
Capitalised as Leasehold improvements 0.09 - - 195.89 0.37
Closing balance - 0.09 - - 195.89
Notes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
CL Educate Limited
Annexure XVII- Restated summary statement of non-current investments
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Investment property
(Non-trade, valued at cost less accumulated depreciation)
Cost of building 13.11 13.11 13.11 - -
Less: Accumulated depreciation 1.41 1.19 0.99 - -
Closing balance (A) 11.70 11.92 12.12 - -
Equity shares in subsidiary companies
(Non-trade, un-quoted, at cost)
As at March 31, 2012, March 31, 2011 and March 31, 2010 the - - 0.38 0.38 0.38
number of fully paid up stock of $ 1 each of Career Launcher USA
Inc. are 8,500; 8,500 and 8,500 respectively
As at March 31 2014, March 31 2013, March 31 2012, March 31 2011 223.99 210.49 204.50 204.50 144.50
and March 31 2010 the number of fully paid up equity shares of ₹
10 each of Career Launcher Education Infrastructure and Services
Limited are 5,430,026; 5,369,758; 5,343,008; 5,343,008 and
5,075,000 respectively.(refer footnote 3)
As at March 31 2013, March 31 2012, March 31 2011 and March 31 - 0.43 0.43 0.43 0.43
2010 the number of fully paid up equity shares of SGD 1 each of
Career Launcher Asia Educational Hub Pte. Ltd are 14,000 in each
year. (refer footnote 4)
As at March 31 2014, March 31 2013, March 31 2012, March 31 2011 0.10 0.10 0.10 0.10 0.10
and March 31 2010 the number of fully paid up equity shares of `
10 each of CL Media Private Limited are 10,000 in each year.
As at March 31 2014, March 31 2013, March 31 2012, March 31 2011 69.10 69.10 69.10 69.10 69.10
and March 31 2010 the number of fully paid up equity shares of `
10 each of Kestone Integrated Marketing services Private Limited
are 1,000,000 in each year.
As at March 31 2014, March 31 2013 and March 31 2012 the number 0.07 0.07 0.07 - -
of fully paid up equity shares of ` 10 each of CL Higher Education
Services Private Limited are 6,576 in each year.
As at March 31 2014, March 31 2013, March 31 2012 the number of 143.39 108.97 73.13 - -
fully paid up equity shares of ₹ 10 each of G.K. Publications
Private Limited are 190,000; 144,400 and 96,900 respectively(refer
footnote 5).
436.65 389.16 347.71 274.51 214.51
Less : Provision for other than temporary dimunition in value of
0.07 0.07 - - -
investment in CL Higher Education Services Private Limited.
Less : Provision for other than temporary dimunition in value of
- - 0.38 - -
investment in Career Launcher USA Inc.
Closing balance (B) 436.58 389.09 347.33 274.51 214.51
The aggregate book value of unquoted non current investment are as follows: ` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Aggregate book value of unquoted non current investment 441.58 394.09 352.33 274.51 214.51
CL Educate Limited
Annexure XVII- Restated summary statement of non-current investments (contd.)
Footnotes:
1) The figures disclosed above are based on the restated unconsolidated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
3) The Company has given undertaking during the financial year 2012-13 and 2013-14 to HDFC Limited and 2009-10 to 2011-12 to Punjab National
Bank and Axis Bank, against the loan of ₹ 280.00 Million taken by Career Launcher Infrastructure Private Limited (CLIP), a subsidiary company
of its subsidiary named Career Launcher Education Infrastructure and Services Limited (CLEIS), that it will continue to hold atleast 51% of
equity shares of CLEIS throughout the tenure of said loan. There are no other significant restrictions on the right of ownership, realisability of
investments or the remittance of income and proceeds of disposal.
4) During the financial year 2013-14, the Company has transferred equity shares held by it in Career Launcher Asia Educational Hub Pte. Ltd. to
Kestone Integrated Marketing Services Private Limited at book value.
The Company on November 12, 2011 entered into an agreement with the promoters of G. K. Publication Private Limited (‘GKP’) to acquire
100% of equity shares (190,000 equity shares) of GKP held by them.
The Company shall acquire such shares in tranches on dates mentioned below:
During the year, the Company had acquired the first tranche of shares in GKP by payment of consideration stipulated above including
consideration by way of issue of equity shares of CL Educate Limited of value ₹ 29.45 Million, which has been booked as ‘share application
money pending allotment’ by the Company (refer annexure VII)
CL Educate Limited
Annexure XVIII- Restated summary statement of long-term loans and advances
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Unsecured, considered good, unless otherwise stated
Capital advances 1.29 0.20 1.23 1.87 8.99
Security deposits - - - - -
- Considered good 8.10 12.48 9.97 9.08 13.16
- Considered doubtful 0.44 0.44 - - -
9.83 13.12 11.20 10.95 22.15
- Less: provision for doubtful security deposits 0.44 0.44 - - -
9.39 12.68 11.20 10.95 22.15
Share application money given and pending allotment (refer - 13.50 - 5.00 5.00
annexure XLVI)
Other loans and advances
Balance with government authorities
- Service tax paid under protest 21.30 21.30 21.30 - -
Loans and advances to employees 2.07 0.09 0.62 0.15 -
Advance income-tax (net of provision for tax)(refer footnote 3) 35.26 36.15 30.02 55.11 56.00
MAT Credit Entitlement 14.95 7.28 7.28 - -
Others -Gratuity trust (refer annexure XLVI) 0.02 0.01 0.01 0.01 0.01
Total 82.99 91.01 70.43 71.22 83.16
Footnotes:
1) The figures disclosed above are based on the restated unconsolidated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
` in Million
3) Particulars As at March 31
2014 2013 2012 2011 2010
CL Educate Limited
Annexure XIX- Restated summary statement of other non-current assets
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Unsecured, considered good unless otherwise stated
Interest accrued on non current deposits 0.09 2.32 0.18 1.64 -
Non-current bank balances (refer annexure XXIII) 132.34 148.59 3.95 53.20 32.24
Total 132.43 150.91 4.13 54.84 32.24
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
CL Educate Limited
Annexure XX- Restated summary statement of current investments
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Equity shares in subsidiary companies
(Non-trade, un-quoted, at cost and fair value whichever is lower)
On March 31, 2013 the number of fully paid up stock are 8,500 of $ - 0.38 - - -
1 each of Career Launcher USA Inc
Less : Provision for dimunition in value of investment - (0.38) - - -
Total - - - - -
Footnotes:
1) During the year ending March 31 2014, the Company has transferred common stock held by it in Career Launcher USA Inc. to other shareholder
at Nil value.
2) The aggregate book value of unquoted current investment are as follows:
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Aggregate book value of unquoted current investment - - - - -
3) There are no significant restrictions on the right of ownership, realisability of investments or the remittance of income and proceeds of
disposal.
4) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
5) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
CL Educate Limited
Annexure XXI- Restated summary statement of inventories
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Traded goods
- Text books 33.65 24.28 12.50 - -
Total 33.65 24.28 12.50 - -
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
CL Educate Limited
Annexure XXII- Restated summary statement of trade receivables
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Unsecured, considered good unless stated otherwise (refer
annexure XLVI)
Outstanding for a period exceeding six months from the date they
are due for payment
- Considered good 65.98 76.30 72.24 69.36 99.25
- Considered doubtful 1.03 1.03 1.03 1.03 1.03
67.01 77.33 73.27 70.39 100.28
Less: Provision for doubtful trade receivables 1.03 1.03 1.03 1.03 1.03
65.98 76.30 72.24 69.36 99.25
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
3) For the financial year March 31, 2010 disclosure of ageing of year end outstanding balances of trade receivables has been given from the date
of invoices.
4) In the financial year 2009-10, the Company has given a franchisee to Ms Monica Oli in the name of Comprehensive Education and IT Training
Institute to provide test preparation services in Dubai (UAE). In the financial year 2012-13, the Company had terminated the franchise
agreement on account of non-recovery of fees collected by the franchisee from students. At the time of the cancellation of agreement the
total amount of receivables from and payable to Ms Monica Oli in the name of Comprehensive Education and IT Training Institute were AED
1.02 million (₹ 15.09 million ) and AED 0.26 million (₹ 3.87 million) respectively. The details of the amount recoverable are as follows:
i) An amount of AED 0.63 million on account of short deposit of fee collected by Monica Oli in the name of the Company from the students;
ii) An amount of AED 1.39 million on account of fee collected by Monika Oli against the installment due as on January 31, 2013 and did not
deposit in the bank account of the Company.
iii) An amount of AED 0.02 million on account of settlement of wage account and cancellation of visa of Mr. Yogeshwar Singh Batyal by the
Company;
iv) An amount of AED 0.004 million on account of payment of outstanding dues of bill in respect of communication expenses of Mr. Akhilesh Jha,
an employee and erstwhile center manager of Dubai office of the Company.
In the previous year, the Company has adjusted/squared off traded receivables of AED 0.26 million ( ₹ 3.87 million) against the amounts
payable to AED 0.26 million (₹ 3.87 million) on account of its share in the books of account.
In the previous year, the Company has initiated legal actions against Monica Oli to recover the said amounts. The Company had sent legal
notice dated November 6, 2013 to Monica Oli asking her to pay the flowing amounts to the Company.
1) An amount of AED 2.04 million as mentioned above;
2) An amount of AED 0.05 million on account of losses suffered by the Company due to non-communication by Monika Oli regarding
termination of agreement;
3) An amount of AED 1.00 million on account of damages for starting a same/similar business in violation of terms of the agreement and
unauthorizedly using data/information, manuals etc. pertaining to the Company;
Further, the Company has preferred arbitration in the matter and the Hon'ble Arbitrator has issued notices to parties for appearance.
CL Educate Limited
Annexure XXIII- Restated summary statement of cash and bank balances
` in Million
Particulars Non-current Current
As at March 31 As at March 31
2014 2013 2012 2011 2010 2014 2013 2012 2011 2010
Cash and cash equivalents
Balances with banks:
– on current accounts - - - - - 28.08 7.44 14.50 34.31 51.00
– in exchange earner's foreign - - - - - - - 0.62 0.53 0.48
currency account ('EEFC')
Cheques/ drafts on hand - - - - - 2.90 5.43 2.09 0.04 0.72
Cash on hand - - - - - 3.95 6.81 2.77 6.59 0.88
- - - - - 34.93 19.68 19.98 41.47 53.08
Other bank balances - - - - -
- in unpaid dividend account - - - - - 0.02 0.05 0.07 0.07 0.07
– Deposits with original maturity - - - - - 6.00 45.56 - - -
for more than 3 months but less
than 12 months from the
reporting date
– Deposits with maturity for - - - 52.92 - - - - - -
more than 12 months from
reporting date
– Margin money deposits and 132.34 148.59 3.95 0.28 32.24 3.71 - 137.93 88.25 74.54
under lien deposits
132.34 148.59 3.95 53.20 32.24 44.66 65.29 157.98 129.79 127.69
- - - - - - - - - -
Amount disclosed under other (132.34) (148.59) (3.95) (53.20) (32.24) - - - - -
non-current assets
(refer annexure XIX)
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and
cash flow.
CL Educate Limited
Annexure XXIV- Restated summary statement of short term loans and advances
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and
cash flow.
CL Educate Limited
Annexure XXV- Restated summary statement of other current assets
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Unsecured, considered good, unless otherwise stated
Unbilled revenue - - 5.10 7.02 7.54
Interest accrued but not due on fixed deposits 1.47 2.41 4.61 1.68 5.55
Interest accrued but not due on loans and advances - - - - -
- from related parties (refer annexure XLVI) 24.53 14.67 7.82 0.40 6.81
- from others - - 0.56 0.33 -
Total (A) 26.00 17.08 18.09 9.43 19.90
-Interest recoverable from tax authorities - - - 4.79 -
Fixed asset held for sale (Refer footnote (iii) of annexure XIV) 51.86 51.86 - - -
Total (B) 51.86 51.86 - 4.79 -
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and
cash flow.
3) Tangible assets are subject to first pari passu charge to secure the Company's borrowings referred in footnotes as secured term loan
from banks and bank overdrafts in relevant years (refer annexure VIII).
CL Educate Limited
Annexure XXVI- Restated summary statement of revenue from operations
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Revenue from operations
Sale of traded goods
- Sale of text books 186.52 187.22 148.83 182.34 222.16
Sale of services - - - - -
- Education and training programmes 812.62 782.21 646.66 613.45 603.98
- Vocational training services 98.00 67.25 65.57 27.88 -
1,097.14 1,036.68 861.06 823.67 826.14
Other operating revenue - - - - -
Business development and allied services to related parties (for related - - 2.29 3.77 1.50
party refer annexure XLVI)
Start up fees from franchisees 17.31 16.23 10.81 14.27 -
License fees ( for related party refer annexure XLVI) - - 15.72 0.60 13.23
Royalty income (for related party refer annexure XLVI) - 18.73 5.95 0.09 -
Advertising income (for related party refer annexure XLVI) 10.99 9.51 10.77 9.83 4.42
Campus placement income 3.67 3.25 - - -
Grant income 64.88 78.86 5.10 - -
Scrap sale 0.11 0.82 - - -
Revenue from operations 1,194.10 1,164.08 911.70 852.23 845.29
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
CL Educate Limited
Annexure XXVII- Restated summary statement of other income
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Interest income on
-Fixed deposits 16.48 14.47 11.76 9.03 11.75
-Income tax refund - 2.34 2.41 4.78 -
- Loans and advances (for related party refer annexure XLVI) 12.11 15.37 33.34 18.45 4.36
Net gain on foreign currency transactions and translations 1.62 1.14 6.48 0.10 -
Liabilities no longer required written back 16.64 31.58 16.29 2.14 8.97
Infrastructure fees (for related party refer annexure XLVI) 1.38 1.38 34.38 43.38 30.00
Income on employee stock option (ESOP) scheme (refer footnote 3 and - - - 0.46 -
annexure XXXVIII)
Rent income from investment property net of expenses (refer footnote 4) 0.08 0.39 0.59 - -
Profit on sale of fixed assets (net) - 0.13 - 2.01 -
Profit on sale of investments (refer annexure XLVI) - - - - 7.68
Bad debts recovered 0.81 0.57 0.72 0.53 0.27
Provisions written back - 112.88 - - -
Keyman insurance policy surrender - 7.19 - - -
Notice period recovery 1.98 1.45 0.97 1.12 -
Miscellaneous income (for related party refer annexure XLVI) 1.28 2.26 3.10 4.64 4.57
Total 52.38 191.15 110.04 86.64 67.60
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
3) For material adjustments refer annexure IV(2)
4) Rent income (net of expense) ` in Million
CL Educate Limited
Annexure XXVIII- Restated summary statement of purchase of traded goods
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Text books (for related party refer annexure XLVI) 102.85 65.43 46.37 28.52 32.65
Papers 2.02 2.19 2.23 - 3.47
Others 12.54 35.72 3.96 - 1.08
Total 117.41 103.34 52.56 28.52 37.20
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
CL Educate Limited
Annexure XXIX- Restated summary statement of (increase) in inventories of traded goods
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
CL Educate Limited
Annexure XXX- Restated summary statement of cost of services
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Other test prep related consumables 2.27 4.04 3.18 3.52 11.26
Faculty expenses 84.08 81.40 46.39 39.11 35.36
Franchisee expenses 327.59 372.10 323.35 317.25 316.84
Equipment hire expenses (for related party refer annexure XLVI) 25.27 14.19 5.02 2.74 2.33
Hostel expenses 11.90 10.75 0.01 - 0.01
Mobilization expenses 13.71 4.02 - - -
Project monitoring charges 0.84 0.42 - - -
Placement support expenses 11.41 0.49 0.19 - -
Total 477.07 487.41 378.14 362.62 365.80
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
CL Educate Limited
Annexure XXXI- Restated summary statement of employee benefits expense
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Salary, wages, bonus and other benefits 203.23 179.69 169.46 130.66 134.82
Contribution to provident and other funds (refer annexure XXXVII) 3.82 3.75 3.70 2.79 4.96
Gratuity expense (refer annexure XXXVII) 2.91 1.05 0.20 2.52 0.63
Leave encashment expense (refer annexure XXXVII) 3.18 2.66 1.30 1.55 1.62
Expense on employee stock option (ESOP) scheme (refer annexure XXXVIII) 0.85 3.44 4.23 - 2.13
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
3) Refer annexure XLVI for managerial remuneration.
CL Educate Limited
Annexure XXXII- Restated summary statement of finance costs
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Interest expense on borrowings
-Vehicle loan 0.33 0.46 0.32 0.23 0.26
-Overdraft 30.18 27.17 12.26 8.96 12.08
-Term loan 11.94 24.50 26.80 22.22 1.73
Other borrowing charges - - - - -
- Loan processing charges 1.54 6.16 1.21 - 1.99
- Bank guarantee charges 0.11 - - - -
Interest on delayed payment of statutory dues 0.03 0.78 0.02 - 0.02
Total 44.13 59.07 40.61 31.41 16.08
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
CL Educate Limited
Annexure XXXIII- Restated summary statement of depreciation and amortisation expenses
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Depreciation and amortisation of tangible assets (refer annexure XIV) 17.62 17.01 16.06 16.29 13.75
Amortisation of intangible assets (refer annexure XV) 19.86 20.20 12.21 5.74 5.38
37.48 37.21 28.27 22.03 19.13
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
CL Educate Limited
Annexure XXXIV- Restated summary statement of Other expenses
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Rent expenses (refer annexure XLI) 58.78 48.99 35.13 35.67 52.24
Office expenses 30.11 25.46 17.70 12.52 8.47
Travelling and conveyance expenses 22.44 21.65 19.81 11.68 12.74
Legal and professional expenses (for related party refer annexure XLVI) 10.75 10.73 15.57 10.66 11.43
Communication expenses 16.59 11.46 10.67 10.00 13.53
Repairs and maintenance expenses - - - - -
-Building 8.96 7.05 6.53 5.08 -
-Others 3.91 3.68 2.73 3.34 8.49
Water and electricity expenses 11.67 9.70 6.94 4.96 6.32
Freight and cartage expenses 3.33 5.78 5.07 4.30 5.24
Loss on sale of fixed assets (net) - - 0.13 - -
Printing and stationery expenses 2.88 2.30 1.95 1.52 2.11
Newspaper, books and periodicals expenses 0.76 0.52 1.59 0.62 0.79
Insurance expenses 1.32 2.66 2.57 1.91 1.63
Royalty expenses (for related party refer annexure XLVI) - 2.18 1.25 1.82 3.80
Recruitment, training and development expenses (for related party refer 2.86 1.81 1.49 1.06 1.66
annexure XLVI)
Rates and taxes expenses 0.02 0.61 2.19 0.45 1.50
Donations 0.12 0.14 0.30 0.14 1.53
Business service fee expenses (for related party refer annexure XLVI) 2.40 2.40 2.40 2.40 7.29
Bank charges (other than finance cost) 2.98 2.60 2.55 2.21 1.96
Marketing research expenses (for related party refer annexure XLVI) 12.24 7.83 5.18 4.09 6.41
Advertisement, publicity and sales promotion expenses 55.80 41.07 48.23 43.93 50.59
Business promotion expenses (for related party refer annexure XLVI) 7.14 6.82 6.56 4.04 6.36
Material development and printing expenses 3.63 2.64 1.00 7.64 10.09
Sales Incentive expenses 1.87 0.95 1.54 5.15 0.32
Commission to non executive directors 0.17 0.43 - 0.49 -
Bad debts written off 39.00 31.90 40.90 26.35 11.95
Doubtful advances written-off (for related party refer annexure XLVI) 0.51 120.02 0.04 2.63 0.04
Miscellaneous balances written-off 1.62 2.40 1.41 0.11 0.67
Doubtful deposits written-off - 0.39 - - 0.21
Provision for doubtful advances 0.34 2.00 - - -
Net loss on foreign currency transactions and translations - - - - 1.13
Provision for impairment of non-current investment - 0.07 - - -
Fixed assets written off 0.68 0.61 1.07 - 1.70
Collection charges - - - 1.56 -
Miscellaneous expenses (for related party refer annexure XLVI) 2.82 3.85 2.69 2.82 2.13
Total 305.70 380.70 245.19 209.15 232.33
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
CL Educate Limited
Annexure XXXV- Restated summary statement of contingent liabilities (to the extent not provided for)
` in Million
As at March 31
Particulars
2014 2013 2012 2011 2010
Claims against the Company not acknowledged as debt (refer footnote 1) 319.29 307.31 246.81 167.25 419.26
Corporate guarantees (refer footnote 2) 355.00 370.00 270.00 795.00 775.00
Guarantee to directors of a subsidiary (refer footnote 3) - 10.75 36.92 - -
Margin money deposit (refer footnote 4) - - - 0.28 -
Total 674.29 688.06 553.73 962.53 1194.26
Footnotes:
1) Details of claims against the Company not acknowledged as debt
As assessed by the management, the likeliness of liability of above disputes or loans not being discharged by the respective
subsidiary companies is not ‘more likely than not’ as mentioned in Accounting Standard -29 “Provisions, Contingent Liabilities and
Contingent Assets” and hence no liability has been recognised in the books. Also, as the likeliness of the same is not remote (as
mentioned in the same Accounting Standard) the Company has disclosed these as Contingent Liabilities.
F) Rashtriya advertising & Prabhatam Advertising Pvt Ltd, a service provider has filed a claim against the Company for recovery of an
amount of ₹ 1.45 million with interest as balance of amounts due. The Company has disputed the demand and the case is under
trial in the court of law.
G) Triangle Education, a franchisee of the Company in Jaipur, had arbitrarily terminated the agreement and started a competing
business using the brand of CL Educate. The Company has filed a statement of claim before the sole Arbitrator amounting ₹ 19.00
million against Triangle Education. Triangle Education also filed a counter claim against the Company amounting ₹ 3.20 million.
H) A student has filled a case against the Company for refund of fees amounting ₹ 0.62 million on the ground that he paid fees to
Brilliant Tutorials considering the fact that the Company has a tie-up with Brilliant Tutorial which was subsequently called off by
the Company.
CL Educate Limited
Annexure XXXV- Restated summary statement of contingent liabilities (to the extent not provided for)
B) During the financial year 2009-10, the Company received a demand for service tax aggregating ₹ 1.55 million for the period
September 2004 to March 2007 due to incorrect availment of service tax CENVAT credit. Penalty, aggregating ₹3.10 million has
also been levied under Section 15 read with Rule 15 of CENVAT Credit Rules, 2004. The Company has preferred an appeal with
Commissioner (Appeals) of Service Tax.
C) Demand for service tax aggregating ₹ 114.26 million for the period April, 2003 to October, 2010 is disputed by the Company
against which company had filled an reply with Commissioner (Appeals) of Service tax.
B) During the financial year 2009-10, the Company received a demand for service tax aggregating ₹ 1.55 million for the period
September 2004 to March 2007 due to incorrect availment of service tax CENVAT credit. Penalty, aggregating ₹3.10 million has
also been levied under Section 15 read with Rule 15 of CENVAT Credit Rules, 2004. The Company has preferred an appeal with
Commissioner (Appeals) of Service Tax.
C) Demand for service tax aggregating ₹ 34.70 million for the period April, 2003 to October, 2010 is disputed by the Company.
against which company had filled an reply with Commissioner (Appeals) of Service tax.
B) Demand for income tax aggregating to ₹ 34.81 million for the assessment year 2005-06 is disputed by the Company against which
the Company has preferred an appeal. The assessing officer has also initiated penalty proceedings under Section 274 read with
section 271 of the Income Tax Act, 1961 but in the absence of an order the amount of penalty is currently not ascertainable (refer
note below).
CL Educate Limited
Annexure XXXV- Restated summary statement of contingent liabilities (to the extent not provided for)
C) Demand for income tax aggregating to ₹ 106.37 million for the assessment year 2006-07 is disputed by the Company against which
the Company has preferred an appeal. The assessing officer has also initiated penalty proceedings under Section 274 read with
section 271 of the Income Tax Act, 1961 but in the absence of an order the amount of penalty is currently not ascertainable (refer
note below).
D) Demand for income tax aggregating to ₹. 128.16 million for the assessment year 2007-08 is disputed by the Company against which
the Company has preferred an appeal. The assessing officer has also initiated penalty proceedings under Section 274 read with
section 271 of the Income Tax Act, 1961 but in the absence of an order the amount of penalty is currently not ascertainable.CIT
(A) has decided the appeal partly in favour of the company and all major additions made in the assessment have been deleted. In
view of quantum additions deleted by the CIT (A), there will not be any imposition of penalty relating to those issues (refer note
below).
E) Demand for service tax aggregating to ₹ 71.00 million for the nine months the period 1 July 2003 to 30 September 2008 is disputed
by the Company against which the Company filed a reply. During the year, the Company received an order from the Commissioner
of Service Tax confirming the demand of ₹ 71.00 million. The officer has also imposed a penalty of ₹ 71.00 million under Section
78 of the Finance Act, 1994. The Company has preferred an appeal with CESTAT against the order of the Commissioner of Service
tax.
F) During the financial year 2009-10, the Company received a demand for service tax aggregating ₹ 1.55 million for the period
September 2004 to March 2007 due to incorrect availment of service tax CENVAT credit. Penalty, aggregating ₹3.10 million has
also been levied under Section 15 read with Rule 15 of CENVAT Credit Rules, 2004. The Company has preferred an appeal with
Commissioner (Appeals) of Service Tax.
Note:
Income tax cases related to assessment years 2004-05 to 2007-08 has been in later years decided in favour of the Company.
B) The Company has given an undertaking to continue to provide financial support to CL Higher Education Services Private Limited
('CLHES'), the subsidiary of the Company, to meet financial liabilities for continued business activities of CLHES.
B) The Company has given an undertaking to continue to provide financial support to CL Higher Education Services Private Limited
('CLHES'), the subsidiary of the Company, to meet financial liabilities for continued business activities of CLHES.
CL Educate Limited
Annexure XXXV- Restated summary statement of contingent liabilities (to the extent not provided for)
CL Educate Limited
Annexure XXXVI- Restated summary statement of commitments
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Estimated amount of contracts remaining to be executed
on capital account and not provided for
- to related party 10.80 13.20 15.60 18.00 20.40
- to others - 2.00 0.02 0.02 67.26
Commitment for license fees from Threesixtyone Degree 0.25 10.55 - - -
Minds Consulting Private Limited
Total capital commitments (A) 11.05 25.75 15.62 18.02 87.66
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities,
profit and loss and cash flow.
3) The Company has other material commitments of repayment/conversion of its Class- II and Class-III preference
shares issued, refer footnote 3 of annexure V for further details.
CL Educate Limited
Annexure XXXVII- Restated summary statement of employee benefits obligations
The Company has in accordance with the Accounting Standard-15 ‘Employee Benefits’ has calculated the various benefits provided to employees as under:
* The discount rates as mentioned above have been determined by reference to market yield at the respective balance sheet date on government
securities. The estimates of future salary increases, considered in actuarial valuation, take account of inflation, seniority, promotion and other relevant
factors, such as supply and demand in the employment market prevailing at the relevant time.
CL Educate Limited
Annexure XXXVII- Restated summary statement of employee benefits obligations
D) Expenses recognised in the restated summary statement of profit and loss for the year ` in Million
Particulars Earned leave (unfunded) Gratuity (funded)
For the year ending March 31 For the year ending March 31
2014 2013 2012 2011 2010 2014 2013 2012 2011 2010
Current service cost 1.34 1.14 1.10 1.03 1.07 1.71 1.24 1.18 1.08 1.01
Interest cost 0.47 0.40 0.43 0.38 0.35 0.47 0.41 0.46 0.34 0.34
Past service cost - - - - - - - - - -
Expected return on plan assets - - - - - (0.18) (0.18) (0.15) (0.18) (0.28)
Net actuarial loss/(gain) to be
1.37 1.12 (0.23) 0.14 0.20 0.91 (0.42) (1.29) 1.28 (0.44)
recognized
Expense recognised in Statement of 3.18 2.66 1.30 1.55 1.62 2.91 1.05 0.20 2.52 0.63
Profit and Loss
E) Reconciliation of present value of defined benefit obligation and fair value of assets ` in Million
Particulars Earned Leave (unfunded) Gratuity (funded)
As at March 31 As at March 31
2014 2013 2012 2011 2010 2014 2013 2012 2011 2010
Present value of obligation as at the 7.38 5.92 5.00 4.92 4.50 7.79 5.93 5.15 5.22 4.00
end of the year (A)
Fair Value of plan assets as at the end - - - - - 1.13 2.03 1.96 1.63 1.98
of the year (B)
Net liability recognized in restated 7.38 5.92 5.00 4.92 4.50 6.66 3.90 3.19 3.59 2.02
summary of assets and liabilities
(A-B)
Amount classified as:(refer annexure X)
Short term provision 0.31 0.83 1.15 - 0.22 0.15 0.64 - - 0.14
Long term provision 7.07 5.09 3.85 4.92 4.28 6.51 3.26 3.19 3.59 1.88
CL Educate Limited
Annexure XXXVII- Restated summary statement of employee benefits obligations
F) Net asset/(liability) and actuarial experience gain/(loss) for present benefit obligation (‘PBO’) and plan assets and employers best estimate for next year
a) Gratuity (Funded) ` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
PBO 7.79 5.93 5.15 5.22 4.00
Plan assets 1.13 2.03 1.96 1.63 1.98
Net (liability) (6.66) (3.90) (3.19) (3.59) (2.02)
Experience gain/(loss) on PBO 0.45 0.92 0.79 (1.60) 0.50
Experience gain/(loss) on plan assets (0.04) (0.00) 0.04 (0.02) (0.10)
The plan assets of the Company are managed by Life Insurance Corporation of India through a trust managed by the Company in terms of an insurance
policy taken to fund obligations of the Company with respect to its gratuity plan. The categories of plan assets as a percentage of total plan assets is
based on information provided by Life Insurance Corporation of India with respect to its investment pattern for group gratuity fund for investments
managed in total for several other companies. Information on categories of plan assets as at March 31, 2014, March 31, 2013, March 31, 2012, March 31,
2011 and March 31, 2010 has not been provided by Life Insurance Corporation of India.
3) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
4) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
CL Educate Limited
Annexure XXXVIII- Restated summary statement of employees share based payment plan
Pursuant to shareholder resolution dated March 6, 2008, the Company introduced “Employee Stock Option Plan 2008 (CL ESOP -2008)” which provides for the issue
of 250,000 stock options to directors and employees of the Company and its subsidiaries companies. The plan entitles directors and employees to purchase equity
shares in the Company at the stipulated exercise price, subject to compliance with vesting conditions. All exercised options shall be settled by physical delivery of
equity shares. As per the plan holders of vesting options are entitle to purchase one equity share for each option.
Particulars As at March 31
2014 2013 2012 2011 2010
Stock options granted under this scheme (in numbers) 248,968 243,968 214,968 177,468 177,468
The terms and conditions related to grant of the share options are as follows:
Employees entitled No. of Vesting conditions Contractual life of the
options option (years)
Directors of the Company 154,857 3 years' service from 1.58
Employees 94,111 the grant date 3.22
` in Million
Share based payment expenses As at March 31
2014 2013 2012 2011 2010
CL ESOP -2008 (Refer footnotes) 0.85 3.44 4.23 (0.46) 2.13
Footnotes:
1) Includes expenses on account of stock options of CLEIS, a subsidiary of the Company, to employees of the Company.
2) The information concerning stock options granted, exercised, forfeited and outstanding at the year end is as follows:
CL Educate Limited
Annexure XXXVIII- Restated summary statement of employees share based payment plan
3) The Black Scholes valuation model has been used for computing the weighted average fair value considering the following inputs:
Particulars As at March 31
2014 2013 2012 2011 2010
Dividend yield (%) - - - - -
Expected volatility (%)* 19.04% 26.95% 9.20% 7.88% 19.04%
Risk-free interest rate (%) 8.70% 7.75% 8.45% 14.92% 8.70%
Weighted average share price (in ₹) 334.00 429.00 417.00 350.00 350.00
Exercise price (in ₹) 175-300 175-300 150-300 150-300 150-300
*Expected volatility has been determined using historical fluctuation in share issue prices of the Company.
4) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
5) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash flow.
CL Educate Limited
Annexure XXXIX- Restated summary statement of payment to auditors (excluding service tax)
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and
loss and cash flow.
CL Educate Limited
Annexure XL- Restated summary statement of segment reporting
Primary segment
The company has identified two reportable business segments as primary segments: Education and training programme (including sale of
study material) and Vocational training (except in financial year 2009-10). The segments have been identified and reported taking into
account the nature of products, the differing risks and returns, the organisation structure and the internal financial reporting systems.
i) Education and training programme (including sale of study material) mainly include coaching for higher education entrance examination.
ii) Vocational training includes specific projects undertaken (including government projects).
Financial information about the primary segments is given below:
For the Year ended March 31, 2014
` in Million
Particulars Education and training Vocational Others Total
programme (including Training
sale of study material)
Revenue
External revenue 1,016.46 162.88 14.77 1,194.11
Total revenue 1,016.46 162.88 14.77 1,194.11
` in Million
Segment liabilities 214.64 81.54 - 296.18
Unallocable liabilities - - - 395.74
Total liabilities 691.92
Secondary segment
The Company has identified Geographical Segment as Secondary Segment.
Financial information about the geographic segment is given below:
` in Million
Particulars Within India Overseas Total
Segment revenue 1,194.11 - 1,194.11
Segment assets 1,813.78 22.46 1,836.24
Segment liabilities 691.65 0.27 691.92
Capital expenditures 12.78 0.16 12.94
CL Educate Limited
Annexure XL- Restated summary statement of segment reporting
Revenue
External revenue 985.66 146.11 32.31 1,164.08
Total revenue 985.66 146.11 32.31 1,164.08
` in Million
Segment liabilities 214.19 10.41 - 224.60
Unallocable liabilities - - - 451.52
Total liabilities 676.12
` in Million
Other information
Capital expenditure-allocable 7.03 0.76 - 7.79
Capital expenditure-unallocable - - - 7.60
Depreciation and amortisation- allocable 18.22 1.04 - 19.26
Depreciation and amortisation-unallocable - - - 18.16
Other significant non-cash expenses (net)-allocable 27.17 0.61 - 27.78
Secondary segment
The Company has identified Geographical Segment as Secondary Segment.
Financial information about the geographic segment is given below:
` in Million
Particulars Within India Overseas Total
Segment revenue 1,120.46 43.62 1,164.08
Segment assets 1,768.92 12.33 1,781.25
Segment liabilities 676.12 - 676.12
Capital expenditures 15.39 - 15.39
CL Educate Limited
Annexure XL- Restated summary statement of segment reporting
Revenue
External revenue 806.31 70.67 34.72 911.70
Total revenue 806.31 70.67 34.72 911.70
Results
Segment results 254.17 21.20 19.61 294.98
` in Million
Segment liabilities 164.84 - - 164.84
Unallocable liabilities - - - 614.05
Total liabilities 778.89
` in Million
Other information
Capital expenditure-allocable - - 120.00 120.00
Capital expenditure-unallocable - - - 22.10
Depreciation and amortisation- allocable - - 9.49 9.49
Depreciation and amortisation- allocable- - - - 19.00
unallocable
Other significant non-cash expenses (net)-allocable 57.03 - - 57.03
Secondary segment
The Company has identified Geographical Segment as Secondary Segment.
Financial information about the geographic segment is given below:
` in Million
Particulars Within India Overseas Total
Segment revenue 866.33 45.37 911.70
Segment assets 1,662.56 44.34 1,706.90
Segment liabilities 778.89 - 778.89
Information on capital expenditure has not been provided by locations of customers, as such information is not realistically allocable and
identifiable in the this year.
CL Educate Limited
Annexure XL- Restated summary statement of segment reporting
Revenue
External revenue 810.06 27.88 14.29 852.23
` in Million
Segment liabilities 143.63 - - 143.63
Unallocable liabilities - - - 400.86
Total liabilities 544.49
` in Million
Other information
Capital expenditure-allocable - 2.07 - 2.07
Capital expenditure-unallocable - - - 265.71
Depreciation and amortisation- allocable - - 3.49 3.49
Depreciation and amortisation-unallocable - - - 18.54
Other significant non-cash expenses (net)-allocable 26.35 - - 26.35
Secondary segment
The Company has identified Geographical Segment as Secondary Segment.
Financial information about the geographic segment is given below:
` in Million
Particulars Within India Overseas Total
Segment revenue 825.55 26.68 852.23
Segment assets 1,472.04 18.98 1,491.02
Segment liabilities 529.68 14.81 544.49
Capital Expenditure 267.78 - 267.78
CL Educate Limited
Annexure XL- Restated summary statement of segment reporting
` in Million
Segment liabilities 204.49 - 204.49
Unallocable liabilities - - 428.17
Total liabilities 632.66
` in Million
Other information
Capital expenditure-allocable 11.98 - 11.98
Capital expenditure-unallocable - - 1.59
Depreciation and amortisation- allocable 12.19 - 12.19
Depreciation and amortisation-unallocable - - 6.93
Other significant non-cash expenses (net)-allocable - - -
Other significant non-cash expenses (net)-unallocable - - 14.58
Secondary segment
The Company has identified Geographical Segment as Secondary Segment.
Financial information about the geographic segment is given below:
` in Million
Particulars Within India Overseas Total
Segment revenue 829.30 15.99 845.29
Segment assets 1,262.08 6.27 1,268.36
Segment liabilities 625.61 7.05 632.66
Capital Expenditure 13.57 - 13.57
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
-----Space intentionally left blank-----
CL Educate Limited
Annexure XLI Restated summary statement of leases
As lessee
The Company is a lessee under various operating leases for coaching centres across India. The lease terms of these
premises range from 1 to 2 years and accordingly are short term leases. Rental expense for operating lease and total of
future minimum lease payments under non-cancellable leases are as follows:
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Rental expense for operating leases 58.78 48.99 35.13 35.67 52.24
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Not later than one year 1.70 0.20 0.54 0.62 7.61
Later than one year but not later than 5 years - - - - 8.99
Later than 5 years - - - - -
Total 1.70 0.20 0.54 0.62 16.60
As lessor
The Company has given a portion of its premises on cancellable operating lease to various franchisees. There are no non
cancellable leases and hence disclosure relating to minimum lease receipts has not been provided. The total lease
receipts recognized in Statement of Profit and Loss are as follows.
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Rental income for operating leases 0.29 0.60 0.80 - -
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit
and loss and cash flow.
CL Educate Limited
Annexure XLII-Restated summary statement of expenditure in foreign currency
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Travelling and conveyance expenses - 0.13 0.13 0.33 1.88
Legal and professional expenses - - - - 0.31
Advertisement, publicity and sales promotion expenses - - - - 0.52
Communication expenses - - - - 0.11
Office expenses - - - - 0.46
Staff Welfare expenses - - - - 0.08
Repairs and maintenance expenses - - - - 0.85
Bank charges (other than finance cost) 0.05 0.07 0.05 0.03 -
Franchisee expenses - 33.05 33.08 19.67 -
Rent expenses 0.41 - - - 3.51
Salary, wages, bonus and other benefits 2.20 - - 0.50 4.70
Miscellaneous expenses 0.07 0.24 3.17 1.44 0.11
Total 2.73 33.49 36.43 21.97 12.53
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit
and loss and cash flow.
CL Educate Limited
Annexure XLIII- Restated summary statement of earnings in foreign currency
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Operating revenue from:
- Education and training programmes - 38.00 47.97 26.68 18.19
- Sale of text books - 4.12 4.26 3.04 -
Other operating revenue from:
- Advertising income - - - - 0.10
- License fees - - - - 0.62
- Start up fees from franchisees - 1.49 - - -
Total - 43.61 52.23 29.72 18.91
Footnotes:
1) The figures disclosed above are based on the restated summary statement of profit and loss of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit
and loss and cash flow.
CL Educate Limited
Annexure XLIV- Restated summary statement of un-hedged foreign currency exposure
The year-end foreign currency exposures that have not been hedged by a derivative instrument or otherwise are as follows:
Receivables in foreign currency in Million
*Abbreviations: AED: United Arab Emirates Dirham, QAR: Qatari Rial, SGD: Singapore Dollar and USD: United States Dollar.
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit and loss and cash
flow.
3) The Company does not enter into any forward contracts to hedge its foreign currency exposures.
CL Educate Limited
Annexure XLV- Restated summary statement of disclosure relating to suppliers registered under Micro, Small and
Medium Enterprise Development Act, 2006:
Amount due to entities covered under Micro, Small and Medium Enterprises as defined in the Micro, Small, Medium
Enterprises Development Act, 2006, have been identified on the basis of information available with the Company.
There was no amount due to any such entities at the end of each year which needs to be disclosed. This has been
relied upon by the auditors.
Footnotes:
1) The above statement should be read with annexures to the restated summary statement of assets and liabilities,
profit and loss and cash flow.
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure (contd.)
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
(B) Details of related party transactions are as below:
2. Other income
a. Interest on loans and advances
- Career Launcher Education Foundation 8.88 7.47 25.48 13.83 0.29
- Kestone Integrated Marketing Services Private Limited - 0.11 0.43 0.14 0.31
- Career Launcher USA Ltd. 0.08 - - 3.11 2.63
- Career Launcher Education Infrastructure and Services
- - - 1.15 1.02
Limited
- Career Launcher Higher Education Services Private Limited
0.01 - 0.16 - -
e. Infrastructure Fees
'- Career Launcher Education foundation - - 33.00 42.00 30.00
'- Career Launcher Education Infrastructure and Services
1.38 1.38 1.38 1.38 -
Limited
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure (contd.)
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
3. Other expenses
a.CL Media Private Limited
- Business service fee expenses 2.40 2.40 2.40 2.40 7.29
- Royalty Expenses - - 0.58 - -
- Miscellaneous expense - 0.02 - - -
e. CLEF- AP
- Balances written off - - 0.04 - -
5. Cost of service
Equipment hire expenses
'- Kestone Integrated Marketing Services Private Limited 26.51 7.67 - - -
6. Managerial remuneration
- Mr. Gautam Puri 5.61 5.10 5.05 5.05 4.80
- Mr. Satya Narayanan R. 5.61 5.10 5.05 5.05 4.80
- Mr. Nikhil Mahajan 5.46 4.95 4.91 5.05 4.80
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure (contd.)
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
7.Reimbursement of expense from related parties
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure (contd.)
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure (contd.)
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
18. Assets purchased by subsidiary on our behalf and
transferred
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure (contd.)
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
- Career Launcher Employee Group Gratuity Trust 0.02 0.01 0.01 0.01 0.01
2. Trade receivables
- CL Media Private Limited - - 60.76 28.36 -
- Career Launcher Education Foundation - - - - 69.50
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure (contd.)
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
4. Other current assets
5. Trade payable
- CL Media Private Limited 61.21 13.37 29.77 24.43 18.19
- GK Publications Private Limited 2.99 0.24 - - -
CL Educate Limited
Annexure XLVI- Restated summary statement of related party disclosure (contd.)
` in Million
Particulars As at March 31
2014 2013 2012 2011 2010
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities, profit
and loss and cash flow.
CL Educate Limited..
Annexure XLVII- Restated summary statement of earnings per equity share
The calculation of earnings per share (EPS) has been made in accordance with Accounting Standard (AS) 20. The
statement on calculation of Basic and Diluted EPS is as under.
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Profit/(Loss) after tax 24.48 65.25 (58.01) 83.54 59.26
Add: Exceptional expenses 15.49 - 196.62 17.13 -
Profit after tax but before exceptional 39.97 65.25 138.61 100.67 59.26
expenses
Weighted average numbers of equity shares 9,417,810 9,393,087 8,777,076 8,749,003 8,748,033
Add: Dilutive potential equity shares (refer 304,946 311,050 774,989 4,939 4,342
footnote 1)
Number of equity shares for dilutive EPS 9,722,756 9,704,137 9,552,065 8,753,942 8,752,375
Basic earnings per share before exceptional 4.24 6.95 15.79 11.51 6.77
expenses
Diluted earnings per share before exceptional 4.11 6.72 14.51 11.50 6.77
expenses
Basic earnings per share after exceptional 2.60 6.95 (6.61) 9.55 6.77
expenses
Diluted earnings per share after exceptional 2.52 6.72 (6.61) 9.54 6.77
expenses
Footnotes:
1) Following are the potential equity shares considered to be dilutive in nature, hence these have been adjusted
to arrive at the dilutive earnings per share:
A) The Company has committed to issue equity shares of CL Educate Limited to the promoters of G. K. Publication
Private Limited for purchase of first and third and last tranche of equity share of G. K. Publication Private
Limited (refer footnote 5 of annexure XVII). As the numbers of shares and share price for such issue is
determined as of the reporting date, the impact of the same as potential equity share for calculation of diluted
earnings per share has been taken.
CL Educate Limited..
Annexure XLVII- Restated summary statement of earnings per equity share
B) The Company had ESOP outstanding as on Balance Sheet date, shares which are outstanding and will be issued
at, for a lesser consideration than its fair value. Such equity shares generate lesser proceeds and have no effect
on the net profit attributable to equity shares outstanding. Therefore, value of such differential (fair value per
share less exercising price per share) in respect of ESOP outstanding are considered dilutive and equalised
number of ESOP outstanding derived by dividing such differential value with fair value per share is added to the
number of equity shares outstanding in the computation of diluted earnings per share.
C) The Company had committed to issue equity shares of CL Educate Limited to GPE (India) Limited on conversion
of Class- II shares-CCPS and Gaja Trustee Company Private Limited for Class- III shares-OCPS as per terms
mentioned in footnote D of annexure V. The conversion price 1 and 2 as mentioned in footnote D of annexure 5
of the financial statements has elapsed. Shareholders have right to seek the conversion of these shares at a
price per equity shares of ₹ 425 each as stipulated in conversion price 3. Hence, number of shares is determined
as of the reporting date, therefore, such shares are considered as dilutive and are added to the number of
equity shares outstanding in the computation of diluted earnings per share.
2) The figures disclosed above are based on the restated summary statement of assets and liabilities of the
Company.
3) The above statement should be read with annexures to the restated summary statement of assets and
liabilities, profit and loss and cash flow.
CL Educate Limited..
Annexure XLVIII-Restated summary statement of exceptional expenses
` in Million
Particulars For the year ending March 31
2014 2013 2012 2011 2010
Balances written off of related party balances
i. Career Launcher Education Foundation (refer annexure
XLVI)
- Provision for doubtful advances - - 112.88 - -
- Loans and advances written off 15.49 - 60.70 - -
Total A 15.49 - 173.58 - -
ii. Career Launcher USA Inc.
- Provision for doubtful advances (refer footnote 4) - - 21.10 17.13 -
- Provision for doubtful Receivables - - 1.56 - -
- Provision for Impairment of investments - - 0.38 - -
Total B - - 23.04 17.13 -
Footnotes:
1) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2) The above statement should be read with annexures to the restated summary statement of assets and liabilities,
profit and loss and cash flow.
4) For the year ending March 31, 2012 and March 31, 2011
a. During the year, the Company had created provision and written off balances due in the nature of short terms loans
and advances (‘referred as balances’) recoverable from Career Launcher Education Foundation (enterprises in which
key management personnel and their relatives are able to exercise significant influence) as the loans and advances
are considered unrecoverable on account of inability of Career Launcher Education Foundation to repay.
The evaluation of provision involves usage of assumptions and significant judgments based on valuation
methodologies/judgements, which mainly included discontinuation of affiliation by Pondicherry University of college
run by Career Launcher Education Foundation. Keeping the attendant circumstances in view, the management
believes it is prudent to impair these balances. These will be evaluated on a going forward basis for any further
changes.
Impairment of the balances have been done by way provisions and write offs. Write offs have been done for the
portion of balances which are considered fully unrecoverable and provisions have been made for the portion for which
the management believes that the amount shall be more likely than not be unrecovered.
CL Educate Limited..
Annexure XLIX - Restated summary statement of accounting ratios
Diluted earnings per share (`) (refer note 2 (b) A/F 2.52 6.72 (6.61) 9.54 6.77
below)
Restated profit/(loss) available for equity A 24.48 65.25 (58.01) 83.54 59.26
shareholders
Weighted average number of equity shares for basic B 9,417,810 9,393,087 8,777,076 8,749,003 8,748,033
earnings per share (refer note 3 and 5 below)
Add: Potential equity shares on conversion of C 235,294 235,294 699,208 - -
preference shares
Add: Potential equity shares on issue of ESOPs D 46,166 75,756 28,365 4,939 4,342
Add: Potential equity shares to be issued for E 23,486 - 47,416 - -
consideration other than cash
Weighted average number of shares for diluted F= 9,722,756 9,704,137 9,552,065 8,753,942 8,752,375
earnings per share B+C+D+E
Net-worth at the end of the year G 1130.46 1105.13 898.56 846.22 635.70
Total number of equity shares outstanding at the H 9,417,810 9,417,810 9,334,706 8,749,003 8,749,003
end of the year
Return on net-worth (refer note 2 (c) below) A/G*100 2.17% 5.90% -6.46% 9.87% 9.32%
Net asset value per equity share (`) (refer note 2 (d) G/H 120.03 117.34 96.26 96.72 72.66
below)
Notes:
2.The ratios have been computed as below:
(a) Basic earnings per share (`) Net profit after tax (as restated) attributable to equity shareholders
Weighted average number of equity shares outstanding during the year
(b) Diluted earnings per share (`) Net profit after tax (as restated) attributable to equity shareholders
Weighted average number of dilutive equity shares outstanding during the year
(c) Return on net worth (%) Net profit after tax after preference dividend and related tax thereon (as restated)
Net worth at the end of the year
(d) Net assets value per equity share Net Worth at the end of the year
Total number of equity shares outstanding at the end of the year
CL Educate Limited..
Annexure XLIX - Restated summary statement of accounting ratios
3. Weighted average number of equity shares are the number of equity shares outstanding at the beginning of the year adjusted by the
number of equity shares issued during year multiplied by the time weighing factor. The time weighing factor is the number of days for
which the specific shares are outstanding as a proportion of total number of days during the year.
4.Net worth for ratios mentioned in note 2(c) and 2(d) represents sum of equity share capital and reserves and surplus. Refer annexure VI
for components of reserve and surplus.
5.Earnings per share calculations are in accordance with AS 20 - "Earnings per share", [notified under the Companies Act, 1956 read with
General Circular 15/2013 dated September 13, 2013, issued by the Ministry of Corporate Affairs, in respect of Section 133 of the
Companies Act, 2013].
6.Considering that the Company has incurred losses during the year ended March 31, 2012, the conversion of CCPS and issue of ESOPs
would decrease the loss per share for the year ended March 31, 2012 and hence, it has been ignored for the purpose of calculation of
diluted EPS.
7.The share application money received and pending allotment as at March 31, 2011 were towards non-cumulative, non-convertible
redeemable preference shares and hence was not considered for computing diluted earnings per share.
8.The figures disclosed above are based on the restated unconsolidated summary statements of the Company.
9. The above statement should be read with the annexures to the restated unconsolidated summary statements of assets and liabilities,
profit and loss and cash flows as appearing in Annexure IV.
CL Educate Limited..
Annexure L - Restated summary statement of tax shelters
` in Million
Particulars As at March 31,
2014 2013 2012 2011 2010
Restated profit before tax 37.99 102.87 (91.83) 126.07 92.73
Marginal tax rate (in %) 32.45% 32.45% 32.45% 33.22% 33.22%
Tax expense at marginal rate 12.33 33.38 (29.79) 41.88 30.80
Adjustments :
Permanent differences
Interest/provision on TDS 0.03 0.78 - 0.70 2.06
Donation 0.06 0.14 0.30 0.07 0.77
ESOP 0.85 3.44 (1.67) (0.46) 2.13
Provision for doubtful advances 1.49 - (10.56) - 0.21
Share issue expenses - 5.88 1.96 - -
Long term capital gain - - - 2.01 7.68
Total (A) 2.44 10.25 (9.97) 2.32 12.84
Timing differences
Provision for retirement benefit
Difference in depreciation 0.46 0.29 (2.38) - -
Reversal of provision for investment (0.38) - - - -
Brought forward losses - 6.74 - - -
Expense disallowed previous year now being 1.03 (4.30) - - -
allowed as TDS is paid now
Footnotes:
1. The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and
loss and cash flow.
CL Educate Limited
Annexure LI - Restated summary statement of capitalisation
` in Million
Particulars March 31, 2014 Post Issue
(refer footnote 3)
Debt:
Long-term Borrowings 18.88 [•]
Short-term Borrowings 240.66 [•]
Current maturities of long term borrowing (Refer annexure XIV) 48.57 [•]
Total Debt (A) 308.11 [•]
Shareholders Fund:
Equity shares 94.18 [•]
Compulsorily convertible 0.01% non cumulative preference shares 4.11 [•]
Optionally convertible 0.01% non cumulative preference shares 0.89 [•]
Reserves and Surplus 1,031.28 [•]
Total Shareholders Fund (B) 1,130.46 [•]
Footnotes:
1. The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and loss and cash
flow.
3. Will be updated at the time of prospectus.
4. Subsequent to March 31, 2014, there has been changes in the capital structure of the Company as detailed in footnote (9) to Annexure V.
Report of the Independent Auditors on the Restated Consolidated Summary Financial
Statements
To,
The Board of Directors
CL Educate Limited
DTJ 925, DLF Tower - B
Jasola District Centre,
New Delhi - 110025
India
Dear Sirs,
(a) section 26(1)(b) oI WKH &RPSDQLHV $FW ´the Actµ UHDG ZLWK 5XOH RI WKH
Companies (Prospectus and Allotment of Securities) Rules, 2014; and
(b) the Securities and Exchange Board of India (Issue of Capital and Disclosure Requirements)
Regulations, 2009, as amended ´6(%,5HJXODWLRQVµ
a. the terms of reference agreed with the Company vide engagement letter dated August
18, 2014 relating to work to be performed on such restated consolidated financial
information, proposed to be included in the DRHP of the Company in connection with its
proposed IPO; and
b. the Guidance Note (Revised) on Reports in Company Prospectuses issued by the Institute
of Chartered Accountants of India.
3. The restated consolidated summary financial statements have been prepared by the
management from the audited consolidated financial statements of the Group as at and for
each of the years ended March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011
and March 31, 2010, prepared in accordance with accounting principles generally accepted in
India at the relevant time and approved by the Company in its board meetings held on
September 5, 2014, September 28, 2013, January 24, 2013, January 24, 2013 and September
5, 2014 respectively.
4. For the purpose of our examination of the restated consolidated summary financial
statements we have relied on:
(a) the audited consolidated financial statements of the Group as at and for each of the
years ended March 31, 2014, March 31, 2013, March 31, 2012 and March 31, 2011
prepared in accordance with accounting principles generally accepted in India at the
relevant time and approved by the Company in its board meetings held on September 5,
2014, September 28, 2013, January 24, 2013 and November 5, 2011 respectively and
which have been audited by us;
(` in Millions)
Year Number of Total Total Total Total cash
ended entities assets revenue profit/(loss) inflow/(outflow)
March 31, 1 0.32 2.49 2.26 0.00
2014
March 31, 2 3.61 3.21 1.90 0.09
2013
March 31, 3 127.34 107.82 (15.25) 2.43
2012
March 31, 3 40.16 38.18 0.25 (3.46)
2011
(b) the audited consolidated financial statements of the Group as at and for the year ended on
March 31, 2010, prepared in accordance with accounting principles generally accepted in
India at the relevant time and approved by the Company in its board meeting held on
September 5, 2014 which have been audited by AMAA and Associates Chartered Accountants
whose report has been furnished to us and relied upon by us.
5. Financial Information
The financial information referred to above, relating to assets and liabilities, profits and
losses, and cash flows of the Group is contained in the following annexure to this report,
FROOHFWLYHO\UHIHUUHGWRDVWKH´5HVWDWHGConsolidated Summary Financial 6WDWHPHQWVµ:
c) Annexure III containing the ´5HVWDWHG Consolidated Summary Statement of Cash Flowsµ
for the years ended March 31, 2014, 2013, 2012, 2011 and 2010.
e) Annexure V to XXXII and XLVII containing the Annexure to Restated Consolidated
Summary Financial Statements.
Other Financial Information relating to the Group which is based on the Restated
Consolidated Summary Financial Statements / audited consolidated financial statements
prepared by the management and approved by the Board of Directors is attached in
Annexure XXXIII to XLVI and XLVIII to LI to this report as listed hereunder:
1. Annexure XXXIII- Restated consolidated summary of statement of basic and diluted earnings
per equity share
2. Annexure XXXIV- Restated consolidated summary statement of contingent liabilities
3. Annexure XXXV- Restated consolidated summary statement of commitments
4. Annexure XXXVI- Restated consolidated summary statement of employee benefits obligations
5. Annexure XXXVII- Restated consolidated summary statement of employees share based
payment plan
6. Annexure XXXVIII- Restated consolidated summary statement of payment to auditors
7. Annexure XXXIX - Restated consolidated summary statements of lease
8. Annexure XL - Restated consolidated summary statement of expenditure in foreign currency
9. Annexure XLI- Restated consolidated summary statement of earnings in foreign currency
10.Annexure XLII- Restated consolidated summary statement of un-hedged foreign currency
exposure
11.Annexure XLIII - Restated consolidated summary statement of related party disclosures
12.Annexure XLIV- Restated consolidated summary statement of disclosure relating to suppliers
registered under Micro, Small and Medium Enterprise Development Act, 2006
13.Annexure XLV- Restated consolidated summary statement of goodwill on consolidation
14.Annexure XLVI - Restated consolidated summary statement of capital work in progress
15.Annexure XLVIII - Restated consolidated summary statement of segment reporting
16.Annexure XLIX - Restated consolidated summary statement of material adjustments
17.Annexure L - Restated consolidated summary statement of accounting ratios
18.Annexure LI - Restated consolidated summary of capitalisation statement
8. $XGLWRUV·5HVSRQVLELOLW\
9. Opinion
In our opinion, the financial information of the Company as stated in Para 5 above and Other
Financial Information as stated in Para 6 above, read with the Statement of Significant
Accounting Policies enclosed in Annexure IV to this report, after making such
adjustments/restatements and regroupings as considered appropriate, as stated in
Statement on Adjustments to Audited Consolidated Financial Statements enclosed in
Annexure XLIX, have been prepared in accordance with section 26(1)(b) of the Act read with
Rule 4 of the Companies (Prospectus and Allotment of Securities) Rules, 2014 and the SEBI
Regulations.
The Restated Consolidated Summary Financial Statements have been arrived at after making
such adjustments and regroupings as, in our opinion, are appropriate and more fully
described in the Statement on Adjustments to Audited Consolidated Financial Statements in
Annexure XLIX [read with significant accounting policies in Annexure IV] to this report.
a) WKHUH DUH QR TXDOLILFDWLRQV LQ WKH DXGLWRUV· UHSRUWV WKDW UHTXLUH DQ DGMXVWPHQW LQ WKH
Restated Consolidated Summary Financial Statements;
b) adjustments for the material amounts in the respective financial years to which they
relate to have been adjusted in the attached Restated Consolidated Summary Financial
Statements;
c) there are no changes in accounting policies adopted by the Group during the year ended
March 31, 2014 which required adjustment in Restated Consolidated Summary Financial
Statements;
d) upto the financial year ending March 31, 2011, the Group had a policy of charging off
its inventory to the statement of profit and loss. Effective financial year ended March
31, 2012 the Company started recognising inventory in the balance sheet based on
actual inventory lying with the Company at the year end. The impact of such change in
accounting policy on the profit as per restated summary of profit and loss for the years
ended March 31, 2010 and 2011 is unascertainable;
e) there are no extraordinary items that are required to be disclosed in the Restated
Consolidated Summary Financial Statements.
10. The figures included in the Restated Consolidated Summary Financial Statements and Other
Financial Information do not reflect the events that occurred subsequent to the date of the
audit reports on the respective years referred to above.
11. This report on Restated Consolidated Summary Financial Statements should not in any way
be construed as a reissuance or redating of the previous audit reports nor should this be
construed as a new opinion on any of the consolidated financial statements referred to
herein. Reading the Restated Consolidated Summary Financial Statements, is not a substitute
for reading the audited consolidated financial statements of the Company.
12. We did not perform audit tests for the purposes of expressing an opinion on individual
balances or summaries of selected transactions, and accordingly, we express no such opinion
thereon.
13. We have no responsibility to update our report for events and circumstances occurring after
the date of the report.
14. This report is issued at the specific request of the Company for your information and
inclusion in the DRHP to be filed by the Company with SEBI and Stock Exchanges in
connection with the proposed IPO of equity shares of the Company. This report may not be
useful for any other purpose.
CL Educate Limited
Annexure I - Restated consolidated summary of assets and liabilities
(൘ in Million)
Annexure As at March 31
Particulars
2014 2013 2012 2011 2010
Non-current liabilities
Long-term borrowings VIII 235.02 258.40 329.64 335.53 357.69
Deferred tax liabilities (net) IX 18.57 15.54 23.68 30.10 4.68
Other long-term liabilities X 1.19 1.10 0.91 0.63 0.09
Long-term provisions XI 20.39 15.22 10.36 10.44 7.38
275.17 290.26 364.59 376.70 369.84
Current liabilities
Short-term borrowings XII 340.81 281.69 220.71 39.56 108.33
Trade payables XIII 169.85 120.84 96.00 88.34 44.50
Other current liabilities XIV 405.26 481.58 607.33 482.08 358.71
Short-term provisions XI 25.67 14.86 3.41 0.23 0.54
941.59 898.97 927.45 610.21 512.08
Total Liability.. 3,012.19 2,801.80 2,634.36 2,356.95 1,666.48
ASSETS
Non-current assets
Fixed assets
-Tangible assets XV 755.87 776.27 912.72 739.38 395.74
-Intangible assets XVI 110.25 124.45 142.56 30.46 38.56
-Capital work-in-progress XLVI 6.31 6.41 5.95 123.58 239.40
Goodwill on consolidation XLV 195.96 155.06 121.35 44.29 44.29
Non-current investments XVII 17.20 17.42 17.63 0.50 0.50
Deferred tax assets (net) IX 1.60 1.10 35.23 4.55 6.09
Long-term loans and advances XVIII 190.61 160.99 124.82 128.30 198.02
Other non-current assets XIX 132.43 210.37 2.75 54.84 32.24
1,410.23 1,452.07 1,363.01 1,125.90 954.84
Current assets
Inventories XX 105.72 67.66 40.47 0.20 0.20
Trade receivables XXI 647.63 536.64 459.94 339.78 318.70
Cash and cash equivalents XXII 114.02 121.32 293.77 452.35 161.28
Short-term loans and advances XVIII 561.94 487.93 410.82 369.09 206.07
Other current assets XXIII 172.65 136.18 66.35 69.63 25.39
1,601.96 1,349.73 1,271.35 1,231.05 711.64
Total Assets.. 3,012.19 2,801.80 2,634.36 2,356.95 1,666.48
Notes:
1. The above statement should be read with the annexures to restated consolidated summay statements of assets and liabilites, statement of profit & loss and cash flow as appearing in
annexure IV.
2. Refer annexure XLIX for material adjustment.
This is the restated consolidated summary statement of assets and liabilities referred to in our report of even date.
CL Educate Limited
Expenses
Cost of raw material and components consumed XXVI A 93.65 78.97 17.69 - -
Cost of services XXVI B 519.44 526.04 388.83 363.58 367.48
Purchases of stock-in-trade XXVII 16.31 13.17 53.01 28.52 45.79
(Increase) in inventories of finished goods, work-in-progress and traded XXVIII (39.91) (27.38) (18.12) - (0.20)
goods
Employee benefit expenses XXIX 686.57 674.64 620.72 358.57 344.10
Finance costs XXX 89.70 101.06 74.00 43.37 24.35
Depreciation and amortisation expense XXXI 54.69 55.97 46.00 32.12 28.23
Other expenses XXXII 659.19 610.87 469.57 357.64 346.14
Total expenses (II) 2,079.64 2,033.34 1,651.70 1,183.80 1,155.89
Profit before exceptional items, tax and minority interest (I-II) 217.43 186.97 109.08 148.65 72.83
Exceptional items (net) XLVII 13.26 - 191.94 - -
Profit/(loss) before tax and minority interest 204.17 186.97 (82.86) 148.65 72.83
Income tax expense:
For current year:
-Current tax 63.81 30.17 23.88 51.18 27.46
-Minimum alternate tax ('MAT') credit (25.42) (16.62) (7.74) (0.12) (1.38)
-Deferred tax (benefit)/charge 2.54 25.99 (37.10) 26.95 7.98
Total tax expenses 40.93 39.54 (20.96) 78.01 34.06
Profit/(loss) after tax before minority interest 163.24 147.43 (61.90) 70.64 38.77
Share of minority in loss for the year 8.44 2.73 (9.10) (18.06) (7.73)
Profit/(loss) after tax 154.80 144.70 (52.80) 88.70 46.50
1. The above statement should be read with the annexure to restated consolidated summay statements of assets and liabilites, statement of profir & loss and cash flow as appearing in
annexure IV
2. Refer annexure XLIX for material adjustment.
This is the restated consolidated summary statement of profit and loss referred to in our report of even date.
CL Educate Limited
Annexure III - Restated consolidated summary statement of cash flow
(൘ in Million)
For the year ended on March 31
Particulars
2014 2013 2012 2011 2010
A Cash flow from operating activities
Net profit/ (loss) before tax and minority interest and after prior 204.17 186.97 (82.86) 148.65 72.83
period items
Adjustments for:
Depreciation and amortisation 54.69 55.97 46.00 32.12 28.23
Depreciation and amortisation on investment property 0.22 0.21 0.21 - -
Interest expense 84.16 96.82 71.15 43.23 21.91
Loan processing charges 2.67 2.60 2.20 - 2.17
Interest income (76.25) (64.84) (78.03) (44.80) (24.05)
(Gain)/ loss on fixed assets sold (0.24) (7.03) - (1.96) -
Fixed assets written off 0.68 0.92 1.64 - 1.70
Transfer to employee stock option outstanding 0.85 3.44 3.36 (0.46) 2.13
Amortisation of preliminary expenses - 0.07 0.07 0.07 0.07
Dividend paid 0.03 0.02 - - -
Advances and deposits written off 2.13 123.22 1.96 2.85 0.92
Bad debts written off 47.11 34.72 42.16 28.02 16.78
Rent on investment properties (0.30) (0.66) (2.68) (3.08) (1.76)
Bad debts recovered (0.81) (0.57) (0.72) (0.53) (0.27)
Liability no longer required written back (18.09) (33.05) (17.32) (4.78) (9.07)
Provision for doubtful advances 0.85 3.08 3.00 1.95 0.34
Provision no longer required written back (3.08) (112.88) - - -
Exceptional non cash items:
Advances written off 13.26 - 60.70 - -
Doubtful receivables written off - - 31.93 - -
Provision for doubtful advances - - 112.88 - -
Gain on sale of fixed assets - - (13.57) - -
Gain on sale of investment - - - - (4.62)
Unrealised foreign exchange gain (1.53) (0.48) (1.46) (0.10) 2.40
Realised foreign exchange loss on sale of investment 9.45 - - - -
Operating profit before working capital changes 319.97 288.53 180.62 201.18 109.71
Taxes paid (net of refund including interest on refund) (55.29) (28.79) (6.45) (60.52) (44.67)
Net cash generated /(used in) from operating activities 98.26 59.60 (193.01) 138.48 20.03
Purchase of fixed assets (including capital advances and fixed assets (43.61) (78.98) (241.51) (154.53) (256.38)
related payable)
Proceeds from sale of fixed assets - 0.36 143.32 17.74 18.70 -
Proceeds from sale of investment - - - - 9.30
Share application money pending allotment - - - - (5.00)
Purchase of investment of in subsidiaries (47.91) (37.68) (73.13) - -
Inter-corporate deposits (net) (0.01) 7.29 3.70 6.28 (1.17)
Purchase of investment of in others - - (5.00) - -
Realisation from fixed deposits (net) 75.85 (16.15) 134.75 (275.09) 67.57
Loan given (48.46) (130.33) 30.84 (142.17) (73.99)
Rental Income 0.30 0.66 2.68 3.08 1.76
Interest received 52.23 64.45 79.23 39.62 29.35
Net cash used in Investing activities (11.25) (47.42) (50.70) (504.11) (228.56)
&RQWLQXHGRQQH[WSDJH«
CL Educate Limited
Annexure III - Restated consolidated summary statement of cash flow
Proceeds from issue of equity shares of subsidiary company (net of 2.13 18.19 (8.68) 186.33 2.10
minority adjustments)
Security premium 0.35 141.60 107.99 240.92 -
Share application money received 13.86 (29.45) (70.86) 100.31 -
Proceeds from long-term borrowings (including current maturities) 35.00 505.84 266.16 55.65 244.57
Repayment of long-term borrowings (116.96) (582.17) (231.67) (55.39) (53.57)
Proceeds from short-term borrowings (net) 59.12 60.98 181.14 (68.75) 46.07
Loan processing fee paid (2.67) (2.60) (2.20) - (2.09)
Dividend paid (0.03) (0.02) - - -
Share issue expenses (0.03) (6.00) - (11.92) (0.19)
Interest paid (Include interest capitalised) (84.80) (100.80) (71.04) (44.26) (18.52)
Net cash flow from financing activities (94.03) 5.57 170.84 402.89 218.37
Net increase / (decrease) in cash and cash equivalents (7.02) 17.75 (72.87) 37.26 9.84
Unrealised foreign exchange gain on cash and cash equivalents 0.02 (0.98) (1.58) (0.33) -
Cash and cash equivalents at beginning of the year 60.81 44.04 118.49 81.56 71.72
Adjustment on account of acquisition of subsidiary
Cash and cash equivalents at end of the year 53.81 60.81 44.04 118.49 81.56
Add:
Fixed deposits shown under Cash and bank balances 60.21 60.51 249.73 333.86 79.72
Total cash and bank balances at end of the year 114.02 121.32 293.77 452.35 161.28
Notes :
1. The above restated consolidated summary statement of cash flows has been prepared under the "Indirect Method" as set out in Accounting Standard-3 on "Cash Flow Statement" [notified
under the Companies Act, 1956 read with general circular 15/2003 dated September 13, 2013 issued by Ministary of Corporate Affairs, in respect section 133 of Companies Act, 2013].
2. The above restated consolidated summary statement of cash flows has been complied from and is based on the restated consolidated summary statement of assets and liabilities as at
March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011 and March 31, 2010, and the restated consolidated summary statement of profit and loss for the year ended on that date.
This is the restated consolidated summary statement of cash flows referred to in our report of even date.
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
1. Background
The accompanying restated consolidated summary statement of the assets and liabilities, profit and Loss and
cash flows reflect results of activities undertaken by the Company and its subsidiaries (collectively referred
WRDV¶WKHGroup· during the period of 5 years ending March 31, 2014, March 31, 2013, March 31, 2012, March
31, 2011, and March 31, 2010.
a. Basis of preparation of restated consolidated summary statement of the assets and liabilities
The restated summary consolidated financial statements have been prepared to comply with the Accounting
Standards notified under section 211 (3C) of the Companies Act, 1956 read with the General Circular 15/2013
dated 13 September 2013 of the Ministry of Corporate Affairs in respect of section 133 of the Companies Act,
¶WKH $FW· 7KH restated consolidated summary financial statements have been prepared on a going
concern basis under the historical cost convention on accrual basis. The accounting policies have been
consistently applied by the Group unless otherwise stated.
The restated consolidated summary financial statements of the Company have been prepared to comply in all
material respects with the requirements of Part I of Chapter III to the Companies Act, 2013 and Securities
and Exchange Board of India (Issue of Capital and Disclosure Requirements) Regulations, 2009 issued by SEBI,
as amended from time to time.
These restated consolidated summary financial statements and other financial information have been
prepared after incorporating:
(a) Adjustments for the material amounts in respective years to which they relate.
(b) Adjustments for reclassification of the corresponding items of income, expenses, assets and liabilities, in
order to bring them in line with the groupings as per the audited financial statements of the Company as
at and for the year ended March 31, 2014 (prepared in accordance with Revised Schedule VI of the
&RPSDQ\·V$FWDQGWKHUHTXLUHPHQWVRIWKH6(%,5HJulations.
These restated consolidated summary financial statements and Other Financial Information were approved by
the Board of Directors on September 22, 2014.
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
b. Principles of consolidation
The restated consolidated summary financial statements include the restated consolidated summary financial
statements of the Company and its subsidiaries.
The restated consolidated summary financial statements have been prepared in accordance with Accounting
Standard (AS-RQ´Consolidated Financial StatementsµUHIHUUHGWRLQWKH&RPSDQLHV$FFRXQWLQJ6WDQGDUGV
Rules, 2006 issued by the Central Government in exercise of the power conferred under sub-section (1) (a) of
VHFWLRQRIWKH&RPSDQLHV$FWWKH¶$FW·The Restated consolidated summary financial statements
are prepared on the following basis:
i. Restated consolidated summary financial statements includes restated consolidated summary statement of
assets and liability, restated consolidated summary statement of profit and loss, restated consolidated
summary statement of cash flow statement and notes to restated consolidated summary financial
statements, other statements and explanatory material that form an integral part thereof. The restated
consolidated summary financial statements are presented, to the extent possible, in the same format as
adapted by the Company for its standalone restated summary financial statements.
ii. The Restated consolidated summary financial statements have been combined on a line by line basis by
adding the book values of like items of assets, liabilities, income and expenses after eliminating intra-group
balances/transactions and resulting unrealised profits in full. The amounts shown in respect of reserves
comprise the amount of the relevant reserves as per the Balance Sheet of the Company and its share in the
post-acquisition increase/ (decrease) in the relevant reserves of the entity to be consolidated. This
procedure has been performed using the audited Standalone Restated summary financial statements of CL
Educate Limited and its subsidiaries.
iii. As per Accounting Standard 21 on restated consolidated summary financial statements, notes involving
items which are material need to be disclosed. Materiality for this purpose is assessed in relation to the
information contained in the restated consolidated summary financial statements.
iv. The restated consolidated summary financial statements have been drawn to keep all the information as
contained in the Audited Restated consolidated summary financial statements of the Company for the
year ended March 31, 2014 on standalone basis.
(i) During the financial year 2013-14, the Company has transferred its share in Career Launcher Asia Education
Hub Pte Ltd (Singapore) to one of its subsidiary named Kestone Integrated Marketing Services Private Limited
(India) at book value.
(ii) This subsidiary was acquired by the Company with effect from October 1, 2011. During the year ended March
31, 2014 the Company acquired additional 24% shares in the subsidiary.
(iii) This company was promoted by the Company and was incorporated on August 28, 2011.
(iv) During the financial year 2013-14, the Company has transferred its share in Career Launcher USA Inc. (The
United States of America) to other shareholder at Nil value.
(v) This subsidiary was acquired by the Company with effect from October 28, 2006.
(vi) This company was promoted as a wholly owned subsidiary company by a Subsidiary of the Company, namely
´Career Launcher Education Infrastructure and Services Limitedµ and was incorporated on 20 February 2008.
Entities acquired/ sold during the year have been consolidated from/ upto the respective date of their
acquisition/ disposal.
d. Use of estimates
The preparation of restated consolidated summary financial statements in conformity with Generally Accepted
Accounting Principles requires management to make estimates and assumptions that affect the reported
amounts of assets, liabilities and contingent liabilities at the reported date and the reported amounts of
revenues and expenses during the reporting period. Although these estimates are based on the managHPHQWV·
best knowledge of current events and actions, actual results could differ from these estimates. Any revision in
accounting estimate is recognised prospectively in current and future periods.
e. Revenue recognition
Revenue is recognised to the extent that it is probable that the economic benefit will flow to the Group and
revenue can be reliably measured.
Educational and training businesses of the Group include revenue from services and sales of text books.
Revenue in respect of educational and training fees received from students is recognised on time basis over the
period of the course. Fees are recorded at invoice value excluding taxes and net of discounts, if any.
Revenue in respect of vocational training is recognised over the period of the training period. However, taking
into account the uncertainty involved in conditions to be fulfilled under the terms of the contract, portion of
such revenue depending upon such uncertainty is deferred till the fulfillment of conditions of the contract.
Sale of text books for full course is recognised at the time of receipt of first payment on account of test
preparation services provided by the Group.
Advertisement income
Revenue is recognised on accrual basis, if the right to receive payment is established by the Balance Sheet date.
Revenue in respect of infrastructure fee and soft skills fee are charged from different institutions on revenue
sharing basis and are recognised on accrual basis over the year of rendering services.
Revenue in respect of event management service is recognised on proportionate completion method by relating
the revenue with work accomplished and certainty of consideration available.
Revenue in respect of managed manpower services and others is recognised on an accrual basis, in accordance
with the terms of the respective contract.
Revenue is recognised when the significant risks and rewards of ownership have passed on to the buyer and is
disclosed net of sales return and trade discounts. Allowances for sales returns are estimated and provided for in
the year of sales.
Revenue from consultancy services and seminar and alliance income is recognised as and when services are
actually rendered.
Revenue in respect of training fee, school fee and subscription fee is recognised on accrual basis in the year to
which it pertains.
Pass through revenue arises on account of facility provided to customers, in which debtors of the customers are
realised through the Group. Revenue is generally a portion of such realisation and recognition of such revenue is
made on receipt of request of such realisation from customers.
Grant income
Government grants available to the Group are recognised when both the following conditions are satisfied:
(a) where there is reasonable assurance that the group will comply with the conditions attached to them;
and
(b) where such benefits have been earned by the Group and it is reasonably certain that the ultimate
collection will be made.
Grants related to specific fixed assets are shown as a deduction from the gross value of the asset concerned
in arriving at its book value. The grant is thus recognised in the restated consolidated summary statement of
profit and loss over the useful life of a depreciable asset by way of a reduced depreciation charge. Where the
grant equals the whole, or virtually the whole, of the cost of the asset, the asset is shown in the Balance
Sheet at a nominal value. Grants for various government projects carried out by the Company are disclosed in
other operating income as grant income.
License fee
Revenue in respect of one-time license fee received from the franchisees is recognised on execution of the
contract.
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
Revenue from licensing of content given for a long term period and dependent on percentage of revenue earned
by the licensee is recognised when the right to receive payment is established.
License fee on account of grant of brand on non exclusive basis is one-time fee charged from different schools
and is recognised in the year in which contract is executed.
Royalty income
Revenue from royalty is recognised on an accrual basis in accordance with the terms of the relevant agreement.
Content development fee is recognised on accrual basis on raising of bill for the period for which services are
provided.
Subscription fee
Unbilled revenue
Unbilled revenue, included in other current assets, represents amounts recognised based on services performed
in advance of billing in accordance with service terms.
Unearned revenue
Amounts billed and received or recoverable prior to the reporting date of services to be performed after the
reporting date are recorded as unearned revenue in other current liabilities.
Other Income
Interest income
Revenue from interest on time deposits, inter-corporate loans and other loans are recognised on the time
proportion method taking into consideration the amount outstanding and the applicable interest rates.
Dividend income
Dividends income is recognised when the right to receive the same is established.
f. Fixed Assets
Tangible Assets
Tangible fixed assets are stated at cost of acquisition net of recoverable taxes (wherever applicable), less
accumulated depreciation and impairment losses, if any. Cost comprises the purchase price and any cost
attributable to bringing the assets to its working condition for its intended use.
Subsequent expenditure related to an item of fixed asset is added to its book value only if it increases the future
benefits from the existing asset beyond its previously assessed standard of performance. All other expenses on
existing fixed assets, including day to day repair and maintenance and cost of replacing parts, are charged to the
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
Restated consolidated summary statement of profit and loss for the period during which such expenses are
incurred.
Fixed assets retired from active use and held for disposal are stated at lower of book value and net realisable
value as estimated by the Group and are shown separately in the restated consolidated summary financial
statements under other current assets. Loss determined, if any, is recognised immediately in the restated
consolidated summary statement of profit and loss, whereas profit and sale of such assets is recognised only upon
completion of sale thereof.
Intangible Assets
An intangible asset is recognised when it is probable that the future economic benefits attributable to the asset
will flow to the enterprise and where its cost can be reliably measured. Intangible assets are stated at cost of
acquisition less accumulated amortization and accumulated impairment losses, if any. Cost comprises the
purchase price and any cost attributable to bringing the assets to its working condition for its intended use.
Gain or loss arising from the retirement of disposal of an intangible asset are determined as the difference
between the net disposal proceeds and the carrying amount of asset is recognised as income or expense in the
Restated consolidated summary statement of profit and loss in the year in which the asset is derecognized.
Depreciation and amortisation has been calculated on Straight Line Method at the following rates, based on
management estimates, which are equal to or higher than the rates specified as per schedule XIV of the
Companies Act, 1956, which in the opinion of the management are reflective of the estimated useful lives of
the Fixed Assets.:
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
Goodwill reflects the excess of cost of acquisition over the book value of net assets acquired on the date of the
acquisition. Goodwill is tested for impairment on an annual basis.
Depreciation and amortisation on addition to fixed assets is provided on pro-rata basis from the date the assets
are ready for intended use. Depreciation and amortisation on sale/discard of fixed assets is provided for upto the
date of sale, deduction or discard of fixed assets as the case may be.
All assets, except chairs used in test preparation centres costing ൕ 5,000 or below are depreciated in full by a
one-time depreciation charge unless used as project assets under infrastructure projects.
h. Impairment of assets
The carrying amounts of assets are reviewed at each Balance Sheet date to determine if there is any indication
of impairment based on internal/external factors. An impairment loss is recognised wherever the carrying
amount of an asseWH[FHHGVLWVUHFRYHUDEOHDPRXQW7KHUHFRYHUDEOHDPRXQWLVWKHJUHDWHURIWKHDVVHW·VQHW
selling price and value in use. In assessing value in use, the estimated future cash flows are discounted to their
present value at the weighted average cost of capital.
After impairment, depreciation/amortisation is provided on the revised carrying amount of the asset over its
remaining useful life.
i. Borrowing costs
Borrowing costs relating to acquisition or construction or production of assets which take substantial period of
time to get ready for its intended use are included as cost of such assets to the extent they relate to the period
till such assets are ready to be put to use. Other borrowing costs are recognised as an expense in the period in
which they are incurred.
j. Leases
Finance leases, which effectively transfer to the group substantially all the risks and benefits incidental to
ownership of the leased item, are capitalised at the inception of the lease term at the lower of the fair value
of the leased property or present value of minimum lease payments. Lease payments are apportioned between
the finance charges and reduction of the lease liability so as to achieve a constant rate of interest on the
remaining balance of the liability. Finance charges are recognised as finance costs in the restated consolidated
summary statement of profit and loss. Lease management fees, legal charges and other initial direct costs of
lease are capitalised.
A leased asset is depreciated on a straight-line basis over the useful life of the asset or the useful life
envisaged in Schedule XIV to the Companies Act, 1956, whichever is lower. However, if there is no reasonable
certainty that the Group will obtain the ownership by the end of the lease term, the capitalised asset is
depreciated on a straight-line basis over the shorter of the estimated useful life of the asset, the lease term or
the useful life envisaged in Schedule XIV to the Companies Act, 1956.
Leases, where the lessor effectively retains substantially all the risks and benefits of ownership of the leased
item, are classified as operating leases. Operating lease payments are recognised as an expense in the restated
consolidated summary statement of profit and loss on a straight-line basis over the lease term.
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
Leases in which the Group transfers substantially all the risks and benefits of ownership of the asset are
classified as finance leases. Assets given under finance lease are recognised as a receivable at an amount equal
to the net investment in the lease. After initial recognition, the Group apportions lease rentals between the
principal repayment and interest income so as to achieve a constant periodic rate of return on the net
investment outstanding in respect of the finance lease. The interest income is recognised in the restated
consolidated summary statement of profit and loss. Initial direct costs such as legal costs, brokerage costs, etc.
are recognised immediately in the restated consolidated summary statement of profit and loss.
Leases in which the Group does not transfer substantially all the risks and benefits of ownership of the asset
are classified as operating leases. Assets subject to operating leases are included in fixed assets. Lease income
on an operating lease is recognised in the restated consolidated summary statement of profit and loss on a
straight-line basis over the lease term. Costs, including depreciation, are recognised as an expense in the
Consolidated Restated consolidated summary statement of profit and loss. Initial direct costs such as legal
costs, brokerage costs, etc. related to lease are recognised immediately in the restated consolidated summary
statement of profit and loss.
k. Investment property
An investment in land or buildings, which is not intended to be occupied substantially for use by, or in the
operations of, the Group, is classified as investment property. Investment properties are stated at cost, net of
accumulated depreciation and accumulated impairment losses, if any.
The cost comprises purchase price and directly attributable cost of bringing the investment property to its
working condition for the intended use. Any trade discounts and rebates are deducted in arriving at the purchase
price.
Depreciation on building component of investment property is calculated on a straight-line basis using the rate
arrived at based on the useful life estimated by the management, or that prescribed under the Schedule XIV to
the Companies Act, 1956, whichever is higher. The Group has used the depreciation rate of 1.67% (useful life of
60 years).
On disposal of an investment, the difference between its carrying amount and net disposal proceeds is charged
or credited to the restated consolidated summary statement of profit and loss.
Accounting treatment
Investments, which are readily realisable and intended to be held for not more than one year from the date on
which such investments are made, are classified as current investments. All other investments are classified as
long-term investments.
On initial recognition, all investments are measured at cost. The cost comprises purchase price and directly
attributable acquisition charges such as brokerage, fees and duties. If an investment is acquired, or partly acquired,
by the issue of shares or other securities, the acquisition cost is the fair value of the securities issued. If an
investment is acquired in exchange for another asset, the acquisition is determined by reference to the fair value of
the asset given up or by reference to the fair value of the investment acquired, whichever is more clearly evident.
Current investments are carried in the restated consolidated summary financial statements at lower of cost and
fair value determined on an individual investment basis. Long-term investments are carried at cost. However,
provision for diminution in value is made to recognise a decline other than temporary in the value of long term
investments on individual investment basis.
On disposal of an investment, the difference between its carrying amount and net disposal proceeds is charged or
credited to the restated consolidated summary statement of profit and loss.
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
Classification in the Restated consolidated summary financial statements as per requirements of Revised
Schedule-VI
Investments that are realisable within the period of twelve months from the Balance Sheet date are classified as
current investments. All other investments are classified as non-current investments.
m. Inventories
i. Raw materials are valued at lower of cost or net realisable value. The comparison of cost and net realisable
value is made on an item by item basis. Cost includes purchase price, (excluding those subsequently
recoverable by the enterprise from the concerned revenue authorities), freight inwards and other expenditure
incurred in bringing such inventories to their present location and condition. In determining the cost, first in
first out method is used. The carrying cost of raw materials, packaging materials and stores and spare parts
are appropriately written down when there is a decline in replacement cost of such materials or finished
products in which these will be incorporated are expected to sell below cost.
ii. Work in progress, manufactured finished goods and traded goods are valued at the lower of cost and net
realisable value. The comparison of cost and net realisable value is made on an item by item basis. Cost of
work in progress and manufactured finished goods is determined on the first in first out basis and comprises
direct material, cost of conversion and other costs incurred in bringing these inventories to their present
location and condition. Cost of traded goods is determined on a first in first out basis.
iii. 3URYLVLRQ RI REVROHVFHQFH RQ LQYHQWRULHV LV FRQVLGHUHG RQ WKH EDVLV RI PDQDJHPHQW·V HVWLPDWH EDVHG RQ
demand and market of the inventories.
n. Employee Benefits
All employee benefits payable wholly within twelve months of rendering the service are classified as short
term employee benefits. Benefits such as salaries, wages, and bonus etc are recognised in the restated
consolidated summary statement of profit and loss in the period in which the employee renders the related
service.
Employees of the Group and certain subsidiaries are entitled to receive benefits under the Provident Fund,
which is a defined contribution plan. Both the employee and the employer make monthly contributions to
the plan at a predetermined rate as per the provisions of The Employees Provident Fund and Miscellaneous
Provisions Act, 1952). These contributions are made to the fund administered and managed by the
Government of India.
The Group's contributions to the scheme are expensed off in the restated consolidated summary statement
of profit and loss. The Group has no further obligations under these plans beyond its monthly contributions.
Employees whose wages/salary is within the prescribed limit in accordance with the Employee State Insurance
Act, 1948, are covered under this scheme. These contributions are made to the fund administered and managed
by the Government of India.
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
The Group's contributions to the scheme are expensed off in the restated consolidated summary statement
of profit and loss. The Group has no further obligations under these plans beyond its monthly contributions.
The Group and certain subsidiaries provide for retirement benefits in the form of Gratuity. Benefits payable to
eligible employees of the company with respect to gratuity, a defined benefit plan are accounted for on the
basis of an actuarial valuation as at the Balance Sheet date. In accordance with the Payment of Gratuity Act,
1972, the plan provides for lump sum payments to vested employees on retirement, death while in service or
on termination of employment in an amount equivalent to 15 days basic salary for each completed year of
service. Vesting occurs upon completion of five years of service. The present value of such obligation is
determined by the projected unit credit method and adjusted for past service cost and fair value of plan assets
as at the Balance Sheet date through which the obligations are to be settled. The resultant actuarial gain or
loss on change in present value of the defined benefit obligation or change in return of the plan assets is
recognised as an income or expense in the restated consolidated summary statement of profit and loss. The
expected return on plan assets is based on the assumed rate of return of such assets.
The Company and its subsidiaries contribute to a trust set up by them, which further contribute to a policy
taken from the Life Insurance Corporation of India except in case of G.K. Publications Private Limited.
Benefits under the Group·V DQG FHUWDLQ VXEVLGLDULHV· leave encashment scheme constitute other employee
benefits. The liability in respect of leave encashment is provided on the basis of an actuarial valuation done
by an independent actuary at the end of the year. Actuarial gains and losses are recognised immediately in
the restated consolidated summary statement of profit and loss.
The reporting currency of the Group is the Indian Rupee. However, the local currencies of non-integral
overseas subsidiaries are different from the reporting currency of the Group.
Transactions in foreign currency are recorded at the exchange rate prevailing at the date of the transaction.
Exchange differences arising on foreign currency transactions settled during the year are recognised in the
restated consolidated summary statement of profit and loss.
Monetary assets and liabilities denominated in foreign currencies as at the Balance Sheet date, not covered by
forward exchange contracts, are translated at year end rates. The resultant exchange differences are
recognised in the restated consolidated summary statement of profit and loss. Non-monetary assets are
recorded at the rates prevailing on the date of the transaction. Profit and Loss items at representative offices
located outside India are translated at the respective monthly average rates. Monetary Balance Sheet items at
representative offices at the Balance Sheet date are translated using the year-end rates. Non-monetary
Balance Sheet items are recorded at the rates prevailing on the date of the transaction.
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
Statement of profit and loss items at branch offices located outside India are translated at daily average rates.
Monetary Balance Sheet items at branch offices at the Balance Sheet date are translated using the year-end
rates. Non monetary Balance Sheet items are recorded at the rates prevailing on the date of the transaction.
The financial statements of the foreign integral subsidiaries and representative offices (collectively referred to
DVWKH¶)RUHLJQ,QWHJUDO2SHUDWLRQV·DUHWUDQVODWHGLQWR,QGLDQ5XSHHVDVIROORZV-
x Non-monetary Balance Sheet items, other than inventories, are translated using the exchange rate at the
date of transaction i.e., the date when they were acquired.
x Monetary Balance Sheet items and inventory are translated using year-end rates.
x Profit and Loss items, except opening and closing inventories and depreciation, are translated at the
respective monthly average rates. Opening and closing inventories are translated at the rates prevalent at
the commencement and close respectively of the accounting period. Depreciation is translated at the
rates used for the translation of the values of the assets on which depreciation is calculated.
x Contingent liabilities are translated at the closing rate.
x The net exchange difference resulting from the translation of items in the financial statements of foreign
integral operations is recognised as income or expense for the year.
The financial statements of the foreign non integral subsidiaries and joint venture (collectively referred to as
WKH¶IRUHLJQQRQLQWHJUDORSHUDWLRQV·DUHWUDQVODWHG into Indian Rupees as follows:-
x Share capital and opening reserves and surplus are carried at historical cost.
x All assets and liabilities, both monetary and non-monetary, (excluding share capital, opening reserves and
surplus) are translated using the year-end rates.
x Profit and Loss items are translated at the respective monthly average rates.
x Contingent liabilities are translated at the closing rate.
x The resulting net exchange difference is credited or debited to the foreign currency translation reserve.
A reclassification from foreign integral operations to foreign non-integral operations or vice versa is made
consequent to change in the way operations of entities are financed and operates. The translated amounts for
non-monetary items of reclassified entities on the date of such reclassification are treated as the historical
cost for those items in the period of change and subsequent periods. Exchange differences which have been
deferred in foreign currency translation reserve are not recognised as income or expenses until the disposal of
that entity.
q. Income taxes
Income tax expense comprises current tax (i.e. amount of tax for the year determined in accordance with the
Income-tax law), deferred tax charge or credit and MAT credit entitlement.
Deferred tax charge or credit reflects the tax effects of timing differences between accounting income and
taxable income for the period. The deferred tax charge or credit and the corresponding deferred tax liabilities
or assets are recognised using the tax rates that have been enacted or substantively enacted by the Balance
Sheet date. Deferred tax assets are recognised only to the extent there is reasonable certainty that the assets
can be realised in future; however, where there is unabsorbed depreciation or carry forward of losses, deferred
tax assets are recognised only if there is a virtual certainty of realisation of such assets. Deferred tax assets are
reviewed at each Balance Sheet date and are written-down or written up to reflect the amount that is
reasonably / virtually certain (as the case may be) to be realised.
The break-up of the major components of the deferred tax assets and liabilities as at Balance Sheet date has
been arrived at after setting off deferred tax assets and liabilities where the entity has a legally enforceable
right to set-off assets against liabilities and where such assets and liabilities relate to taxes on income levied
by the same governing taxation laws.
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
0LQLPXP $OWHUQDWH 7D[ ¶0$7· payable under the provisions of the Income Tax Act 1961 is recognised as an
asset in the year in which credit becomes eligible and is set off to the extent allowed in the year in which the
Company becomes liable to pay income taxes at the enacted tax rates. MAT credit is recognised as an asset
only when and to the extent there is convincing evidence that the company will pay normal income tax during
the specified period. In the year in which the MAT credit becomes eligible to be recognised as an asset in
accordance with the recommendations contained in Guidance Note issued by the Institute of Chartered
Accountants of India, the said asset is created by way of a credit to the restated consolidated summary
statement of profit and loss and shown as MAT Credit recoverable. The Company reviews the same at each
Balance Sheet date and writes down the carrying amount of MAT Credit receivable to the extent there is no
longer convincing evidence to the effect that Company will pay normal Income Tax during the specified period.
Provisions
The Group creates a provision when there is present obligation as a result of a past event that probably
requires an outflow of resources and a reliable estimate can be made of the amount of obligation.
Contingent liabilities
A disclosure for a contingent liability is made when there is a possible obligation or a present obligation that
probably will not require an outflow of resources or where a reliable estimate of the obligation cannot be
made.
Contingent assets
Contingent assets are neither recorded nor disclosed in the restated consolidated summary financial
statements.
Cash and cash equivalents include cash in hand, demand deposits with banks, other short term highly liquid
investments with original maturities of three months or less.
t. Exceptional items
Items of income or expense from ordinary activities which are of such size, nature or incidence that, their
disclosure is relevant to explain the performance of the enterprise for the period, are disclosed separately in the
restated consolidated summary statement of profit and loss.
Basic earnings per share are calculated by dividing the net profit or loss for the year attributable to equity
shareholders by the weighted average number of equity shares outstanding during the year. The weighted
average number of equity shares outstanding during the period is adjusted for events of bonus issue, share split
or consolidation of shares.
For calculating diluted earnings per share, the net profit or loss for the year attributable to equity shareholders
and the weighted average number of shares outstanding during the year are adjusted for the effects of all
dilutive potential equity shares. The dilutive potential equity shares are deemed converted as of the beginning of
the period, unless they have been issued at a later date.
v. Segment reporting
CL Educate Limited
Notes to the Restated Consolidated Summary Statement of the Assets and Liabilities, Profit and Loss and Cash Flow
The Group identifies primary segments based on the dominant source, nature of risks and returns and the
internal organisation and management structure. The operating segments are the segments for which separate
financial information is available and for which operating profit/loss amounts are evaluated regularly by the
executive Management in deciding how to allocate resources and in assessing performance.
The accounting policies adopted for segment reporting are in line with the accounting policies of the Company.
Segment revenue, segment expenses, segment assets and segment liabilities have been identified to segments on
the basis of their relationship to the operating activities of the segment.
Inter-segment revenue is accounted on the basis of transactions which are primarily determined based on market
/fair value factors.
Revenue, expenses, assets and liabilities which relate to the Group as a whole and are not allocable to
VHJPHQWVRQUHDVRQDEOHEDVLVKDYHEHHQLQFOXGHGXQGHU´XQDOORFDWHGUHYHQXHH[SHQVHV DVVHWVOLDELOLWLHVµ
Share issue expenses are adjusted against the securities premium account as permissible under Section 78 of the
Act, to the extent balance is available for utilization in the securities premium account. The balance of share
issue expenses in excess of securities premium account, if any, are charged to restated consolidated summary
statement of profit and loss.
x. Material events
Material events occurring after the Balance Sheet date are taken into cognizance.
CL Educate Limited
As at March 31, 2014 As at March 31, 2013 As at March 31, 2012 As at March 31, 2011 As at March 31, 2010
Particulars
Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions
Authorised
Equity shares of ൘ 10 each with equal voting rights 13,000,000 130.00 13,000,000 130.00 13,000,000 130.00 13,000,000 130.00 13,000,000 130.00
Preference shares of ൘ 10 each 2,000,000 20.00 2,000,000 20.00 2,000,000 20.00 2,000,000 20.00 2,000,000 20.00
Issued, subscribed and fully paid up
Equity shares of ൘ 10 each with equal voting rights 9,417,810 94.18 9,417,810 94.18 9,334,706 93.35 8,749,003 87.49 8,749,003 87.49
(Class -I)
Compulsorily convertible 0.01% non cumulative 411,045 4.11 411,045 4.11 - - - - - -
preference shares (CCPS) of ൘10 each (Class -II)
Total issued, subscribed and fully paid-up share 9,917,810 99.18 9,917,810 99.18 9,334,706 93.35 9,435,248 94.35 8,749,003 87.49
capital
Footnotes:
1) The figures disclosed above are based on the restated unconsolidated summary statement of assets and liabilities of the Company.
2) The Company has four classes of shares i.e. Equity shares (Class-I), Compulsorily convertible 0.01% non cumulative preference shares (CCPS)(Class -II), Optionally convertible 0.01% non cumulative
preference shares (OCPS)(Class- III) and Compulsorily convertible 0.01% non cumulative preference shares (CCPS) (Class -IV) each class having a par value of ൘ 10 per share.
A) Voting
1) Class-I shares-Equity shares: Each holder of this class of shares is entitled to one vote per share held.
2) Class-II shares-CCPS: This class of shares do not carry any voting rights.
3) Class-III shares-OCPS: This class of shares do not carry any voting rights.
4) Class-IV shares-CCPS: This class of shares do not carry any voting rights.
B) Dividends
1) Class-I shares-Equity shares: The Company declares and pays dividends in Indian rupees. The dividend proposed by the Board of Directors is subject to approval of the shareholders in ensuing
Annual General Meeting except in the case where interim dividend is distributed.
2) Class-II shares-CCPS: The Company declares and pays dividends in Indian rupees. CCPS has preferential right of dividend over equity shares in event of declaration of dividend. These shares carry
dividend rate of 0.01%. The dividend is payable only when the Company declares dividend during a particular financial year.
3) Class-III shares-OCPS: The Company declares and pays dividends in Indian rupees. OCPS has preferential right of dividend over equity shares in event of declaration of dividend. These shares carry
dividend rate of 0.01%. The dividend is payable only when the Company declares dividend during a particular financial year.
4) Class-IV shares-CCPS: The Company declares and pays dividends in Indian rupees. CCPS has preferential right of dividend over equity shares in event of declaration of dividend. These shares carry
dividend rate of 0.01%. The dividend is payable only when the company declares dividend during a particular financial year.
C) Liquidation
1) Class-I shares-Equity shares: In the event of liquidation of the Company, the holders of equity shares shall be entitled to receive all of the remaining assets of the Company, after distribution of
all preferential amounts, if any. Such distribution amounts will be in proportion to the number of equity shares held by the shareholders.
2) Class-II shares-CCPS: In the event of liquidation of the Company, the holders of CCPS shall be entitled to receive all of the remaining assets of the Company, after distribution of all preferential
amounts, if any and before payment to equity shareholders. Such distribution amounts will be in proportion to the number of CCPS held by the shareholders upto the extent of agreed conversion
amount of such shares.
3) Class-III shares-OCPS: In the event of liquidation of the Company, the holders of OCPS shall be entitled to receive all of the remaining assets of the Company, after distribution of all preferential
amounts, if any and before payment to equity shareholders. Such distribution amounts will be in proportion to the number of OCPS held by the shareholders upto the extent of agreed
redemption/conversion amount of such shares.
4) Class-IV shares-CCPS: In the event of liquidation of the Company, the holders of CCPS shall be entitled to receive all of the remaining assets of the Company, after distribution of all preferential
amounts and before payment to equity shareholders, if any. Such distribution amounts will be in proportion to the number of CCPS held by the shareholders upto the extent of agreed conversion
amount of such shares.
CL Educate Limited
If the Consolidated audited EBITDA of the Company for the year ended March 31, 2013 is less than ൘ 360.00 million or if audited consolidated financial statements are not made available to
shareholder by September 30, 2013, shareholder shall have right, exercisable at its sole discretion at any time by written notice to the Company and the founders and the Company, to require the
Company to convert all of their shareholding as Class-II shares-CCPS into such number of equity shares that ensures shareholder an internal rate of return of 15% on the investment amount calculated
from the closing date upto the date of such conversion.Founders and the Company, jointly and severally undertake and agree to shareholder, to procure third parties to acquire and purchase of all
of the Class-II shares-CCPS held by shareholder at conversion price arrived in accordance with the shareholder agreement. In event such purchase by third party doesn't happen in 60 days of
conversion, founders and the Company are jointly and severally liable to purchase the same at above mentioned conversion price 3)
If for any reason whatsoever under applicable laws the Company is unable to undertake the conversion, shareholder shall have the right to seek the conversion of these shares at a price per equity
share of ൘ 425.If the Company subsequently raises additional fund through issue of new shares at a price per share lower than above conversion price, the the following conditions shall apply: i. If
shareholder has already exercised its options under above then the founders shall procure the Company to, and the Company shall take all reasonable steps to issue such number of additional equity
shares to the shareholder as if the Class-II shares-CCPS had converted at a price per share equal to the price per share of such new shares. Such additional equity shares shall, subject to applicable
laws be issued at no further cost to shareholder. ii. If shareholder has not exercised its options under Conversion Price 1 and Conversion Price 2, then at shareholder's options, CCPS may be
converted into equity shares of the Company at a price per share equal to the price of such new share.
2) During the year ended March 31 2013, On December 14, 2012, 88,955 class-II, 0.01% OCPS of ൘10 each. Each share holder of OCPS has to get his share converted into equity share or redeemed in
cash as per price of conversion mentioned in conditions at any time. Conversion option avalable to shareholder's were 1) If Company raises additional funds of a minimum of ൘100.00 million through
the issue of new shares within a period of 90 days i.e. Feb 7, 2013 from the closing date i.e. November 9, 2012, the OCPS shall be converted into equity shares at a price per share equal to the price
per share of the new shares so issued in a manner to yield an IRR of 15% per annum, calculated on daily basis for the period from the closing date till the date on which the New Shares are so
issued.2) If the Company does not raise additional funds within 90 days from the closing date or if the Company raises additional funds of less than ൘100.00 million through the issue of new shares
within a period of 90 business days from the closing date, the OCPS shall be converted into equity shares at a price per share based on aggregate equity valuation of such fund raised of less than
൘100.00 million or 12.5 multiplied by the EBITDA as per audited consolidated financial statements of the Company and its subsidiaries for the twelve month period ended March 31, 2013, whichever
is lower.
If the Consolidated audited EBITDA of the Company for the year ended March 31, 2013 is less than ൘ 360.00 million or if audited consolidated financial statements are not made available to
shareholder by September 30, 2013, shareholder shall have right, exercisable at its sole discretion at any time by written notice to the Company and the founders and the Company, to require the
Company, to redeem all of their shareholding as Class-III shares-OCPS at a price that ensures shareholder an internal rate of return of 15% on the investment amount calculated from the closing date
upto the date of such redemption.Founders and the Company, jointly and severally undertake and agree to shareholder, to procure third parties to acquire and purchase of all of the Class-III shares-
OCPS held by shareholder at conversion price arrived in accordance with shareholder agreement. In event such purchase by third party doesn't happen in 60 days of conversion, founders and the
Company are jointly and severally liable to purchase the same at above mentioned conversion price 3.
If for any reason whatsoever under applicable laws the Company is unable to undertake the conversion/redemption, shareholder shall have the right to seek the conversion of these shares at a price
per equity share of ൘ 425.If the Company subsequently raises additional fund through issue of new shares at a price per share lower than above conversion price, the the following conditions shall
apply: i. If shareholder has already exercised its options under above then the founders shall procure the Company to, and the Company shall take all reasonable steps to issue such number of
additional equity shares to shareholder as if the Class-III shares-OCPS had converted at a price per share equal to the price per share of such new shares. Such additional equity shares shall, subject
to applicable laws be issued at no further cost to shareholder. ii. If shareholder has not exercised its options under Conversion Price 1 and Conversion Price 2, then at shareholder's options, The Class-
III shares-OCPS may be converted into equity shares of the Company at a price per share equal to the price of such new share.
3) During the year ending March 31 2012 company issued 525,000 0.01% Class-IV shares-CCPS. Each share holder of these CCPS had to get his share converted into equity share at the end of one year
or the happening of Initial Public Offerings (IPO) whichever is earlier.If any dividend is paid prior to the conversion of these CCPS, then the dividend on these shares shall be payable based on the
notional number of equity shares to be issued upon the conversion of these CCPS into equity shares at ൘ 417 per share.The CCPS had to be adjusted for bonus, splits, rights and any other corporate
actions applicable to equity shares.These shares were converted into 251,796 equity shares of ൘ 10 each at a premium of ൘ 407 per share during financial year 2011-12.
4) During the year ending March 31 2011 company had issued 686,245 0.01% Class-IV shares-CCPS. Each share holder of these CCPS had to get his share converted into equity share at the end of one
year or the happening of Initial Public Offerings (IPO) whichever is earlier.If any dividend is paid prior to the conversion of these CCPS, then the dividend on these shares shall be payable based on
the notional number of equity shares to be issued upon the conversion of these CCPS into equity shares at ൘ 417 per share.The CCPS had to be adjusted for bonus, splits, rights and any other
corporate actions applicable to equity shares.These shares were converted into 329,132 equity shares of ൘ 10 each at a premium of ൘ 407 per share during financial year 2011-12.
4) Reconciliation of shares outstanding as at the beginning and at the end of the reporting period
March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Particulars
Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions
At the beginning of year 9,417,810 94.18 9,334,706 93.35 8,749,003 87.49 8,749,003 87.49 8,743,003 87.43
Add: Share issued during the year by way of: - - - - - -
-Allotment of share for a consideration otherwise - - 83,104 0.83 - - - - 6,000 0.06
than in cash
- Employee stock option plan - - - - 4,775 0.05 - - - -
-conversion of Compulsorily convertible 0.01% non - - - - 580,928 5.81 - - - -
cumulative preference shares (CCPS) of ൘10 each
(previous year ൘10) (Class -IV)
Outstanding at the end of the year 9,417,810 94.18 9,417,810 94.18 9,334,706 93.35 8,749,003 87.49 8,749,003 87.49
CL Educate Limited
B) Class-II shares-CCPS
March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Particulars
Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions
At the beginning of the year 411,045 4.11 - - - - - - - -
Add: Share issued during the year - - 411,045 4.11 - - - - - -
Outstanding at the end of the year 411,045 4.11 411,045 4.11 - - - - - -
C) Class-III shares-OCPS
March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Particulars
Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions
At the beginning of the year 88,955 0.89 - - - - - - - -
Add: Share issued during the year - - 88,955 0.89 - - - - - -
Less: conversion into equity shares - - - - - - - - - -
Outstanding at the end of the year 88,955 0.89 88,955 0.89 - - - - - -
D) Class-IV shares-CCPS
March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Particulars
Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions Numbers ൘ in Millions
5) Shares held by the holding company/ultimate holding company and/or their associates/ subsidiaries and shareholders holding more than 5% shares in the Company.
March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Name of share holders
Numbers % held Numbers % held Numbers % held Numbers % held Numbers % held
Mr. Gautum Puri 2,549,186 27.07% 2,549,186 27.07% 2,549,186 27.31% 2,549,186 29.14% 2,549,186 29.14%
Mr. Satya Narayanan R 2,549,186 27.07% 2,549,186 27.07% 2,549,186 27.31% 2,549,186 29.14% 2,549,186 29.14%
Bilakes Consulting Private Limited 786,859 8.36% 786,859 8.36% 786,859 8.43% 786,859 8.99% 786,859 8.99%
GPE (India) Limited 765,747 8.13% 765,747 8.13% 765,747 8.20% 575,807 6.58% 575,807 6.58%
Mr. Sreenivasan R 449,698 4.77% 449,698 4.77% 449,698 4.82% 449,698 5.14% 449,698 5.14%
Mr. Shivakumar R 449,698 4.77% 449,698 4.77% 449,698 4.82% 449,698 5.14% 449,698 5.14%
7,550,374 70.62% 7,550,374 70.62% 7,550,374 80.88% 7,360,434 84.13% 7,360,434 84.13%
B) Class-II shares-CCPS
March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Name of share holders
Numbers % held Numbers % held Numbers % held Numbers % held Numbers % held
GPE (India) Limited 411,045 100.00% 411,045 100.00% - - - - - -
411,045 100.00% 411,045 100.00% - - - - - -
C) Class-III shares-OCPS
March 31, 2014 March 31, 2013 March 31, 2012 March 31, 2011 March 31, 2010
Name of share holders
Numbers % held Numbers % held Numbers % held Numbers % held Numbers % held
Gaja Trustee Company Private Limited 88,955 100.00% 88,955 100.00% - - - - - -
88,955 100.00% 88,955 100.00% - - - - - -
As per records of the Company, including its register of shareholders/members, the above shareholding represents both legal and beneficial ownerships of shares.
6) No class of shares have been issued as bonus shares and shares issued for consideration other than cash during the period of five years immediately preceeding the reporting date except
for one class of shares for which detail of shares alloted is as under:
As at March 31
Particulars
2014 2013 2012 2011 2010
Equity shares allotted as fully paid-up pursuant to contracts for consideration other than cash 670,032 670,032 636,928 56,000 56,000
Total 670,032 670,032 636,928 56,000 56,000
In addition, the Company has issued 4,775 equity shares of ൘ 10 each fully paid up during the period of five years on exercise of options granted under the employee stock option plans wherein part
consideration was received in the form of employee services.
CL Educate Limited
7) No class of shares have been bought back by the Company during the period of five years.
8) Shares reserved for issue under options: Refer annexure XXXVII for details of shares to be issued under ESOP.
7KH&RPSDQ\KDVRQHVWRFNRSWLRQSODQ(PSOR\HHVWRFNRSWLRQVDUHFRQYHUWLEOHLQWRHTXLW\VKDUHVLQDFFRUGDQFHZLWKWKHUHVSHFWLYHHPSOR\HHV·VWRFNRSWLRQSODQ
Pursuant to the resolution passed by the Board of Directors at its meeting on March 6, 2008 and the Special Resolution passed by the members in the extraordinary general meeting held on March 31,
2008, the Company introduced ´&DUHHU Launcher Employee Options Plan µ which provides for the issue of 250,000 equity shares to employees of the Company and its subsidiaries. All the above
options granted are planned to be settled in equity at the time of exercise and have maximum vesting period of 3 years from the date of respective grants. As at March 31, 2014 March 31, 2013,
March 31, 2012, March 31, 2011 and March 31, 2010 the Company had 56,143; 66,268; 35,032; 72,532 and 54,520 number of shares reserved for issue under the scheme respectively.
Pursuant to the Special Resolution passed by the members in the extraordinary general meeting held on May 29, 2013, and the resolution passed by the Board of Directors at its meeting on January
WKH&RPSDQ\UHQHZHG´&DUHHU/DXQFKHU(PSOR\HH6WRFN2SWLRQV3ODQµIRUIXUWKHUSHULRGVLHXSWR0D\DQG0DUFKUHVSHFWLYHO\
9. Summary of significant changes in capital structure of the Company subsequent to March 31, 2014
a) Pursuant to the resolution passed in the board meeting held on September 5, 2014, the Company has increased its authorised equity share capital from ൘ 130.00 million to ൘ 160.00 million.
b) The Company issued 12,917 and 10,569 equity shares of ൘ 10 each to Rakesh Mittal and Poonam Mittal respectively, promoters of G. K. Publications Private Limited, pursuant to investment
agreement dated November 12, 2011 regarding acquisition of equity shares held by them in G. K. Publications Private Limited.
c) Pursuant to Employee Stock Option Plan 2008 (CL ESOP -2008) the Company issued 2400 and 500 equity shares of ൘ 10 to independent directors and employees respectively wherein part
consideration was received in form of employee services.
d) Pursuant to the resolution passed in the board meeting held on July 22, 2014, the Company on September 5, 2014 converted 411,045 class- II, 0.01% CCPS and 88,955 class- III, 0.01% OCPS of ൘ 10
each to 193,433 and 41,861 Class-I equity shares of ൘ 10 each respectively on the basis of terms and conditions as stipulated in the agreements executed with the shareholders and the Company.
e) Pursuant to the resolution passed in the board meeting held on August 11, 2014, the Company on September 5, 2014 swaped its shares with the shareholders of CLEIS in the share swap ratio of
2.10:1. The same has resulted in issue of 904,139 equity shares of ൘ 10 each against 1,898,684 equity shares of ൘ 10 each of CLEIS. The said shares were issued at a premium of ൘ 580 per share.
f) On September 5, 2014 company has issued 230,000 and 594,233 equity shares of ൘ 10 each at a premium of ൘ 580 per share through preferential allotment to GPE (India) Limited and HDFC Limited
respectely.
g) On September 16, 2014 company has issued 237,293 equity shares of ൘ 10 each at a premium of ൘ 580 per share through preferential allotment to GPE (India) Limited.
CL Educate Limited
VI.D. Capital reserves (Others) (D) 0.02 0.02 0.02 0.02 0.02
VI.H. Surplus in the restated consolidated summary of statement of profit and loss
Opening balance 302.19 157.32 210.18 118.53 66.04
(+) Net profit/(loss) for the year 154.80 144.70 (52.80) 88.70 46.50
(+) Transferred from FCTR 6.20 - - - 0.38
(+) Adjustment on account of change in minority interest (7.02) 0.17 (0.06) 2.95 -
(+) Other adjustments - - - - 5.61
Closing balance (H) 456.17 302.19 157.32 210.18 118.53
Total reserves and surplus (A+B+C+D+E+F+G+H) 1,394.40 1,235.98 953.05 896.13 576.27
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure VII - Restated consolidated summary statement of share application money pending allotment
1) The share application money of ൘ 13.86 million outstanding as at March 31, 2014 represents part consideration towards investment in G.K. Publications Private Limited as stipulated in the
investment agreement entered on November 12, 2011 with the promoters of G.K. Publications Private Limited.
The consideraion is discharged by way of issue of 12,917 and 10,569 equity shares of ൘ 10 each at a premium of ൘ 580 per share, on September 5, 2014 to former promoters of G.K. Publications
Private Limited, Rakesh Mittal and Poonam Mittal respectively (refer annexure XXXV).
2) Share application money of ൘ 29.45 million outstanding as at March 31, 2012 represents part consideration towards investment in G.K. Publications Private Limited as stipulated in the
investment agreement entered on November 12, 2011 with the promoters of G.K. Publications Private Limited. The Company issued 47,416 equity shares of ൘ 10 each at a premium of ൘ 611 each
on May 1, 2012.
3) During the year ended March 31, 2011, the Company received an amount of ൘ 100.31 million towards share application money for issue of 501,537 0.01% compulsorily convertible non
cumulative preference shares of ൘ 10 each to be issued at a premium of ൘ 190 per share. The Company issued 525,000; 0.01% compulsorily convertible non cumulative preference shares of ൘ 10
each at a premium of ൘ 190 per share on April 29, 2011.
4) The figures disclosed above are based on the restated summary statement of assets and liabilities of the Company.
5) The above statement should be read with annexures to the restated summary statement of assets and liabilites, profit and loss and cash flow.
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
-From others
a) Term loan (Refer footnote 5) 212.85 215.00 114.23 125.00 196.43
Unsecured loans
-From banks
a) Term loans (Refer footnote 6) 1.27 2.64 - - -
-From others
b) From others (Refer footnote 7) 1.73 3.99 16.92 - -
Total 235.02 258.40 329.64 335.53 357.69
(൘ in Million)
Current maturities
Particulars As at March 31
2014 2013 2012 2011 2010
-From others
a) Term loan (Refer footnote 5) 2.15 - 101.61 71.43 -
Unsecured loans
-From banks
a) Term loans (Refer footnote 6) 1.37 1.15 - - -
-From others
b) From others (Refer footnote 7) 2.21 13.74 - - -
54.52 113.10 118.18 77.81 55.39
The above amount includes
$PRXQWGLVFORVHGXQGHUWKHKHDG´2WKHUFXUUHQWOLDELOLWLHVµ5HIHUDQQH[XUH;,9 (54.52) (113.10) (118.18) (77.81) (55.39)
Net Amount - - - - -
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
3) Vehicle loans from banks are secured against hypothecation of concerned vehicles. The repayment terms of the vehicle loans are as follows:
(൘ in Million)
Loan Rate of Interest Equal monthly installment Date of Last EMI Outstanding Amount as at March 31,
(EMI) 2014 2013 2012 2011 2010
Loan 1 11.53% 0.03 January 5, 2017 0.94 1.21 1.45 - -
Loan 2 11.99% 0.03 May 7, 2016 0.75 1.04 1.29 - -
Loan 3 12.27% 0.02 July 9, 2016 0.64 0.84 1.02 - -
Loan 4 12.24% 0.02 June 14, 2016 0.50 0.69 0.86 - -
Loan 5 9.03% 0.03 July 1, 2013 - 0.10 0.39 0.65 -
Loan 6 11.07% 0.02 June 7, 2013 - 0.05 0.23 0.39 0.53
Loan 7 8.89% 0.02 Feburary 1, 2013 - - 0.22 0.43 0.63
Loan 8 12.16% 0.01 July 7, 2012 - - - 0.21 0.35
Loan 9 14.02% 0.03 July 5, 2011 - - - 0.13 0.48
Loan 10 11.25% 0.02 June 5, 2011 - - - 0.06 0.28
Loan 11 11.25% 0.03 April 20, 2011 - - - 0.03 0.31
Loan 12 11.25% 0.01 April 20, 2011 - - - 0.01 0.17
Loan 13 6.74% 0.01 January 7, 2011 - - - - 0.13
Loan 14 6.74% 0.03 August 2, 2010 - - - - 0.14
Loan 15 6.76% 0.01 August 2, 2010 - - - - 0.06
Total 2.83 3.93 5.46 1.91 3.08
During the financial year 2012-13, the Company and CL Media Private Limited had entered into a finance facility agreement amounting ൘ 366.90 Million with Kotak Mahindra Bank, under which
various term loans and overdrafts have been availed at different times during the financial year 2013-14 and financial year 2012-13.
The term loans comprise four loans of ൘ 104.47 Million, ൘ 83.56 Million, ൘ 12.00 Million and ൘ 35.00 Million. Year end balances of these loans are ൘ Nil, ൘ 26.73 Million, ൘ 7.27 Million and ൘ 31.12
Million respectively.
Interest rate:
These loans carry interest at Bank's base rate + 4.25% per annum ranging from 14% to 14.25% .
Repayment schedule:
The loan of ൘ 104.47 million was repayable in 17 equal monthly instalments of ൘ 6.81 Million (inclusive of interest) for which December 15, 2013 was the last instalment date.
The loan of ൘ 83.56 Million is repayable in 28 equal monthly instalments of ൘ 3.52 (inclusive of interest) for which November 15, 2014 is the last instalment date.
The loan of ൘ 12.00 Million is repayable in 36 equal monthly instalments of ൘ 0.41 Million (inclusive of interest) for which November 10, 2015 is the last instalment date.
The loan of ൘ 35.00 Million is repayable in 24 equal monthly instalments of ൘ 1.68 Million (inclusive of interest) for which December 25, 2015 is the last instalment date.
Primary security
These loans are secured by way of first and exclusive charge on all present and future current and moveable assets including moveable fixed assets of the Company.
Collateral security
The loans are further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
- Lien over fixed deposits of ൘ 130.00 Million
These properties are common collateral for exposure of the bank in CL Media Private Limited (a wholly owned subsidiary company) for overdraft limit of ൘ 25.00 Million.
All secured loans are further secured by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan (promoters and directors).
The Company and CL Media Privatte Limited during the year has obtained term loans from Kotak Mahindra Bank. This amount comprise three loans of ൘104.47 Million, ൘83.56 Million and ൘ 12.00
Million and various overdrafts. These loans carry interest at Bank's base rate + 4.25% per annum ranging from 13.50% to 14%. Year end balances of these loans are ൘57.82 Million, ൘62.34 Million
and ൘10.88 Million respectively.
Repayment schedule:
The loan of ൘ 104.47 Million is repayable in 17 equal monthly installments of ൘ 6.81 Million (inclusive of interest) for which December 15, 2013 is the last installment date.
The loan of ൘ 83.56 Million is repayable in 28 equal monthly installments of ൘ 3.52 Million (inclusive of interest) for which November 15, 2014 is the last installment date.
The loan of ൘ 12.00 is repayable in 36 equal monthly installments of ൘ 0.41 Million (inclusive of interest) for which November 10, 2015 is the last installment date.
Primary security
This loans are secured by way of first and exclusive charge on all present and future current and moveable assets including moveable fixed assets of the Company.
CL Educate Limited
Collateral security
The loans are further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
- Lien over fixed deposits of ൘ 145.00 Million.
These properties are common collateral for exposure of the bank in CL Media Private Limited (a wholly owned subsidiary company) for overdraft limit of ൘ 25.00 Million.
All secured loans are further secured by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan (promoters and directors).
For the year ended March 31, 2012, March 31, 2011 and March 31, 2010
Secured term loans represent loans taken by Career Launcher Infrastructure Private Limited ('CLIP') as consortium loan from Axis Bank Limited and Punjab National Bank.
For the year ended March 31, 2014 and March 31, 2013
Secured term loan from others represents loan taken by CLIP, a wholly owned subsidiary of CLEIS, the subsidiary of CL Educated Limited ("CL").
b) First charge on all receivables, present and future, arising from the above mentioned projects, from Indus world school, located at 9, Sanyogitaganj, Near Mission Hospital, Chhawani, Indore
and all other schools that are being run by Nalanda Foundation.
c) First charge on all bank accounts of CLIP, including without limitation to the project account/trust and retention account/escrow accounts, debt service reserve account and any other
accounts wherever mentioned.
e) First charge on all bank accounts of CLEIS, including without limitation to Project account/Trust and retention account/Escrow account Debt service reserve account and any other accounts
wherever mentioned.
g) First charge on bank accounts of Nalanda Foundation related to all schools under Nalanda Foundation.
k) Personal guatantees of Mr. Satya Narayanan R., Mr. Gautam Puri, Mr. Sujit Bhattacharyya, Mr. Sreenivasan R., Mr. Shiv Kumar Ramachandran and Mr. Nikhil Mahajan.
l) Undertaking from CLEIS to the effect that: 1.) they will continue to hold at least 51% of equity share capital of CLIP throughout the tenor of the loan 2.) to provide funds by way of additional
equity/unsecured loans to CLIP for project completion and meeting cost overruns of the project if any including interest and principal repayments.
m) Undertaking from CL, to the effect that: 1.) they will continue to hold at least 51% of equity share capital of CLEIS throughout the tenor of the loan 2.) to provide funds by way of additional
equity/unsecured loans to CLIP for project completion and meeting cost overruns of the project if any including interest and principal repayments.
CL Educate Limited
n) Undertaking from Nalanda Foundation that payment to CLIP towards payment of loans will be made prior to any other payments after day to day expenses are met.
o) Any other security of equivalent or higher amount that may be acceptable to the lender, HDFC Limited. There is no other security demanded by the lenders as at March 31, 2014 & March 31,
2013.
Rate of interest
Rate of interest shall be variable and linked to HDFC's Corporate Prime Lending Rate (CPLR) and shall be lower than the same by 325 basis points. The applicable interest rate will be
reviewed/reset on monthly basis i.e. on first day of every calender month.
Terms of repayment
The loan shall be repaid by way of 32 unequal quarterly instalments with the first instalment falling due on February 28, 2015.
During the financial year 2011-12 secured term loans were taken by the Company from L & T Finance Limited comprising of two loans of ൘ 100.00 million and ൘ 142.85 million. Both loans carry
interest @ 14% per annum. Year end balances of both the loans were for financial year ending March 31, 2012 ൘ 215.84 million.
The loan of ൘ 100.00 million was repayable in 36 equal monthly instalments of ൘ 3.41 million (inclusive of interest) for which November 10, 2014 is the last instalment date.The loan of ൘ 142.85
million was repayable in 24 monthly instalments of equal principal of ൘ 5.95 million each along with interest thereon for which December 1, 2013 was the last instalment date. However, the loan
was prepaid during the financial year 2012-13.
This loan is secured by way of first pari passu charge on all immovable and movable fixed assets and all the current assets of the Company. All secured loans are further secured by way of
personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan (promoters and directors).
The loan was further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
Term loan was taken by the Company during the financial year 2009-10 of ൘ 250.00 million from L & T Finance Limited, which carrying an interest rate of 12.50% and payable in 42 equal
instalments of ൘ 5.95 million each along with interest thereon for which December 1, 2013 was the last instalment date.This loan was secured by way of first pari passu charge on all immovable
and movable fixed assets and all the current assets of the Company. All secured loans were further secured by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan
(promoters and directors). However, the loan was prepaid during the financial year 2012-13.
The loan was further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
During the financial year 2009-10 secured term loan of ൘ 250.00 million was taken by the Company from L & T Finance Limited which carrying an interest rate of 12.50% and payable in 42 equal
instalments of ൘ 5.95 million each along with interest thereon for which December 1, 2013 was the last instalment date. This loan was secured by way of first pari passu charge on all immovable
and movable fixed assets and all the current assets of the Company. All secured loans were further secured by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan
(promoters and directors). However, the loan was prepaid during the financial year 2012-13.
The loan was further secured by equitable mortgage on following properties of the Company:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
This loan carries interest rate 17.50% p.a. (Current base rate + Margin of 7.75%).
Terms of repayment
൘ 1.37 Million repayable in next one year from March 31, 2014, and ൘ 1.27 Million repayable in second year.
This loan carries interest rate 17.50% p.a. (Current base rate + Margin of 7.75%).
CL Educate Limited
Terms of repayment
൘ 1.15 Million repayable in next one year from March 31, 2014, ൘ 1.37 Million repayable in second year and ൘ 1.27 Million repayable in third year.
This comprise of two loans from Non Banking Finance Companies outstanding as the year end of ൘ 2.15 Million and ൘ 1.79 Million availed by Kestone Integrated Marketing Services Private Limited
(Kestone).
Loan of ൘ 2.15 Million carries interest rate of 16.64% ൘ 1.17 Million repayable in next one year from March 31, 2014 and ൘ 0.98 Million repayable in second year.
Loan of ൘ 1.79 Million carries interest rate of 19.35% ൘ 1.04 Million repayable in next one year from March 31, 2014 and ൘ 0.75 Million repayable in second year.
This comprise of two loans from Non Banking Finance Companies outstanding as the year end of ൘ 3.73 Million and ൘ 3.25 Million availed by Kestone.
Loan of ൘ 3.73 Million carries interest rate of 16.64% ൘ 1.57 Million repayable in next one year from March 31, 2013, ൘ 1.18 Million repayable in second year and ൘ 0.98 Million repayable in third
year.
Loan of ൘ 3.25 Million carries interest rate of 19.35% ൘ 1.46 Million repayable in next one year from March 31, 2013, ൘ 1.04 Million repayable in second year and ൘ 0.75 Million repayable in third
year.
Persuant to the shareholders agreement dated November 12, 2010 entered into with the promoters of G K Publications Private Limited ('GKP') to acquire 100% equity shares of GKP held by them,
the Company guaranteed the loan taken by GKP from its director/promoter. The loan was repayable by June 30, 2013 (Refer annexure XXXV).
Persuant to the shareholders agreement dated November 12, 2010 entered into with the promoters of G K Publications Private Limited ('GKP') to acquire 100% equity shares of GKP held by them,
the Company guaranteed the loan taken by GKP from its director/promoter. The loan was repayable by June 30, 2013 (Refer annexure XXXV).
CL Educate Limited
Net deferred tax assets/ (liabilities) (16.97) 2.54 (14.44) 25.99 11.55 (37.10) (25.55) 26.95 1.41
Presentation in the restated consolidated summary statement of assets and liabilities as per tax jurisdictions:
As at March 31
Particulars
2014 2013 2012 2011 2010
Total deferred tax assets of net deferred tax assets jurisdiction entities 1.60 1.10 35.23 4.55 6.09
Total deferred tax liabilities of net deferred tax liabilities jurisdiction entities (18.57) (15.54) (23.68) (30.10) (4.68)
(16.97) (14.44) 11.55 (25.55) 1.41
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. The net deferred tax assets as at March 31, 2009 was ൗ 9.39 million. Accordingly net reversal of deferred tax assets by ൘ 7.98 million has been recorded as charge in the restated consolidated
statement of profit and loss for the year ended March 31, 2010.
4. Net deferred tax assets and net deferred tax liabilities in different entities have not been set off considering the provisions of AS - 22.
CL Educate Limited
Annexure XI - Restated consolidated summary of statement of provisions
(൘ in Million)
Long-term
Particulars As at March 31
2014 2013 2012 2011 2010
Provision for employees benefit
Gratuity (Refer annexure XXXVI) 11.93 8.84 5.75 4.94 2.33
Leave encashment (Refer annexure XXXVI) 8.46 6.38 4.61 5.50 5.05
Total 20.39 15.22 10.36 10.44 7.38
(൘ in Million)
Short-term
Particulars As at March 31
2014 2013 2012 2011 2010
Provision for tax (net of advance taxes) (refer footnote i) 23.73 11.95 1.08 - 0.12
Total A 23.73 11.95 1.08 - 0.12
Provision for sales return (Refer footnote ii) B 1.35 1.00 0.71 - -
ii. Provision for sales return has been created for estimated loss of margin on expected sales returns in future period against products sold during the year. The provision has been recorded based
on management's best estimate as per past trend. As required by AS-29, following is the movement in provision made:
(൘ in Million)
As at March 31
Particulars
2014 2013 2012 2011 2010
Opening balance 1.00 0.71 - - -
(+) Additions during the year 1.35 1.00 8.40 2.13 -
(-) Utilised/reversed during the year (1.00) (0.71) (7.69) (2.13) -
Closing balance 1.35 1.00 0.71 - -
iii. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
iv. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. All unsecured loans are repayable on demand, except ൘ 20 Million outstanding on March 31, 2012 which was payable within one year from March 31, 2012.
4. Details of these loans are as follows:
Cash credit represents three loans from Kotak Mahindra Bank taken by CL Educate Limited, CL Media Private Limited ('CLM') and GKP and two loans from IndusInd Bank taken by Kestone and GKP
which are repayable on demand.
2. Security details:
Primary security
First and exclusive charge on all present and future current and movable assets including movable fixed assets of the Company.
Collateral security
Lien over the fixed deposit of ൗ 15.00 Million.
All secured loans are further secured by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan (promoters and directors).
The facility carries an interest rate of bank's base rate + 4.25% per annum payable on monthly basis.
Primary security
First and exclusive charge on entire current assets of Kestone both present and future.
Collateral security
First and exclusive charge on movable fixed assets of the Company both present and future.
3. All secured loans are further secured by way of personal guarantees of Gautam Puri and Nikhil Mahajan (directors).
4. Corporate guarantee of CL Educate Limited.
5. Lien on fixed deposits amounting to ൘ 15.00 Million.
Cash credit represents two loans from Kotak Mahindra Bank taken by CL Educate Limited & CLM and one loan from IndusInd Bank taken by Kestone which are repayable on demand.
Collateral security
First and exclusive charge on movable fixed assets of Kestone, both present and future.
All secured loans are further secured by way of personal guarantees of Gautam Puri and Nikhil Mahajan (directors).
Cash credit represents overdrafts from Kotak Mahindra Bank and HDFC Bank taken by CL Educate Limited, and two loans from IndusInd Bank taken by Kestone which are repayable on demand.
Overdraft from Kotak Mahindra Bank is primarily secured by way of lien over fixed deposit of ൘ 25.00 Million and by first and pari passu charges with L & T Finance Limited on all existing and
future current assets/ movable fixed assets of the Company. It is further secured by a collateral security of equitable mortgage over the following properties pari passu with L & T Finance Limited:
- Plot No. 15-A , Block II , Knowledge Park, Greater Noida
- Plot No. 9A, Sector 27-A, Faridabad
- Office space No. 1 and 2, Third Floor, FC Road, Shivaji Nagar, Pune
- Unit No. 207, Second Floor, District Centre, Laxmi Nagar, Delhi
- Office Space No. 201, Second Floor, Business Point, Andheri West, Mumbai.
All secured loans are further secured by way of personal guarantees of Satyanarayan R., Gautam Puri and Nikhil Mahajan (promoters and directors).
For the years ended March 31, 2011 and March 31, 2010
Cash credit represents overdrafts from Kotak Mahindra Bank taken by CL Educate Limited, and cash credit borrowings from IndusInd Bank taken by Kestone which are repayable on demand.
Bank overdraft from Kotak Mahindra Bank was secured by way of pledge of fixed deposit receipts aggregating ൘ 25.00 Million and by first pari passu charge by way of mortgage on all immovable
properties, present and future of the Company and by way of hypothecation on all the movable assets and current assets of the Company. The loan was further secured by irrevocable and
unconditional personal guarantees of the Promoters of the Company.
Cash credit borrowings from IndusInd bank carry interest rate based on Banker's Prime Lending Rate (BPLR) plus 4.75%. The outstanding balance is repayable on demand. Further, cash credit loan
LVVHFXUHGE\ZD\RI²
Primary security ² hypothecation of the entire current assets of Kestone, existing and future, comprising, inter alia, of stocks of raw material, work in progress, finished goods, receivables, books
debts and other current assets.
&ROODWHUDOVHFXULW\²)LUVWDQGH[FOXVLYHFKDUJHRQWKHPRYHDEOHIL[HGDVVHWVRI.HVWRQH/LHQRQIL[HGGHSRVLWVRI൘ 11 million.
Guarantee by -
a.) Corporate guarantee of CL Educate Limited.
b.) Personal guarantee of Mr. Nikhil Mahajan and Mr. Gautam Puri, directors of Kestone Integrated Marketing Services Private Limited.
CL Educate Limited
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. Refer annexure XLIV for disclosure under Micro Small & Medium Enterprises Development Act, 2006.
CL Educate Limited
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XV- Restated consolidated summary statement of tangible fixed assets (൘ in Million)
Intellectual
Computer Licence Content CAT online Education Non-compete
Particulars Goodwill property Website Total
software Fees development module manual fees
rights
Gross block( at cost) as at 31st March 2014
Closing - 166.15 15.19 14.74 1.43 1.83 3.58 2.75 5.00 210.67
Deletion/adjustment - - 0.08 - - - - - - 0.08
Addition - - 1.93 2.50 1.43 - - - - 5.86
Opening - 166.15 13.34 12.24 - 1.83 3.58 2.75 5.00 204.89
Accumulated amortisation as at 31st March 2014
Closing - 67.53 11.90 10.29 0.04 1.83 3.58 2.75 2.50 100.42
Deletion/adjustment - - 0.06 - - - - - - 0.06
Addition - 15.62 1.27 2.10 0.04 - 0.01 - 1.00 20.04
Opening - 51.91 10.69 8.19 - 1.83 3.57 2.75 1.50 80.44
Net Block as at 31st March 2014 - 98.62 3.29 4.45 1.39 - - - 2.50 110.25
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated summary consolidated statement of assets and liabilites, profit and loss and cash flow.
3. Certain intangible assets, are subject to charge to secured borrowings of group Companies referred in annexures as secured term loan from others and secured term loans from banks and bank
overdrafts. (refer annexure VIII).
CL Educate Limited
As at March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011 and March 31, 2010 the 0.50 0.50 0.50 0.50 0.50
number of fully paid up equity shares are 50,000 in each year of ൘ 10 each of Energy
Plantation Project Private Limited
The aggregate book value of unquoted non current investment are as follows:
(൘ in Million)
As at March 31
Particulars
2014 2013 2012 2011 2010
Aggregate book value of unquoted non current investment 5.50 5.50 5.50 0.50 0.50
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flows.
3. There are no significant restrictions on the right of ownership, realisability of investments or the remittance of income and proceeds of disposal.
CL Educate Limited
Annexure XVIII - Restated consolidated summary of statement of loans and advances (൘ in Million)
Long-term
Particulars As at March 31
2014 2013 2012 2011 2010
Unsecured, considered good, unless otherwise stated
Capital advances (A) 13.60 12.30 16.97 5.34 63.30
Security deposits
-Considered good 12.29 14.52 12.38 10.97 25.65
-Considered doubtful 0.44 0.44 - - -
Less: Provision for doubtful balances (0.44) (0.44) - - -
Total (B) 12.29 14.52 12.38 10.97 25.65
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. Details of year-wise advance tax (including tax deducted at source) and provision for tax is as under:
(൘ in Million)
As at March 31
Particulars
2014 2013 2012 2011 2010
Advance income tax (including tax deducted at source) 314.42 259.37 233.61 227.66 167.19
Provision for tax 223.97 172.18 155.86 133.61 83.10
Net Advance income tax (including tax deducted at source) 90.45 87.19 77.75 94.05 84.09
(൘ in Million)
Short-term
Particulars As at March 31
2014 2013 2012 2011 2010
Unsecured, considered good, unless otherwise stated
Advance to suppliers (A) 4.31 6.56 21.59 4.46 7.93
Security deposits
-Considered good 23.92 20.32 20.80 18.08 10.34
-Considered doubtful - - - - 0.34
Less: Provision for doubtful balances - - - - (0.34)
Total (C) 23.92 20.32 20.80 18.08 10.34
Other receivables from related parties (Refer annexure XLIII) (D) 0.12 - - - -
Balances recoverable from government authorities (E) 0.44 0.33 24.39 3.10 -
Intercorporate deposits (F) 0.12 - - - -
Prepaid expenses (G) 108.97 79.55 80.65 61.17 38.03
Loans and advances to employees (H) 1.89 7.38 5.44 2.67 7.74
Loan and advances to franchisees (I) 0.07 2.70 5.39 7.88 3.25
Receivables on account of transfer of fixed assets (J) - - 0.59 - -
Others
- Receivable from others (considered good) 2.77 0.22 11.44 0.36 9.58
- Receivable from others (considered doubtful) 40.22 - - - -
Less: Provision for doubtful balances (40.22) - - - -
Total (K) 2.77 0.22 11.44 0.36 9.58
Total (A+B+C+D+E+F+G+H+I+J+K) 561.94 487.93 410.82 369.09 206.07
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XIX- Restated consolidated summary of statement of other non-current assets (൘ in Million)
Long-term
Particulars As at March 31
2014 2013 2012 2011 2010
Unsecured, considered good, unless otherwise stated
Interest accrued on non current fixed deposits 0.09 2.45 0.18 1.65 -
Non-current bank balances (Deposits with maturity for more than 12 months from reporting 132.34 207.92 2.57 53.19 32.24
date) (Refer annexure XXII)
Total 132.43 210.37 2.75 54.84 32.24
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XX- Restated consolidated summary of statement of inventories (Valued at lower of at cost and net realisable value)
(൘ in Million)
As at March 31
Particulars
2014 2013 2012 2011 2010
Raw materials 3.24 5.09 5.28 - -
Work in progress 16.33 6.67 1.14 - -
Finished goods produced 86.15 47.28 5.92 - -
Finished goods purchased - 8.62 28.13 0.20 0.20
Total 105.72 67.66 40.47 0.20 0.20
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
CL Educate Limited
Annexure XXII- Restated consolidated summary of statement of cash and bank balances (൘ in Million)
Current
Particulars As at March 31
2014 2013 2012 2011 2010
Cash and cash equivalents
Balances with banks:
²RQFXUUHQWDFFRXQWV 46.90 47.92 37.94 111.29 79.42
²H[FKDQJHHDUQHUIRUHLJQFXUUHQF\DFFRXQW
(()&
- - 0.62 0.53 0.48
Cheques/ drafts on hand 2.90 5.91 2.64 0.04 0.72
Cash on hand 4.01 6.98 2.84 6.63 0.94
(൘ in Million)
Non-current
Particulars As at March 31
2014 2013 2012 2011 2010
Other bank balances
²'HSRVLWVZLWKPDWXULW\IRUPRUHWKDQPRQWKVIURPUHSRUWLQJGDWH - 59.33 2.24 52.91 32.24
²0DUJLQPRQH\GHSRVLWV 132.34 148.59 0.33 0.28 -
132.34 207.92 2.57 53.19 32.24
Amount disclosed under other non-current assets (Refer annexure XIX) (132.34) (207.92) (2.57) (53.19) (32.24)
- - - - -
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Footnotes:
i Detail of products sold
(൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
-Sale of study materials 186.52 186.95 148.83 182.34 222.16
-Sale of text books 180.93 149.60 55.43 - -
-Others - - - - 2.71
Total 367.45 336.55 204.26 182.34 224.87
The Company is engaged in publishing educational content and books which are subject to nil rate of excise duty.
CL Educate Limited
Footnotes :
i. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
ii. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flows.
iii. Rent income (net of expenses)
(൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
Rent income on building classified as investment property 0.29 0.60 0.60 - -
Less: Depreciation on building classified as investment property 0.21 0.21 0.21 - -
Total 0.08 0.39 0.39 - -
CL Educate Limited
Annexure XXVI A - Restated consolidated summary of statement of cost of raw material and components consumed
(൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
Inventory at the beginning of the year 5.09 5.28 - - -
Add: Purchases during the year 91.80 78.78 22.97 - -
96.89 84.06 22.97 - -
Less: Inventory at the end of the year 3.24 5.09 5.28 - -
Cost of raw material and components consumed 93.65 78.97 17.69 - -
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XXVI B - Restated consolidated summary of statement of cost of Services
(൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XXVIII - Restated consolidated summary of statement of (increase) in inventories of finished goods and work-in progress and traded goods
(൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
Inventories at the beginning of the year
-Finished goods produced 47.28 5.92 - - -
-Work-in-progress 6.67 1.14 - - -
-Finished goods purchased 8.62 28.13 0.20 0.20 -
(A) 62.57 35.19 0.20 0.20 -
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XXXI - Restated consolidated summary of statement of depreciation and amortisation expenses
(൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
Depreciation & amortization of tangible assets (Refer annexure XV) 34.65 35.04 31.25 23.69 19.15
Amortisation of intangible assets (Refer annexure XVI) 20.04 20.93 14.75 8.43 9.08
54.69 55.97 46.00 32.12 28.23
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XXXII - Restated consolidated summary of statement of other expenses
(൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
Banquet and event material expenses 117.16 83.02 89.35 69.94 41.76
Advertisement, publicity and sales promotion expenses (for related parties refer annexure 82.73 58.90 67.05 60.67 68.90
XLIII)
Travelling, conveyance and vehicle maintenance expenses 72.70 55.51 51.00 26.11 24.66
Rent expense (refer annexure XXXIX) 70.63 57.30 40.99 39.67 59.05
Communication expenses 27.22 23.49 25.25 20.45 21.71
Equipment hire charges 15.81 19.16 16.12 11.42 8.29
Office expenses 36.73 31.32 22.74 15.59 16.75
Legal and professional expenses (refer annexure XXXVIII) 60.78 17.93 21.78 13.29 20.82
Retainership fees and temporary manpower resources expenses 21.97 22.95 24.82 16.22 12.07
Printing and stationery expenses 11.54 9.90 7.03 7.58 8.04
Power and fuel expenses 13.70 11.49 8.11 5.93 7.21
Material development and printing expenses 3.63 2.32 4.48 6.61 0.04
Commission to non executive directors 0.17 0.43 - 0.49 -
Repairs to building 9.56 7.14 7.29 5.55 0.26
Repairs to other 5.63 5.64 3.89 4.09 9.32
Freight outward and forwarding expenses 9.69 9.86 3.98 4.30 5.24
Bank charges (other than loan processing charges) 3.28 6.18 3.47 2.84 2.21
Rates, taxes and fees 1.22 2.09 3.65 1.10 3.22
Insurance expenses 2.37 3.72 3.31 2.22 2.39
Content development expenses 0.04 0.72 0.07 0.15 0.13
Rebates and discounts 1.89 2.80 2.65 0.25 -
Recruitment, training and development expenses (for related parties refer annexure XLIII) 2.87 2.63 2.80 1.60 1.81
Newspaper, books and periodicals and subscriptions expenses 0.76 0.52 3.50 1.27 0.79
Fixed assets written off 0.68 0.92 1.64 - 1.70
Foreign exchange loss (net) - - - - 2.96
Loss on sale of fixed assets (net) - - 0.30 - -
Consumption of packing materials 1.98 2.13 0.08 - -
Business service fee 1.52 1.58 0.93 0.57 0.34
Provision for sales return 1.35 1.00 0.71 - -
Royalty expenses - 4.50 0.67 1.82 3.80
Charity and donations 0.12 0.14 0.44 0.18 1.53
Commission/brokerage charges 0.22 - 0.35 - -
Collection charges expenses - - - 1.56 -
Sponsorship Fee 24.30 - - - -
Bad debts written off 47.11 34.72 42.16 28.02 16.78
Provision for doubtful debts and advances 0.85 3.08 3.00 1.95 0.34
Advances written off (for related parties refer annexure XLIII) 2.13 123.22 1.96 2.85 0.92
Miscellaneous expenses (for related parties refer annexure XLIII) 6.85 4.56 4.00 3.35 3.10
659.19 610.87 469.57 357.64 346.14
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flows.
CL Educate Limited
Annexure XXXIII - Restated consolidated summary of statement of basic and diluted earnings per equity share
The calculation of earnings per Share (EPS) has been made in accordance with Accounting Standard (AS) -20. A statement on calculation of Basic and Diluted EPS is as under.
(൘ in Million)
For the year ended March 31
Particulars
Reference Units 2014 2013 2012 2011 2010
Profit after tax A ൘ 154.80 144.70 (52.80) 88.70 46.50
Add: Exceptional expenses ൘ 13.26 - 191.94 - -
Profit after tax but before exceptional expenses B 168.06 144.70 139.14 88.70 46.50
Weighted average numbers of equity shares C Numbers 9,417,810 9,393,087 8,777,076 8,749,003 8,748,033
Add: Dilutive potential equity shares (Refer D Numbers 304,946 311,050 774,989 4,939 4,342
footnote 3)
Number of equity shares for dilutive EPS E=C+D Numbers 9,722,756 9,704,137 9,552,065 8,753,942 8,752,375
Basic earnings per share before exceptional B/C ൘ 17.84 15.40 15.85 10.14 5.32
expenses
Diluted earnings per share before exceptional B/E ൘ 17.29 14.91 14.57 10.13 5.31
expenses
Basic earnings per share after exceptional A/C ൘ 16.44 15.40 (6.02) 10.14 5.32
expenses
Diluted earnings per share after exceptional A/E ൘ 15.92 14.91 (6.02) 10.13 5.31
expenses
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexure to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. Following are the potential equity shares considered to be dilutive in nature, hence these have been adjusted to arrive at the dilutive earnings per share:
a. The Company has committed to issue equity shares of CL Educate Limited to the promoters of G. K. Publication Private Limited for purchase of first and third and last tranche of equity share of
G. K. Publication Private Limited (refer footnote 3 of annexure XXXV). As the numbers of shares and share price for such issue is determined as of the reporting date, the impact of the same as
potential equity share for calculation of diluted earnings per share has been taken.
b. The Company had ESOP outstanding as on Balance Sheet date, shares which are outstanding and will be issued at, for a lesser consideration than its fair value. Such equity shares generate
lesser proceeds and have no effect on the net profit attributable to equity shares outstanding. Therefore, value of such differential (fair value per share less exercising price per share) in respect
of ESOP outstanding are considered dilutive and equalised number of ESOP outstanding derived by dividing such differential value with fair value per share is added to the number of equity shares
outstanding in the computation of diluted earnings per share.
c. The Company had committed to issue equity shares of CL Educate Limited to GPE (India) Limited on conversion of Class- II shares-CCPS and Gaja Trustee Company Private Limited for Class- III
shares-OCPS as per terms mentioned in footnote D of annexure V. The conversion price 1 and 2 as mentioned in footnote D of annexure 5 of the financial statements has elapsed. Shareholders
have right to seek the conversion of these shares at a price per equity shares of ൘ 425 each as stipulated in conversion price 3. Hence, number of shares is determined as of the reporting date,
therefore, such shares are considered as dilutive and are added to the number of equity shares outstanding in the computation of diluted earnings per share.
CL Educate Limited
Annexure XXXIV- Restated consolidated summary statement of contingent liabilities (to the extent not provided for) (൘ in Million)
As at March 31
Particulars
2014 2013 2012 2011 2010
Claims against the Group not acknowledged as debt (Refer footnotes 3) 319.92 308.15 247.46 167.25 419.26
Corporate guarantees for loans taken by others (refer footnote 4) 370.00 385.00 270.00 795.00 775.00
Guarantee to directors of a subsidiary (refer footnote 5) - 10.75 36.92 - -
Guarantee issued by bank on our behalf (refer footnote 6 ) - - - 0.28 -
689.92 703.90 554.38 962.53 1,194.26
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with notes to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. Details of claims against the Group not acknowledged as debt are as follows:
As assessed by the management, the likeliness of liability of above disputes/loan not being discharged by the respective subsidiary companies are not ¶PRUH likely than QRW· as mentioned in
Accounting Standard -29 ´3URYLVLRQV Contingent Liabilities and Contingent $VVHWVµ and hence no liability has been recognised in the books. Also, as the likeliness of the same is not remote (as
mentioned in the same Accounting Standard) too and accordingly the Company has disclosed these as Contingent Liabilities.
(ii) Demand for service tax aggregating ൘ 3.12 million for the period September 2004 to March 2008 due to incorrect availment of service tax cenvat credit is disputed by the Company . Penalty,
aggregating ൘ 3.10 milion has also been levied under Section 15 read with Rule 15 of Cenvat Credit Rules, 2004. During the year, the Company has received an order passed by Commissioner
(Appeals) of Service tax. The Company has preferred an appeal with CESTAT against the order of the Commissioner (Appeals) of Service tax.
(iii) The Company had received a demand for service tax in financial year 2013-14 aggregating ൘ 40.09 million for the period April 2008 to March 2012 due to incorrect availment of service tax
cenvat credit. The Company has disputed the demand and has preferred an appeal with Commissioner (Appeals) Central Excise and Customs.
(iv) Demand for service tax aggregating ൘ 29.18 million for the period October 2010 to June 2012 is disputed by the Company against which the Company has filed an appeal before Commissioner
(Appeals) of Service tax.
(v) In case of one of the subsidiary named Kestone Integrated Marketing Services Private Limited, the Assistant Commissioner of Income Tax has made certain disallowances and raised a demand of
൘ 0.63 million (including interest) for Assessment year 2011-12. The Company has filed an appeal against the demand notice with Commissioner of Income Tax (Appeals).
(vi) The Company had been allotted a land located at Faridabad (Haryana) in an auction by Hon'ble High Court of Jharkhand. When the Company applied for transfer of ownership in the records of
Haryana Urban Development Authority (HUDA), the transfer permission was granted with levy of extension fee of ൘ 6.70 million on account of various dues not paid by the erstwhile owner. The
Company has disputed the demand and has preferred an appeal with the Administrator, HUDA.
(vii) Rashtriya advertising & Prabhatam Advertising Pvt Ltd, a service provider has filed a claim against the Company for recovery of an amount of ൘ 1.45 million with interest as balance of
amounts due. The Company has disputed the demand and the case is under trial in the court of law.
(viii) Triangle Education, a franchisee of the Company in Jaipur, had arbitrarily terminated the agreement and started a competing business using the brand of CL Educate. The Company has filed
a statement of claim before the sole Arbitrator amounting ൘ 19.00 million against Triangle Education. Triangle Education also filed a counter claim against the Company amounting ൘ 3.20 million.
(ix) A student has filled a case against the Company for refund of fees amounting ൘ 0.62 million on the ground that he paid fees to Brilliant Tutorials considering the fact that the Company has a
tie-up with brilliant tutorial which was subsequently called off by the Company.
(ii) Demand for service tax aggregating ൘ 3.12 million for the period September 2004 to March 2008 due to incorrect availment of service tax cenvat credit is disputed by the Company . Penalty,
aggregating ൘ 3.10 milion has also been levied under Section 15 read with Rule 15 of Cenvat Credit Rules, 2004. During the year, the Company has preferred an appeal with Commissioner (Appeals)
of Service tax.
(iii) During the financial year 2013-14, the Company received a demand for service tax aggregating ൘ 40.09 million for the period April 2008 to March 2012 due to incorrect availment of service tax
cenvat credit. The Company has preferred an appeal with Commissioner (Appeals) of Service Tax.
(iv) Demand for service tax aggregating ൘ 29.19 million for the period October 2010 to June 2012 is disputed by the Company against which the Company has filed a reply and an order of the
service tax department is awaited.
(v) Various demand notice on account of late/short deduction of Tax deducted at source has been received by the company against which replies has been filed to the concerned authority total
amount pending in appeal is ൘ 0.84 million
(ii) During the financial year 2009-10, the Company received a demand for service tax aggregating ൘ 1.55 million for the period September 2004 to March 2007 due to incorrect availment of service
tax cenvat credit. Penalty, aggregating ൘3.10 million has also been levied under Section 15 read with Rule 15 of Cenvat Credit Rules, 2004. The Company has preferred an appeal with
Commissioner (Appeals) of Service Tax.
CL Educate Limited
(iii)Demandfor servicetax aggregating൘ 114.26millionfortheperiodApril,2003toOctober,2010 isdisputed bytheCompanyagainst whichcompanyhadfilled anreplywith Commissioner
(Appeals) of Service tax.
(iv) Various demand notices on account of late/short deduction of Tax deducted at source has been received by the company against which replies had been filed to the concerned authority. Total
amount demanded is ൘ 0.65 million.
(ii) During the financial year 2009-10, the Company received a demand for service tax aggregating ൘ 1.55 million for the period September 2004 to March 2007 due to incorrect availment of service
tax cenvat credit. Penalty, aggregating ൘ 3.10 million has also been levied under Section 15 read with Rule 15 of Cenvat Credit Rules, 2004. The Company has preferred an appeal with
Commissioner (Appeals) of Service Tax.
(iii) Demand for service tax aggregating ൘ 34.70 million for the period April, 2003 to October, 2010 is disputed by the Company. against which company had filled an reply with Commissioner
(Appeals) of Service tax.
(ii) Demand for income tax aggregating ൘ 34.81 million for the assessment year 2005-06 is disputed by the Company against which the Company has preferred an appeal. The assessing officer has
also initiated penalty proceedings under Section 274 read with section 271 of the Income Tax Act, 1961 but in the absence of an order the amount of penalty is currently not ascertainable (refer
note below).
(iii) Demand for income tax aggregating to ൘ 106.37 million for the assessment year 2006-07 is disputed by the Company against which the Company has preferred an appeal. The assessing officer
has also initiated penalty proceedings under Section 274 read with section 271 of the Income Tax Act, 1961 but in the absence of an order the amount of penalty is currently not ascertainable
(refer note below).
(iv) Demand for income tax aggregating to ൘. 128.16 million for the assessment year 2007-08 is disputed by the Company against which the Company has preferred an appeal. The assessing officer
has also initiated penalty proceedings under Section 274 read with section 271 of the Income Tax Act, 1961 but in the absence of an order the amount of penalty is currently not ascertainable.CIT
(A) has decided the appeal partly in favour of the company and all major additions made in the assessment have been deleted. In view of quantum additions deleted by the CIT (A), there will not
be any imposition of penalty relating to those issues (refer note below).
(v) Demand for service tax aggregating to ൘ 71.00 million for the nine months, for the period 1 July 2003 to 30 September 2008 is disputed by the Company against which the Company filed a
reply. During the year, the Company received an order from the Commissioner of Service Tax confirming the demand of ൘ 71.00 million. The officer has also imposed a penalty of ൘ 71.00 million
under Section 78 of the Finance Act, 1994. The Company has preferred an appeal with CESTAT against the order of the Commissioner of Service tax.
(vi) During the financial year 2009-10, the Company received a demand for service tax aggregating ൘ 1.55 million for the period September 2004 to March 2007 due to incorrect availment of
service tax cenvat credit. Penalty, aggregating ൘3.10 million has also been levied under Section 15 read with Rule 15 of Cenvat Credit Rules, 2004. The Company has preferred an appeal with
Commissioner (Appeals) of Service Tax.
Note:
Income tax cases related to assessment years 2004-05 to 2007-08 has been in later years decided in favour of the Company.
4. Details of corporate guarantees given for loans taken by others are as follows:
CL Educate Limited
5. Details of guarantee to directors of a subsidiary are as follows:
CL Educate Limited
Estimated amount of contracts remaining to be executed on capital account and not provided for (net of 52.56 54.40 52.42 50.35 161.14
capital advance)
Commitment for license fees from Threesixtyone Degree Minds Consulting Private Limited 0.25 10.55 - - -
Total capital commitments (A) 52.81 64.95 52.42 50.35 161.14
Commitment towards purchase of equity shares of Kestone Integrated Marketing Services Private Limited - - - - 7.50
Commitment towards purchase of equity shares of G. K. Publications Private Limited (Refer footnote 3) - 34.41 70.26 - -
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
During the year the Company has acquired the first tranche of shares in GKP by payment of consideration stipulated above including consideration by way of issue of equity shares of CL Educate
Limited of value ൘0LOOLRQZKLFKKDVEHHQERRNHGDV¶VKDUHDSSOLFDWLRQPRQH\SHQGLQJDOORWPHQW·E\WKH&RPSDQ\UHIHUDQQH[XUH9,,
Pursuant to the Special Resolution passed by the members in the annual general meeting held on September 30, 2013, and the resolution passed by the Board of Directors at its meeting on
-DQXDU\WKH&RPSDQ\UHQHZHG´&/(,6(PSOR\HH6WRFN2SWLRQV3ODQµIRUIXUWKHUSHULRGVLHXSWR1RYHPEHUDQG0DUFKUHVSHFWLYHO\
CL Educate Limited
The Group has in accordance with the Accounting Standard- 15 'Employee Benefits' has calculated the various benefits provided to employees as under:
A. Defined contribution Plan
During the year, the Group has recognized the following amounts in restated consoildated summary statement of profit and loss:
(൘ in Million)
For the year ended March 31
Particulars 2014 2013 2012 2011 2010
Employers contribution to provident fund 19.37 21.63 19.66 10.67 11.51
Employers contribution to employee state insurance 10.02 9.04 7.44 2.92 2.13
Total 29.39 30.67 27.10 13.59 13.64
IV. Expenses Recognised in the Statement of Profit and Loss for the year (൘ in Million)
CL Educate Limited
V. Reconciliation of present value of defined benefit obligation and fair value of assets (൘ in Million)
Net liability recognized in Balance Sheet as at 8.80 7.32 6.04 5.53 5.31 11.58 9.18 4.66 4.07 1.59
year end
Amount classified as:
Short term provision 0.34 0.94 1.43 0.03 0.26 0.80 1.51 0.18 0.20 0.16
Long term provision 8.46 6.38 4.61 5.50 5.05 10.77 7.67 4.49 3.87 1.43
VI. Net assets/liability and actuarial experience gain/(loss) for present benefit obligation ¶3%2· and
(a) Employees Gratuity Fund (൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
PBO 14.67 13.71 9.57 8.23 6.18
Plan assets 3.10 4.54 4.90 4.16 4.59
Net assets/(liability) (11.58) (9.18) (4.66) (4.07) (1.59)
Experience gain/(loss) on PBO 1.56 0.91 1.29 (1.03) 1.43
Experience gain/(loss) on plan assets (0.11) (0.02) 0.05 (0.04) 0.08
F(PSOR\HU·VEHVWHVWLPDWHIRUFRQWULEXWLRQGXULQJQH[W\HDU
Particulars Amount in ൘ million
Employees Gratuity Fund 6.91
Earned leave 1.79
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XXXVII - Restated consolidated summary statement of employees share based payment plan
Pursuant to shareholder resolution dated March 6, 2008, the Company introduced ´(PSOR\HH Stock Option Plan 2008 (CL ESOP µ which provides for the issue of 250,000 stock options to
directors and employees of the Company and its subsidiaries companies. The plan entitles directors and employees to purchase equity shares in the Company at the stipulated exercise price,
subject to compliance with vesting conditions. All exercised options shall be settled by physical delivery of equity shares. As per the plan holders of vesting options are entitle to purchase one
equity share for each option.
The terms and conditions related to grant of the share options are as follows:
(൘ in Million)
For the year ended March 31
Particulars
2014 2013 2012 2011 2010
Share based payment expenses:
CL ESOP -2008 (Refer footnotes) 0.85 3.44 4.23 (0.46) 2.13
Footnotes:
Includes expenses on account of stock options of CLEIS, a subsidiary of the Company, to employees of the Company.
The information concerning stock options granted, exercised, forfeited and outstanding at the year end is as follows:
ESOP to directors of the Company
As at March 31
2014 2013 2012 2011 2010
Number of Weighted Number of Weighted Number of Weighted Number of Weighted Number of Weighted
Particulars
Stock average Stock average Stock average Stock average Stock average
Options exercise Options exercise Options exercise Options exercise Options exercise
Price (൘) Price (൘) Price (൘) Price (൘) Price (൘)
As at March 31
2014 2013 2012 2011 2010
Number of Weighted Number of Weighted Number of Weighted Number of Weighted Number of Weighted
Particulars
Stock average Stock average Stock average Stock average Stock average
Options exercise Options exercise Options exercise Options exercise Options exercise
Price (൘) Price (൘) Price (൘) Price (൘) Price (൘)
The Black Scholes valuation model has been used for computing the weighted average fair value considering the following inputs:
CL Educate Limited
*Expected volatility has been determined using historical fluctuation in share issue prices of the Company.
Apart from CL Educate Limited, one of its subsidiary namely Career Launcher Education Infrastructures and services Limited has also issued ESOPs.
Pursuant to shareholder resolution dated September 30, 2008, CLEIS introduced ´&/(,6 Employee Stock Options Plan µ which provides for the issue of 100,000 stock options to employees of
CLEIS and its group companies/entities. The plan entitles employees to purchase equity shares in CLEIS at the stipulated exercise price, subject to compliance with vesting conditions. All exercised
options shall be settled by physical delivery of equity shares. As per the plan holders of vesting options are entitle to purchase one equity share for each option. Till date 25,000, 19,000, 19,000,
15,000 and Nil stock options have been granted under this scheme as on March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011 and March 31, 2010 respectely.
Expenses pertaining to employee stock option plan have been booked in CL Educate Limited as stock options have been granted to employees of CL Educate Limited.
The information concerning stock options granted, exercised, forfeited and outstanding at the yearend is as follows:
As at March 31
2014 2013 2012 2011 2010
Number of Weighted Number of Weighted Number of Weighted Number of Weighted Number of Weighted
Particulars
Stock average Stock average Stock average Stock average Stock average
Options exercise Options exercise Options exercise Options exercise Options exercise
Price (൘) Price (൘) Price (൘) Price (൘) Price (൘)
The Black Scholes valuation model has been used for computing the weighted average fair value considering the following inputs:
Footnote:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. Outstanding options at the end of relevant year have been valued by an independent firm of Chartered Accountants and relied upon by statutory auditors.
CL Educate Limited
Annexure XXXVIII- Restated consolidated summary statement of payment to auditors (excluding service tax) (included in legal and professional expense)
(൘ in Million)
As at March 31
Particulars
2014 2013 2012 2011 2010
Statutory audit 5.23 4.82 3.93 2.96 2.50
Other engagement prescribed by statute to be done by Statutory auditors - 0.60 - 0.75 -
Other matters 0.68 0.78 2.11 1.16 0.03
Reimbursement of expenses 0.05 0.09 0.02 0.04 0.11
Total 5.96 6.29 6.06 4.91 2.64
Footnotes :
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
As lessee
The Group is a lessee under various operating leases. The lease terms of these premises range from 1 to 2 years and accordingly are short term leases. Rental expense for operating lease for the
year ended March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011 & March 31, 2010 was ൘ 70.63 million, ൘ 57.30 million, ൘ 40.98 million, ൘ 39.67 million & ൘ 59.05 million respectively.
Expected future minimum commitments for non-cancellable leases are as follows:
(൘ in Million)
As at March 31
Particulars
2014 2013 2012 2011 2010
Not later than one year 9.84 4.01 3.57 1.26 8.13
Later than one year but not later than 5 years 11.78 4.79 5.86 0.67 8.99
Later than 5 years - - - - -
Total 21.62 8.80 9.43 1.93 17.12
As lessor
The Group has given a portion of its premises on cancellable operating lease to various franchisees.
Lease receipts are recognized in the consolidated statement of profit and loss during March 31, 2014, March 31, 2013, March 31, 2012, March 31, 2011 & March 31, 2010 was ൘ 0.29 million, ൘
0.66million, ൘ 2.68 million, ൘ 3.08 million & ൘.1.76 million There are no non cancellable leases and hence disclosure relating to minimum lease receipts has not been provided.
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Foot note:
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of profit and loss of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Annexure XLII- Restated consolidated summary statement of un-hedged foreign currency exposure
The respective year-end foreign currency exposures that have not been hedged by a derivative instrument or otherwise as follows:
Receivables in indian currency
(൘ in Million)
As at March 31
Particulars
2014 2013 2012 2011 2010
Receivables in indian currency
- Trade receivable 14.47 15.69 17.56 11.01 7.76
- Short term loans and advances 40.34 40.01 39.45 35.75 27.21
- Cash and bank balances 0.14 0.91 2.39 5.16 -
Payables in indian currency
- Trade Payable 0.04 - 3.87 7.96 0.96
- Other current liability - - - 0.24 -
- Short term loans and advances USD 0.76 USD 0.76 USD 0.76 SGD 0.20 SGD 0.19
AED 0.02 AED 0.003 - USD 0.76 AED 0.07
USD 0.66
- Cash and bank balances AED 0.008 AED 0.06 AED 0.12 AED 0.37 -
USD 0.01 USD 0.01 -
Payables in original currency
- Trade Payable USD 0.0007 - AED 0.27 AED 0.65 USD 0.02
*Abbreviations: AED: United Arab Emirates Dirham, QAR: Qatari Rial, SGD: Singapore Dollar and USD: United States Dollar.
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. The group does not enter into any forward contracts to hedge its foreign currency exposures.
CL Educate Limited
The disclosure as required by the Accounting Standard -18 (Related Party Disclosure) are given below:
(a) List of related parties with whom transactions have taken place:
c. License fees
- Nalanda Foundation 8.00 4.00 16.00 1.35 8.19
d. Infrastructure Fees
- Nalanda Foundation 18.33 14.43 10.79 3.99 -
- Career Launcher Education Foundation - - 33.00 42.00 30.00
2. Other income
a. Interest on loans and advances
- Career launcher education foundation 21.08 17.14 35.02 15.88 5.34
- CLEF AP Trust 1.76 1.45 1.28 0.28 0.68
- Nalanda Foundation 32.28 20.30 9.43 12.20 3.64
3. Expenses
a. Other expenses
Career Launcher Education Foundation
-Training and development expenses - 0.17 - - -
-Advertisement, publicity and sales promotion expenses 3.30 2.64 - - -
-Miscellaneous expenses - 0.32 - - -
CLEF- AP
- Dues written off - - 0.04 - -
b. Managerial remuneration
- Mr.Gautam Puri 5.61 5.10 5.05 5.05 4.80
- Mr. Satya Narayanan R. 5.61 5.10 5.05 5.05 4.80
- Mr. Nikhil Mahajan 5.46 4.95 4.91 5.05 4.80
- Mr. Shiva Kumar 4.95 4.96 3.04 - -
- Mr. Sujeet Bhattacharya 4.95 4.85 4.62 4.21 3.42
- Mr. Srinavasan R. - - - 2.08 3.42
CL Educate Limited
6. Reimbursement of expenses to
- Nalanda Foundation 0.06 - 0.30 - -
-CLEF AP - - - - -
9. Loan taken
-Career Launcher employee welfare society - 1.25 - - -
-Career Launcher Education Foundation 0.03 - - - -
15. Liability taken over (on account of gratuity and leave encashment)
- Nalanda Foundation 0.12 - - - -
CL Educate Limited
As at March 31
Particulars
2014 2013 2012 2011 2010
Balance outstanding with or from related parties as at the year end:
5. Trade Receivable
- Career Launcher Education Foundation 7.53 7.75 8.83 39.46 98.76
- Nalanda Foundation 22.30 6.36 53.82 28.22 31.27
CL Educate Limited
Annexure XLIV- Restated consolidated summary statement of disclosure relating to suppliers registered under Micro, Small and Medium Enterprise Development Act, 2006:
Amount due to entities covered under Micro, Small and Medium Enterprises as defined in the Micro, Small, Medium Enterprises Development Act, 2006, have been identified on the basis of
information available with the Company. There was no amount due to any such entities which needs to be disclosed. This has been relied upon by the auditors.
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Foot note:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Less: Capitalisation during the year (C) 0.10 - 124.44 138.74 2.49
Total (A)+(B)+(C) 6.31 6.41 5.95 123.58 239.40
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
4. For the year ending March 31, 2012 and March 31, 2011
a. During the year, the Company has created provision and written off balances due in the nature of short terms loans and advances ¶UHIHUUHG as EDODQFHV· recoverable fromCareer Launcher
Education Foundation (enterprises in which key management personnel and their relatives are able to exercise significant influence) as the loans and advances are considered unrecoverable on
account of inability to be paid by Career Launcher Education Foundation.
The evaluation of provision involves usage of assumptions and significant judgments based on valuation methodologies/judgements, which mainly include discontinuation of affiliation by
Pondicherry University of college run by Career Launcher Education Foundation. Keeping the attendant circumstances in view, the management believes it is prudent to impair these balances.
These will be evaluated on a going forward basis for any further changes.
Impairment of the balances have been done by way provisions and write offs. Write offs have been done for the portion of balances which are considered fully unrecoverable and provisions have
been made for the portion for which the management believes that the amount shall be more likely than not be unrecovered.
CL Educate Limited..
Primary Segment
The group has identified five reportable business segments as primary segments: Education & training programme (including sale of study material), Sale of educational books, Managed manpower
services, Event management services and K - 12. The segments have been identified and reported taking into account the nature of products, the differing risks and returns, the organisation
structure and the internal financial reporting system.
Education & training programme (including sale of study material): This mainly includes coaching for higher education entrances.
Sale of educational books: This mainly includes publishing and sale of educational books to related and third parties.
Managed manpower services: The group provides extended skilled manpower services to clients across locations, markets and roles, ranging from managing enterprise customers, to channel
relationships, to retail. On the basis of client requirements, group not only provide manpower but also equipments, support and manage these skilled teams to meet the business objectives of
customers.
Event management services: The group helps its clients to conduct very large conferences combined with exhibitions and trade shows attended by thousands of persons, too much targeted
seminars for focussed, exclusive audiences, to unique experiential activities.
K - 12: The group provided soft skills, infrastructure facilities and other support services to schools involved in Kindergarten to senior secondary studies.
Education &
training
Managed Event
programme
Particulars K - 12 Manpower management Others Total
(including sale
services services
of study
material)
Revenue
External revenue 1,016.46 60.85 430.17 303.65 375.72 2,186.85
Results
Segment results 281.95 4.28 49.86 53.82 42.99 432.90
Other information
Capital expenditure - allocable 5.24 5.63 - - 2.73 13.60
Capital expenditure - unallocable 7.18
Other significant non-cash expenses (net) - allocable 46.07 0.90 - - 10.51 57.48
Other significant non-cash expenses (net) - unallocable 3.11
CL Educate Limited..
Results
Segment results 321.23 (16.84) 63.03 23.33 80.43 471.18
Other information
Capital expenditure-allocable 7.03 - - - 1.20 8.23
Capital expenditure-unallocable 30.85
Secondary Segment
Particulars Within India Overseas Total
Segment revenue 1,946.10 43.62 1,989.72
Segment assets 2,634.41 12.33 2,646.74
Segment liabilities 1,189.23 - 1,189.23
Capital expenditures 39.08 - 39.08
CL Educate Limited..
Other information
Capital expenditure-allocable 98.63 84.69 - - 1.38 184.70
Capital expenditure-unallocable 49.46
Secondary Segment
Particulars Within India Overseas Total
Segment revenue 1,612.04 45.27 1,657.31
Segment assets 2,513.01 2,513.01
Segment liabilities 1,292.04 1,292.04
Capital expenditures 234.16 - 234.16
Other information
Capital expenditure-allocable - 97.07 - - 0.18 97.25
Capital expenditure-unallocable 171.28
CL Educate Limited..
Secondary Segment
Particulars Within India Overseas Total
Segment revenue 1,230.16 43.62 1,273.78
Segment assets 2,299.95 12.71 2,312.66
Segment liabilities 984.66 2.25 986.91
Capital expenditures 268.53 - 268.53
Other information
Capital expenditure-allocable 9.58 - - - 105.19 114.77
Capital expenditure-unallocable 191.04
Secondary Segment
Particulars Within India Overseas Total
Segment revenue 1,185.63 - 1,185.63
Segment assets 1,622.19 - 1,622.19
Segment liabilities 881.92 - 881.92
Capital expenditures 305.81 - 305.81
Foot note:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
CL Educate Limited..
Summary of results on restatements made in the audited financial statements of the group for the respective years and their impact on profits/(loss) of the group is as under:
A) Net profit/(loss) after tax as per audited financials statements 148.00 113.67 (42.47) 94.21 53.93 -
Total adjustments before Tax 23.23 (7.96) (10.54) 17.60 (6.85) (108.21)
Restated profit/(loss) before tax adjustments 171.23 105.71 (53.01) 111.81 47.08 77.03
Adjustments due to earlier year tax in the relevant years (2.34) (7.14) (0.21) (1.28) (0.02) 10.99
Tax impact of adjustments 16.07 3.16 6.35 1.37 0.38 -
MAT impact of adjustment (0.51) (3.06) (6.55) - (0.58) -
Deferred tax impact of adjustments 3.21 (31.95) 0.20 23.02 0.80 -
Total Tax adjustments 16.43 (38.99) (0.21) 23.11 0.58 10.99
Restated profit/(loss) after tax adjustments 154.80 144.70 (52.80) 88.70 46.50 66.04
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. Tax adjustment for earlier years
For the purpose of the restated consolidated summary statements, such revenue on account of interest income has been appropriately adjusted in the respective years to which the transaction
pretains to.
CL Educate Limited..
For the purpose of the restated consolidated summary statements, such expenses for ESOPs have been appropriately adjusted in the respective years to which the transactions pretains to.
CL Educate Limited..
Notes:
1.The ratios have been computed as below:
(a) Basic earnings per share (Rs.) Net profit after tax (as restated) attributable to equity shareholders
Weighted average number of equity shares outstanding during the year
(b) Diluted earnings per share (Rs.) Net profit after tax (as restated) attributable to equity shareholders
Weighted average number of dilutive equity shares outstanding during the year
(c) Return on net worth (%) Net profit after tax after preference dividend and related tax thereon (as restated)
Net worth at the end of the year
(d) Net assets value per equity share Net Worth at the end of the year
Total number of equity shares outstanding at the end of the year
3. Weighted average number of equity shares are the number of equity shares outstanding at the beginning of the year adjusted by the number of equity shares issued during year multiplied by
the time weighing factor. The time weighing factor is the number of days for which the specific shares are outstanding as a proportion of total number of days during the year.
4.Net worth for ratios mentioned in note 2(c) and 2(d) represents sum of equity share capital and reserves and surplus. Refer annexure VI for components of reserve and surplus.
5.Earnings per share calculations are in accordance with AS 20 - "Earnings per share", [notified under the Companies Act, 1956 read with General Circular 15/2013 dated September 13, 2013,
issued by the Ministry of Corporate Affairs, in respect of Section 133 of the Companies Act, 2013].
6.Considering that the Company has incurred losses during the year ended March 31, 2012, the conversion of CCPS and issue of ESOPs would decrease the loss per share for the year ended March
31, 2012 and hence, it has been ignored for the purpose of calculation of diluted EPS.
7.The share application money received and pending allotment as at March 31, 2011 were towards non-cumulative, non-convertible redeemable preference shares and hence was not considered
for computing diluted earnings per share.
8.The figures disclosed above are based on the restated consolidated summary statements of the Company.
9. The above statement should be read with the annexures to the restated consolidated summary statements of assets and liabilities, profit and loss and cash flows as appearing in Annexure IV.
CL Educate Limited
Shareholders Fund:
Equity shares 94.18 >@
Compulsorily convertible 0.01% non cumulative preference shares 4.11 >@
Optionally convertible 0.01% non cumulative preference shares 0.89 >@
Reserves and Surplus 1,394.40 >@
Total Shareholders Fund (B) 1,493.58 >@
Footnotes:
1. The figures disclosed above are based on the restated consolidated summary statement of assets and liabilities of the Company.
2. The above statement should be read with annexures to the restated consolidated summary statement of assets and liabilites, profit and loss and cash flow.
3. Will be updated at the time of prospectus.
4. Subsequent to March 31, 2014, there has been changes in the capital structure of the Company as detailed in footnote 9 to annexure V.
0$1$*(0(17¶6',6&866,21$1'$1$/<6,62)),1$1&,$/&21',7,21$1'5(68/762)
OPERATIONS
The following discussion and analysis of our financial condition and results of operations are based on, and
should be read in conjunction with, our restated consolidated financial statements as of and for the years ended
March 31, 2014, 2013 and 2012, the notes and significant accounting policies thereto and the reports thereon in
³Financial Statements´ on page 167, which have been prepared in accordance with the Indian GAAP,
Companies Act and the SEBI ICDR Regulations.
We prepare our audited standalone and consolidated financial statements in accordance with Indian GAAP,
which differs in certain material respects from IFRS and U.S. GAAP. We have not attempted to quantify the
impact of IFRS or U.S. GAAP on the financial information included in this Draft Red Herring Prospectus, nor
do we provide a reconciliation of our financial statements to those under U.S. GAAP or IFRS. Accordingly, the
degree to which the financial information included in this Draft Red Herring Prospectus will provide
PHDQLQJIXOLQIRUPDWLRQGHSHQGVRQWKHUHDGHU¶VOHYHORIIDPLOLDULW\ZLWKWKH&RPSDQLHV$FW,QGLDQ*$$3DQG
the SEBI ICDR Regulations. Any reliance on the financial disclosure in this Draft Red Herring Prospectus, by
persons not familiar with Indian accounting practices, should accordingly be limited.
Our fiscal year ends on March 31 of each year. Accordingly, unless otherwise stated, all references to a
particular fiscal year are to the 12-month period ended March 31 of that year.
Overview
We are a diversified provider of educational products, services, content and infrastructure in India, with a
presence across the education value chain. We commenced operations in 1996 as a provider of MBA test
preparation courses and since commencement of operations, we have diversified our operations across four
segments across the education value chain: test preparation and training, generally referred to as test prep,
conducted under the widely-UHFRJQL]HG EUDQG µ&DUHHU /DXQFKHU¶ SXEOLVKLQJ DQG FRQWHQW GHYHORSPHQW
conducted undeUWKHEUDQGµ*.3XEOLFDWLRQV¶.-VFKRROVRSHUDWHGXQGHUWKHEUDQGµ,QGXV:RUOG6FKRROV¶
with 10 schools across India; and vocational training programs implemented by us under Government schemes
in various States across India, as well as recruitment, training and event management services for corporates.
Under the umbrella of our Career Launcher test prep courses, we offer leading test prep courses for MBA, Civil
Services and Law, as well as courses for, among others, Engineering, Bank entrances, GATE and SSC (PSU
entrance) (Source: CRISIL Report). For fiscal 2014, we had 67,549 enrolments in our test prep segment across a
network of 164 test prep centers in 73 cities throughout India, with 76 owned centers (of which 14 are
WHPSRUDU\µ6PDUW&DUHHU&HQWHUV¶ and 88 centers operated under a partnership model. Out of our total student
enrolments, as on March 31, 2014, we had 32,286 enrolments in our MBA courses, followed by 12,138
enrolments in our Civil Services courses, and 9,220 enrolments in our Law courses. Our students have
established a strong success record for us, across our test prep business. For instance, 67 of our students secured
ranks in the top 100 successful candidates in the CLAT examination held in May 2014, and 1,632 of our
students received interview calls from at least one IIM in the CAT examination held in October 2013. Further,
742 of our students qualified for Civil Services Main Examinations, of which 176 of our students were in the
final merit list of Civil Services Main Examinations held in 2013.
With our acquisition of the GK Publications business in November 2011, we believe that we have an established
brand in the publishing and content development business, in particular, a brand that has built a reputation for
publishing niche test prep books, guides, mock test papers and question banks for popular professional and
entrance examinations in India, including titles for Engineering, GATE, Civil Services and Bank entrances.
During the year ended March 31, 2014, we had released 945 titles and had sold over 1.1 million copies under the
359
brand GK Publications. As on March 31, 2014, we had a network of over 1,000 dealers and distributors, across
several States in India.
In the vocational training segment, we had an aggregate of 8,233 enrolments in our vocational training programs
implemented by us under project tenders issued by the Central and various State Governments, during fiscal
2014, across the States of Gujarat, Rajasthan, Jharkhand, Chhattisgarh, Madhya Pradesh and Uttar Pradesh.
With the Government of India and other State Governments promoting private participation in their drive for
skiOO GHYHORSPHQW LQ ,QGLD LQFOXGLQJ WKURXJK WKH 3ULPH 0LQLVWHU¶V 1DWLRQDO 3ROLF\ RI 6NLOO 'HYHORSPHQW
seeking to train 500 million people in India by 2022, we believe that there is a significant growth opportunity in
the vocational training segment. In addition, we undertake certain recruitment, training and event management
services for corporates from time to time, through our Subsidiary, Kestone, which, we believe, enables us to
build relationships with corporates and drives our placement programs for enrolments in our vocational training
programs.
Our revenue from operations for fiscal 2014, 2013 and 2012 aggregated to ` 2,186.85 million, ` 1,989.72
million and ` 1,657.31 million, respectively, on a consolidated basis. Revenues from our test prep business
aggregated to ` 1,016.46 million, ` 985.67 million and ` 809.10 million, respectively; revenues from our
publishing and content development business, conducted under the brand GK Publications, aggregated to `
180.93 million, ` 149.60 million and ` 55.43 million, respectively; revenues from the K-12 schools operated
under the brand Indus World Schools, aggregated to ` 60.85 million, ` 52.83 million and ` 91.82 million,
respectively; revenues from our vocational training programs aggregated to ` 162.87 million, ` 146.11 million
and ` 70.67 million, respectively; and revenues from our recruitment, training and event management services
for corporates aggregated to ` 733.83 million, ` 627.83 million and ` 604.11 million, respectively; for fiscal
2014, 2013 and 2012. Our profit after tax for fiscal 2014 and 2013 aggregated to ` 163.24 million and ` 147.43
million, respectively, and our loss after tax for fiscal 2012 aggregated to ` 61.90 million, on a consolidated
basis.
We believe that the following factors have significantly affected our results of operations and financial condition
during the periods under review, and may continue to affect our results of operations and financial condition in
the future:
Macroeconomic Conditions
Recent global and domestic economic conditions have been unprecedented and challenging, with tighter credit
conditions and recession in most major economies, commencing in 2008 and continued into 2011. While the
global economy has recovered to an appreciable extent, the Indian economy continues to grow at a sluggish
pace. Continued concerns on the systemic impact of long-term and wide-spread recession and the availability
and cost of credit, combined with declining business confidence, have contributed to a decline in global and
domestic employment opportunities, particularly placement opportunities for management graduates in India
and worldwide. Similarly, it is possible that increasing pressures on household incomes, due to employment
instability and high inflation, may have disincentivized some students from pursuing expensive higher education
opportunities or, for instance, to seek placements in the public sector due to a perception of higher employment
opportunities as well as greater employment stability in the public sector in India, as compared to the private
sector. We believe that such factors may have adversely impacted demand for certain of our test prep courses, in
particular, MBA test prep courses (where enrolments have decreased from 39,403 as of March 31, 2013 to
32,286 as of March 31, 2014), which have historically been, and continue to be our most popular and higher
revenue-generating course offerings. Conversely, we believe that this has positively impacted the growth of our
Banking and Civil Services test prep courses, and we believe that, in the foreseeable future, growth in our non-
360
MBA test prep courses will continue to outpace demand in our MBA test prep courses, such as CAT, CMAT,
GMAT and GRE test prep.
Moreover, we believe that the lingering effects of the recent global economic slowdown have generally
dampened business confidence and made the credit markets more volatile, which has had a negative effect on
our operations and financial condition in the past, as well as negatively impacting other industry players,
including companies participating in our placement programs as well as our business partnerships and alliances.
Further, if we are unable to successfully anticipate and respond to changing economic and market conditions in
the future, our business, financial condition and prospects may be adversely affected.
Competition
Competition in each of our business segments, as well as in the education sector as a whole, is generally
fragmented. In particular, we face significant competition from local or regional players in the business
segments and geographical markets in which we operate, and our success depends to a significant extent on our
ability to ensure the continued quality, relevance and innovation of our courses and services.
For instance, in the test prep segment, we believe that we face competition in each of the courses that we offer
from generally from multiple regional players, in addition to larger players that have wider coverage across
India. There are also other players, which have a limited geographical scope and spread but have a strong
presence in the markets in which they operate. In the K-12 segment, especially in metropolitan and other larger
cities and towns in India and among the more affluent section of society, we believe that we face greater
competitive pressures from private schools and educational institutions (relative to government schools). The
vocational training business is generally driven by programs launched by, and under the aegis of, various State
and Central Governments in India in a need-based manner, wherein contracts are awarded through the tender
process, where we face competition from other players. We also conduct recruitment, training and event
management services for corporates and we face competition from other players including from corporates who
may undertake to recruit and train their own staff.
In the publishing and content development business, in addition to competition from traditional print and
publishing companies, we believe that we may also be facing an increasing level of competition from
multimedia companies that are engaged in developing educational content and providing multimedia products
and services in the education sector.
Our test prep and publication and content development businesses also face significant competition from online
content provided by through internet websites. Online content is typically available to consumers at a lower cost
than printed books and guides, and is also interactive and user friendly. In particular, the growing urban
population in India with access to the internet may prefer online content over printed material, thereby adversely
affecting our test prep business and sales of titles under the GK Publications brand.
Competitive factors may force us to reduce our fees and/or increase our spend in order to continue to attract
student enrolments and to retain and attract faculty members, and to pursue new market opportunities. Further,
,QGLD¶V JUDGual transition from the traditional classroom teaching model to the online or virtual model, and
related aspirations and requirements to digitize content and to supplement our network of test prep centers with
more innovative new media solutions and technology platforms adds an additional dimension to the challenges
posed to us by the competitive factors shaping the education sector in which we currently operate.
Our cost of raw material and components consumed primarily consists of the cost of purchase of paper, which is
our most critical raw material for our publication business, conducted through our Subsidiary, GK Publications.
Further, our sustained growth depends on our ability to attract and retain highly-qualified professionals in the
education sector, including faculty, content developers for our publications business, trainers for our vocational
training business and senior management. We also face significant competition in attracting and retaining
personnel who possess the skill sets that we seek. Our inability to recruit and retain skilled personnel on a long-
term basis may affect our business and profitability. In addition, our personnel may join competing businesses.
Our faculty members and subject experts may enter into competing businesses. There have been instances in the
past where our disassociated faculty members have started competing businesses under independent labels that
361
are in direct competition to our business. We also conduct continuous training programmes including refresher
guidance programmes for our faculty members throughout the year on teaching subjects as well as personality
development, attitude development and soft skills such as presentation and communication skills, leadership
skills and time management. These training sessions also involve training on teaching methodologies and
FRPPXQLFDWLRQ VNLOOV LQ RUGHU WR HTXLS RXU IDFXOW\ PHPEHUV WR DGDSW WR RXU VWXGHQWV¶ FKDQJLQJ QHHGV LQ WKH
competitive environment and changing examination trends, academic syllabi and increasing career options. We
incur significant costs towards these training programmes, and our inability to provide adequate training in a
cost effective manner, could adversely affect our business.
Our vocational training programs are funded by grants-in-aid by the relevant Central or State Governments and
a separate Government nominated agency is made responsible for program coordination, including ensuring that
project funds released by the Government are used only for the sanctioned project. We, as the implementation
agency, are reimbursed for costs and expenses incurred by us in relation to the implementation of such projects,
typically in a phased manner, subject to our meeting certain specified training and placement targets. While this
business is carried out by implementation agencies on a cost basis, the administrative costs of the projects are
permitted to be shared. Historically, payments have been received in an average period of 9-12 months.
Payments from the Central and State Governments may be, and have been, subject to several delays due to
regulatory scrutiny and long procedural formalities, including any audit by the Comptroller and Auditor General
of India. If payments under our contracts with Central and State Governments in the vocational training
segment are delayed, our working capital requirements would be adversely affected, resulting in additional
finance costs and increase in our realization cycle. Further, any change in Central or Sate Governments may
result in a change in policy and reassessment of the existing contracts. Any change in the terms of conditions of
existing or future contract may result in rendering all or some projects unviable, which may, in turn, result in
reduction of our revenues from this segment.
We believe that our brand is associated with academic excellence and that our future success will be
significantly influenced by continued investment in our brands Career Launcher, LST, GK Publications and
Indus World Schools. We also believe that continuing to develop awareness of our brands, through focused and
consistent branding and marketing initiatives, among students, parents and other players in the education
industry is critical to our ability to increase enrolments and revenues, increase penetration of our offerings in
existing markets and our planned expansion into new markets.
The factors that may impair our reputation and dilute the impact of our branding and marketing initiatives may
include the media strategies of our competitors, and the success ratio of our students vis-à-vis students enrolled
with any of our competitors, the costs of our branding and marketing campaigns, and any adverse publicity
involving us, our students or faculty hired by us or our business partners. In particular, as a significant part of
our operations is conducted through test prep centers and schools operated by our business partners, we license
our trademarks and brands to several third parties over whose activities we cannot, and do not, exercise direct
day-to-day control. While our agreements with our business partners prohibit them from effecting any damage
to our brand and intellectual property, and require them to indemnify us in case of any such losses, any misuse
or mismanagement on the part of our business partners may dilute the value of our brand and intellectual
property, which may adversely affect our business and prospects. Any impairment of our reputation or erosion
of our brand due to such factors, or any other risks or uncertainties presently unforeseen by us, may have an
adverse effect on our business and prospects.
In particular, the success of the Indus World Schools will depend on the success record of our students. The
VDWLVIDFWRU\SHUIRUPDQFHRI,QGXV:RUOG6FKRROVWXGHQWVLQWKHµ$OO,QGLD6HFRQGDU\6FKRRO([DPLQDWLRQ¶IRU
*UDGH;HTXLYDOHQWWRµ2¶OHYHOLQRWKHUMXULVGLFWLRQVWKHµ$OO,QGLD6HQLRU6FKRRO&HUWLILFDWH([DPLQDWLRQ¶
for Grade XII (equivalent tRµ$¶OHYHOLQRWKHUMXULVGLFWLRQVDQGWKHLUVXEVHTXHQWHQUROPHQWLQUHSXWHGKLJKHU
educational institutions will be critical to the brand image and market reputation of the Indus World Schools.
The revised Schedule VI was notified under the Companies Act,1956, and became applicable to us for
preparation and presentation of our financial statements from the financial year starting from April 1, 2011.
362
Accordingly, we have presented our financial statements as on and for the year ended March 31, 2012, along
with the comparatives as on and for the year ended March 31, 2011, following the requirements of the revised
Schedule VI.
The adoption of the revised Schedule VI does not impact the recognition and measurement principles followed
for preparation of financial statements. However, it has significant impact on the presentation and disclosures
made in the financial statements. We have also reclassified the previous year figures pertaining to the years
ended March 31, 2010, in accordance with the requirements of the revised Schedule VI.
We have prepared our restated consolidated financial statements along with related notes in accordance with the
requirements of the Guidance Note on revised Schedule VI and have reclassified previous year figures
accordingly.
While we believe that all aspects of our restated consolidated financial statements should be studied and
understood in assessing our current and expected results of operations and financial condition, we believe that
the following accounting policies warrant particular attention.
a. Basis of preparation of restated consolidated financial statement of the assets and liabilities
The restated consolidated financial statements have been prepared to comply with the Accounting Standards
notified under section 211 (3C) of the Companies Act, 1956 read with the General Circular 15/2013 dated 13
6HSWHPEHURIWKH0LQLVWU\RI&RUSRUDWH$IIDLUVLQUHVSHFWRIVHFWLRQRIWKH&RPSDQLHV$FWµWKH
$FW¶ 7KH UHVWDWHG FRQVROLGDWHG ILQDQFLDO VWDWHPHQWV KDYH EHHQ SUHSDred on a going concern basis under the
historical cost convention on accrual basis. The accounting policies have been consistently applied by us unless
otherwise stated. The restated consolidated financial statements of the Company have been prepared to comply
in all material respects with the requirements of Part I of Chapter III to the Companies Act, 2013 and Securities
and Exchange Board of India (Issue of Capital and Disclosure Requirements) Regulations, 2009 issued by SEBI,
as amended from time to time.
These restated consolidated financial statements and other financial information have been prepared after
incorporating:
(a) Adjustments for the material amounts in respective years to which they relate.
(b) Adjustments for reclassification of the corresponding items of income, expenses, assets and liabilities, in
order to bring them in line with the groupings as per the audited financial statements of the Company as
at and for the year ended March 31, 2014 (prepared in accordance with Revised Schedule VI of the
&RPSDQ\¶V$FWDQGWKHUHTXLUHPHQWVRIWKH6(%,5HJXODWLRQV
b. Principles of consolidation
The restated consolidated financial statements have been prepared in accordance with Accounting Standard
(AS- RQ ³&RQVROLGDWHG )LQDQFLDO 6WDWHPHQWV´ UHIHUUHG WR LQ WKH &RPSDQLHV $FFRXQWLQJ 6WDQGDUGV 5XOHV
2006 issued by the Central Government in exercise of the power conferred under sub-section (1) (a) of section
642 of the Companies $FWWKHµ$FW¶7KHUestated consolidated financial statements are prepared on the
following basis:
i. Restated consolidated financial statements include restated consolidated statement of assets and liability,
restated consolidated statement of profit and loss, restated consolidated statement of cash flow statement
and notes to restated consolidated financial statements, other statements and explanatory material that
form an integral part thereof. The restated consolidated financial statements are presented, to the extent
possible, in the same format as adapted by the Company for its restated standalone financial statements.
363
ii. The restated consolidated financial statements have been combined on a line by line basis by adding the
book values of like items of assets, liabilities, income and expenses after eliminating intra-group
balances/transactions and resulting unrealised profits in full. The amounts shown in respect of reserves
comprise the amount of the relevant reserves as per the &RPSDQ\¶V EDODQFH Vheet and its share in the
post-acquisition increase/ (decrease) in the relevant reserves of the entity to be consolidated. This
procedure has been performed using the audited restated standalone financial statements of CL Educate
Limited and its Subsidiaries.
iii. As per Accounting Standard 21 on restated consolidated financial statements, notes involving items
which are material need to be disclosed. Materiality for this purpose is assessed in relation to the
information contained in the restated consolidated financial statements.
iv. The restated consolidated financial statements have been drawn to keep all the information as contained
in the &RPSDQ\¶V restated consolidated financial statements for the year ended March 31, 2014 on
standalone basis.
The restated consolidated financial statements include the restated consolidated financial statements of CL
Educate limited and its Subsidiaries.
(i) During the financial year 2013-14, the Company has transferred its share in Career Launcher Asia
Education Hub Pte Ltd (Singapore) to our Subsidiary Kestone Integrated Marketing Services Private
Limited (India) at book value.
(ii) This Subsidiary was acquired by the Company with effect from October 1, 2011.
(iii) This company was promoted by the Company and was incorporated on August 28, 2011.
(iv) During the financial year 2013-14, the Company has transferred its share in Career Launcher USA Inc.
(The United States of America) to other shareholder at nil value.
(v) This Subsidiary was acquired by the Company with effect from October 28, 2006.
(vi) This company was promoted as a wholly owned Subsidiary company by a Subsidiary of the Company,
QDPHO\ ³&DUHHU /DXQFKHU (GXFDWLRQ ,QIUDVWUXFWXUH DQG 6HUYLFHV /LPLWHG´ DQG ZDV LQFRUSRUDWHG RQ
February 2008.
Entities acquired/ sold during the year have been consolidated from/ upto the respective date of their acquisition/
disposal.
d. Use of estimates
364
The preparation of restated consolidated financial statements in conformity with Generally Accepted
Accounting Principles requires management to make estimates and assumptions that affect the reported amounts
of assets, liabilities and contingent liabilities at the reported date and the reported amounts of revenues and
H[SHQVHVGXULQJWKHUHSRUWLQJSHULRG$OWKRXJKWKHVHHVWLPDWHVDUHEDVHGRQWKHPDQDJHPHQWV¶EHVWNQRZOHGJH
of current events and actions, actual results could differ from these estimates. Any revision in accounting
estimate is recognised prospectively in current and future periods.
e. Revenue recognition
Revenue is recognised to the extent that it is probable that the economic benefit will flow to us and revenue can
be reliably measured.
Our educational and training businesses include revenue from services and sales of text books.
Revenue in respect of educational and training fees received from students is recognised on time basis over the
period of the course. Fees are recorded at invoice value excluding taxes and net of discounts, if any.
Revenue in respect of vocational training is recognised over the period of the training period. However, taking
into account the uncertainty involved in conditions to be fulfilled under the terms of the contract, portion of such
revenue depending upon such uncertainty is deferred till the fulfillment of conditions of the contract.
Sale of text books for full course is recognised at the time of receipt of first payment on account of test
preparation services provided by us.
Advertisement income
Revenue is recognised on accrual basis, if the right to receive payment is established by the balance sheet date.
Revenue in respect of infrastructure fee and soft skills fee are charged from different institutions on revenue
sharing basis and are recognised on accrual basis over the year of rendering services.
Revenue in respect of event management service is recognised on proportionate completion method by relating
the revenue with work accomplished and certainty of consideration available.
Revenue in respect of managed manpower services and others is recognised on an accrual basis, in accordance
with the terms of the respective contract.
Revenue is recognised when the significant risks and rewards of ownership have passed on to the buyer and is
disclosed net of sales return and trade discounts. Allowances for sales returns are estimated and provided for in
the year of sales.
Revenue from consultancy services and seminar and alliance income is recognised as and when services are
actually rendered.
365
Revenue in respect of training fee, school fee and subscription fee is recognised on accrual basis in the year to
which it pertains.
Pass through revenue arises on account of facilities provided to customers, in which debtors of the customers are
realised through us. Revenue is generally a portion of such realisation and recognition of such revenue is made
on receipt of request of such realisation from customers.
Grant income
Government grants available to us are recognised when both the following conditions are satisfied:
(a) where there is reasonable assurance that we will comply with the conditions attached to them; and
(b) where such benefits have been earned by us and it is reasonably certain that the ultimate collection will
be made.
Grants related to specific fixed assets are shown as a deduction from the gross value of the asset concerned in
arriving at its book value. The grant is recognised in the restated consolidated statement of profit and loss over
the useful life of a depreciable asset by way of a reduced depreciation charge. Where the grant equals the whole,
or virtually the whole, of the cost of the asset, the asset is shown in the balance sheet at a nominal value. Grants
for various government projects carried out by us are disclosed in other operating income as grant income.
License fee
Revenue in respect of one-time license fee received from the franchisees is recognised on execution of the
contract.
Revenue from licensing of content given for a long term period and dependent on percentage of revenue earned
by the licensee is recognised when the right to receive payment is established.
License fee on account of grant of brand on non exclusive basis is one-time fee charged from different schools
and is recognised in the year in which contract is executed.
Royalty income
Revenue from royalty is recognised on an accrual basis in accordance with the terms of the relevant agreement.
Content development fee is recognised on accrual basis on raising of bill for the period for which services are
provided.
Subscription fee
Unbilled revenue
Unbilled revenue, included in other current assets, represents amounts recognised based on services performed
in advance of billing in accordance with service terms.
Unearned revenue
Amounts billed and received or recoverable prior to the reporting date of services to be performed after the
reporting date are recorded as unearned revenue in other current liabilities.
Other Income
366
Revenue from interest on time deposits, inter-corporate loans and other loans are recognised on the time
proportion method taking into consideration the amount outstanding and the applicable interest rates.
Dividend income
Dividends income is recognised when the right to receive the same is established.
f. Fixed Assets
Tangible Assets
Tangible fixed assets are stated at cost of acquisition net of recoverable taxes (wherever applicable), less
accumulated depreciation and impairment losses, if any. Cost comprises the purchase price and any cost
attributable to bringing the assets to its working condition for its intended use.
Subsequent expenditure related to an item of fixed asset is added to its book value only if it increases the future
benefits from the existing asset beyond its previously assessed standard of performance. All other expenses on
existing fixed assets, including day to day repair and maintenance and cost of replacing parts, are charged to the
restated consolidated statement of profit and loss for the period during which such expenses are incurred.
Fixed assets retired from active use and held for disposal are stated at lower of book value and net realisable
value as estimated by us and are shown separately in the restated consolidated financial statements under other
current assets. Loss determined, if any, is recognised immediately in the restated consolidated statement of
profit and loss, whereas profit and sale of such assets is recognised only upon completion of sale thereof.
Intangible Assets
An intangible asset is recognised when it is probable that the future economic benefits attributable to the asset
will flow to the enterprise and where its cost can be reliably measured. Intangible assets are stated at cost of
acquisition less accumulated amortization and accumulated impairment losses, if any. Cost comprises the
purchase price and any cost attributable to bringing the assets to its working condition for its intended use.
Gain or loss arising from the retirement of disposal of an intangible asset are determined as the difference
between the net disposal proceeds and the carrying amount of asset is recognised as income or expense in the
restated consolidated statement of profit and loss in the year in which the asset is derecognized.
Depreciation and amortisation has been calculated on WKHµStraight Line Method¶ at the following rates, based on
management estimates, which are equal to or higher than the rates specified as per schedule XIV of the
Companies Act, 1956, which in the opinion of the management are reflective of the estimated useful lives of the
Fixed Assets.:
^Goodwill reflects the excess of cost of acquisition over the book value of net assets acquired on the date of the
acquisition. Goodwill is tested for impairment on an annual basis.
Depreciation and amortisation on addition to fixed assets is provided on pro-rata basis from the date the assets
are ready for intended use. Depreciation and amortisation on sale/discard of fixed assets is provided for upto the
date of sale, deduction or discard of fixed assets as the case may be.
All assets, except chairs used in test preparation centres costing ൕ 5,000 or below are depreciated in full by a
one-time depreciation charge unless used as project assets under infrastructure projects.
h. Impairment of assets
The carrying amounts of assets are reviewed at each balance sheet date to determine if there is any indication of
impairment based on internal/external factors. An impairment loss is recognised wherever the carrying amount
RIDQDVVHWH[FHHGVLWVUHFRYHUDEOHDPRXQW7KHUHFRYHUDEOHDPRXQWLVWKHJUHDWHURIWKHDVVHW¶VQHWVHOOLQJSULFH
and value in use. In assessing value in use, the estimated future cash flows are discounted to their present value
at the weighted average cost of capital.
After impairment, depreciation/amortisation is provided on the revised carrying amount of the asset over its
remaining useful life.
i. Borrowing costs
Borrowing costs relating to acquisition or construction or production of assets which take substantial period of
time to get ready for its intended use are included as cost of such assets to the extent they relate to the period till
such assets are ready to be put to use. Other borrowing costs are recognised as an expense in the period in which
they are incurred.
j. Leases
Finance leases, which effectively transfer to us substantially all the risks and benefits incidental to ownership of
the leased item, are capitalised at the inception of the lease term at the lower of the fair value of the leased
property or present value of minimum lease payments. Lease payments are apportioned between the finance
charges and reduction of the lease liability so as to achieve a constant rate of interest on the remaining balance
of the liability. Finance charges are recognised as finance costs in the restated consolidated statement of profit
and loss. Lease management fees, legal charges and other initial direct costs of lease are capitalised.
A leased asset is depreciated on a straight-line basis over the useful life of the asset or the useful life envisaged
in Schedule XIV to the Companies Act, 1956, whichever is lower. However, if there is no reasonable certainty
that we will obtain the ownership by the end of the lease term, the capitalised asset is depreciated on a straight-
line basis over the shorter of the estimated useful life of the asset, the lease term or the useful life envisaged in
Schedule XIV to the Companies Act, 1956.
Leases, where the lessor effectively retains substantially all the risks and benefits of ownership of the leased
item, are classified as operating leases. Operating lease payments are recognised as an expense in the restated
consolidated statement of profit and loss on a straight-line basis over the lease term.
368
Leases in which we transfer substantially all the risks and benefits of ownership of the asset are classified as
finance leases. Assets given under finance lease are recognised as a receivable at an amount equal to the net
investment in the lease. After initial recognition, we apportion lease rentals between the principal repayment and
interest income so as to achieve a constant periodic rate of return on the net investment outstanding in respect of
the finance lease. The interest income is recognised in the restated consolidated statement of profit and loss.
Initial direct costs such as legal costs, brokerage costs, etc. are recognised immediately in our restated
consolidated statement of profit and loss.
Leases in which we do not transfer substantially all the risks and benefits of ownership of the asset are classified
as operating leases. Assets subject to operating leases are included in fixed assets. Lease income on an operating
lease is recognised in the restated consolidated statement of profit and loss on a straight-line basis over the lease
term. Costs, including depreciation, are recognised as an expense in the restated consolidated statement of profit
and loss. Initial direct costs such as legal costs, brokerage costs, etc. related to lease are recognised immediately
in the restated consolidated statement of profit and loss.
k. Investment property
An investment in land or buildings, which is not intended to be occupied substantially for use by, or in our
operations, is classified as investment property. Investment properties are stated at cost, net of accumulated
depreciation and accumulated impairment losses, if any.
The cost comprises purchase price and directly attributable cost of bringing the investment property to its
working condition for the intended use. Any trade discounts and rebates are deducted in arriving at the
purchase price.
Depreciation on building component of investment property is calculated on a straight-line basis using the
rate arrived at based on the useful life estimated by the management, or that prescribed under the Schedule
XIV to the Companies Act, 1956, whichever is higher. We have used the depreciation rate of 1.67% (useful
life of 60 years).
On disposal of an investment, the difference between its carrying amount and net disposal proceeds is
charged or credited to the restated consolidated statement of profit and loss.
Accounting treatment
Investments, which are readily realisable and intended to be held for not more than one year from the date on
which such investments are made, are classified as current investments. All other investments are classified as
long-term investments.
On initial recognition, all investments are measured at cost. The cost comprises purchase price and directly
attributable acquisition charges such as brokerage, fees and duties. If an investment is acquired, or partly
acquired, by the issue of shares or other securities, the acquisition cost is the fair value of the securities issued. If
an investment is acquired in exchange for another asset, the acquisition is determined by reference to the fair
value of the asset given up or by reference to the fair value of the investment acquired, whichever is more
clearly evident.
Current investments are carried in the restated consolidated financial statements at lower of cost and fair value
determined on an individual investment basis. Long-term investments are carried at cost. However, provision for
diminution in value is made to recognise a decline other than temporary in the value of long term investments on
individual investment basis.
On disposal of an investment, the difference between its carrying amount and net disposal proceeds is charged
or credited to the restated consolidated statement of profit and loss.
Classification in the restated consolidated financial statements as per requirements of Revised Schedule-VI
Investments that are realisable within the period of twelve months from the balance sheet date are classified as
current investments. All other investments are classified as non-current investments.
369
m. Inventories
i. Raw materials are valued at lower of cost or net realisable value. The comparison of cost and net
realisable value is made on an item by item basis. Cost includes purchase price, (excluding those
subsequently recoverable by the enterprise from the concerned revenue authorities), freight inwards and
other expenditure incurred in bringing such inventories to their present location and condition. In
determining the cost, first in first out method is used. The carrying cost of raw materials, packaging
materials and stores and spare parts are appropriately written down when there is a decline in
replacement cost of such materials or finished products in which these will be incorporated are expected
to sell below cost.
ii. Work in progress, manufactured finished goods and traded goods are valued at the lower of cost and net
realisable value. The comparison of cost and net realisable value is made on an item by item basis. Cost
of work in progress and manufactured finished goods is determined on the first in first out basis and
comprises direct material, cost of conversion and other costs incurred in bringing these inventories to
their present location and condition. Cost of traded goods is determined on a first in first out basis.
iii. 3URYLVLRQRIREVROHVFHQFHRQLQYHQWRULHVLVFRQVLGHUHGRQWKHEDVLVRIPDQDJHPHQW¶VHVWLPDWHEDVHGRQ
demand and market of the inventories.
n. Employee Benefits
All employee benefits payable wholly within twelve months of rendering the service are classified as short term
employee benefits. Benefits such as salaries, wages, and bonus etc are recognised in the restated consolidated
statement of profit and loss in the period in which the employee renders the related service.
Employees of our Company and certain Subsidiaries are entitled to receive benefits under the Provident Fund,
which is a defined contribution plan. Both the employee and the employer make monthly contributions to the
plan at a predetermined rate as per the provisions of The Employees Provident Fund and Miscellaneous
Provisions Act, 1952). These contributions are made to the fund administered and managed by the Government
of India.
Our contributions to the scheme are expensed off in the restated consolidated statement of profit and loss. We
have no further obligations under these plans beyond its monthly contributions.
Employees whose wages/salary is within the prescribed limit in accordance with the Employee State Insurance
Act, 1948, are covered under this scheme. These contributions are made to the fund administered and managed
by the Government of India.
Our contributions to the scheme are expensed off in the restated consolidated statement of profit and loss. We
have no further obligations under these plans beyond its monthly contributions.
We and certain Subsidiaries provide for retirement benefits in the form of Gratuity. Benefits payable to eligible
employees of the company with respect to gratuity, a defined benefit plan are accounted for on the basis of an
actuarial valuation as at the balance sheet date. In accordance with the Payment of Gratuity Act, 1972, the plan
provides for lump sum payments to vested employees on retirement, death while in service or on termination of
employment in an amount equivalent to 15 days basic salary for each completed year of service. Vesting occurs
upon completion of five years of service. The present value of such obligation is determined by the projected
370
unit credit method and adjusted for past service cost and fair value of plan assets as at the balance sheet date
through which the obligations are to be settled. The resultant actuarial gain or loss on change in present value of
the defined benefit obligation or change in return of the plan assets is recognised as an income or expense in the
restated consolidated statement of profit and loss. The expected return on plan assets is based on the assumed
rate of return of such assets.
The Company and its Subsidiaries contribute to a trust set up by them, which further contribute to a policy taken
from the Life Insurance Corporation of India except in case of G.K. Publications Private Limited.
Benefits under RXU &RPSDQ\¶V DQG FHUWDLQ 6XEVLGLDULHV¶ OHDYH HQFDVKPHQW scheme constitute other employee
benefits. The liability in respect of leave encashment is provided on the basis of an actuarial valuation done by
an independent actuary at the end of the year. Actuarial gains and losses are recognised immediately in the
restated consolidated statement of profit and loss.
ESOP 2008 provides for the grant of our equity shares to its employees. ESOP 2008 provides that employees are
granted an option to acquire equity shares that vests in a graded manner. The options may be exercised within a
specified period. We follow the fair value method to account for its stock-based employee compensation plans.
Compensation cost is measured using independent valuation by a firm of chartered accountants using Black-
Scholes model in accordance with the guidance note issued by the Institute of Chartered Accountants of India.
Compensation cost, if any, is amortised over the vesting period.
Our reporting currency is the Indian Rupee. However, the local currencies of non-integral overseas Subsidiaries
are different from our reporting currency.
Transactions in foreign currency are recorded at the exchange rate prevailing at the date of the transaction.
Exchange differences arising on foreign currency transactions settled during the year are recognised in the
restated consolidated statement of profit and loss.
Monetary assets and liabilities denominated in foreign currencies as at the balance sheet date, not covered by
forward exchange contracts, are translated at year end rates. The resultant exchange differences are recognised
in the restated consolidated statement of profit and loss. Non-monetary assets are recorded at the rates prevailing
on the date of the transaction. profit and loss items at representative offices located outside India are translated
at the respective monthly average rates. Monetary balance sheet items at representative offices at the balance
sheet date are translated using the year-end rates. Non-monetary balance sheet items are recorded at the rates
prevailing on the date of the transaction.
Statement of profit and loss items at branch offices located outside India are translated at daily average rates.
Monetary balance sheet items at branch offices at the balance sheet date are translated using the year-end rates.
Non monetary balance sheet items are recorded at the rates prevailing on the date of the transaction.
The financial statements of the foreign integral Subsidiaries and representative offices (collectively referred to
DVWKHµ)RUHLJQ,QWHJUDO2SHUDWLRQV¶DUHWUDQVODWHGLQWR,QGLDQ5XSHHVDVIROORZV-
x Non-monetary balance sheet items, other than inventories, are translated using the exchange rate at the
date of transaction i.e., the date when they were acquired.
x Monetary balance sheet items and inventory are translated using year-end rates.
x Profit and loss items, except opening and closing inventories and depreciation, are translated at the
respective monthly average rates. Opening and closing inventories are translated at the rates prevalent at
the commencement and close respectively of the accounting period. Depreciation is translated at the rates
used for the translation of the values of the assets on which depreciation is calculated.
x Contingent liabilities are translated at the closing rate.
371
x The net exchange difference resulting from the translation of items in the financial statements of foreign
integral operations is recognised as income or expense for the year.
The financial statements of the foreign non integral Subsidiaries and joint venture (collectively referred to as the
µIRUHLJQQRQLQWHJUDORSHUDWLRQV¶DUHWUDQVODWHGLQWR,QGLDQ5XSHHVDVIROORZV-
x Share capital and opening reserves and surplus are carried at historical cost.
x All assets and liabilities, both monetary and non-monetary, (excluding share capital, opening reserves
and surplus) are translated using the year-end rates.
x Profit and loss items are translated at the respective monthly average rates.
x Contingent liabilities are translated at the closing rate.
x The resulting net exchange difference is credited or debited to the foreign currency translation reserve.
A reclassification from foreign integral operations to foreign non-integral operations or vice versa is made
consequent to change in the way operations of entities are financed and operates. The translated amounts for
non-monetary items of reclassified entities on the date of such reclassification are treated as the historical cost
for those items in the period of change and subsequent periods. Exchange differences which have been deferred
in foreign currency translation reserve are not recognised as income or expenses until the disposal of that entity.
q. Income taxes
Income tax expense comprises current tax (i.e. amount of tax for the year determined in accordance with the
Income-tax law), deferred tax charge or credit and MAT credit entitlement.
Deferred tax charge or credit reflects the tax effects of timing differences between accounting income and
taxable income for the period. The deferred tax charge or credit and the corresponding deferred tax liabilities or
assets are recognised using the tax rates that have been enacted or substantively enacted by the balance sheet
date. Deferred tax assets are recognised only to the extent there is reasonable certainty that the assets can be
realised in future; however, where there is unabsorbed depreciation or carry forward of losses, deferred tax
assets are recognised only if there is a virtual certainty of realisation of such assets. Deferred tax assets are
reviewed at each balance sheet date and are written-down or written up to reflect the amount that is reasonably /
virtually certain (as the case may be) to be realised.
The break-up of the major components of the deferred tax assets and liabilities as at balance sheet date has been
arrived at after setting off deferred tax assets and liabilities where the entity has a legally enforceable right to
set-off assets against liabilities and where such assets and liabilities relate to taxes on income levied by the same
governing taxation laws.
Provisions
We create a provision when there is present obligation as a result of a past event that probably requires an
outflow of resources and a reliable estimate can be made of the amount of obligation.
Contingent liabilities
372
A disclosure for a contingent liability is made when there is a possible obligation or a present obligation that
probably will not require an outflow of resources or where a reliable estimate of the obligation cannot be made.
Contingent assets
Contingent assets are neither recorded nor disclosed in the restated consolidated financial statements.
Cash and cash equivalents include cash in hand, demand deposits with banks, other short term highly liquid
investments with original maturities of three months or less.
t. Exceptional items
Items of income or expense from ordinary activities which are of such size, nature or incidence that, their
disclosure is relevant to explain the performance of the enterprise for the period, are disclosed separately in the
restated consolidated statement of profit and loss.
Basic earnings per share are calculated by dividing the net profit or loss for the year attributable to equity
shareholders by the weighted average number of equity shares outstanding during the year. The weighted
average number of equity shares outstanding during the period is adjusted for events of bonus issue, share split
or consolidation of shares.
For calculating diluted earnings per share, the net profit or loss for the year attributable to equity shareholders
and the weighted average number of shares outstanding during the year are adjusted for the effects of all dilutive
potential equity shares. The dilutive potential equity shares are deemed converted as of the beginning of the
period, unless they have been issued at a later date.
v. Segment reporting
We identify primary segments based on the dominant source, nature of risks and returns and the internal
organisation and management structure. The operating segments are the segments for which separate financial
information is available and for which operating profit/loss amounts are evaluated regularly by the executive
management in deciding how to allocate resources and in assessing performance.
The accounting policies adopted for segment reporting are in line with the accounting policies of the Company.
Segment revenue, segment expenses, segment assets and segment liabilities have been identified to segments on
the basis of their relationship to the operating activities of the segment.
Inter-segment revenue is accounted on the basis of transactions which are primarily determined based on market
/fair value factors.
Revenue, expenses, assets and liabilities which relate to us as a whole and are not allocable to segments on
reasonable basis have been LQFOXGHGXQGHUµunallocated revenue / H[SHQVHVDVVHWVOLDELOLWLHV¶.
Share issue expenses are adjusted against the securities premium account as permissible under Section 78 of the
Act, to the extent balance is available for utilization in the securities premium account. The balance of share
issue expenses in excess of securities premium account, if any, are charged to restated consolidated statement of
profit and loss.
373
Results of Operations and Financial Condition
The following table sets out certain information relating to our revenue from operations for the periods
described below:
Sale of Products
Our revenue from sale of study material primarily consists of the fee received by us for sale of the standard text
books and other study materials to students enrolling in our test prep and vocational training businesses. Students are
invoiced separately for educational training services and for the standard text books that are provided by us.
Our revenue from sale of text books primarily consists of the income received for the sale of the text books for
various competitive exams, through our Subsidiary, GK Publications.
Sale of Services
Our education and training fees primarily consists of the fee received from the students from our test prep
courses. Our products and services are generally priced at a gross price at which the students could be eligible
certain discounts. Also our products are priced at a price inclusive of service tax.
374
Vocational Training Services Income
Our fees from vocational training services primarily consist of fees received for providing vocational training
services to students. Generally, these vocational training programs are conducted in partnerships with either the
private sector partners or with the central or state government. In case of the programs that are conducted in
partnership with private sector entities, the fees could be paid either by the enrolling student or by the corporate or in
a mix of both, depending on the nature of contract entered into by us with the corporate. In case of programs
conducted in partnership with a state or central government, the fee is received form the respective state or central
government.
Our management manpower fees primarily consist of the revenue through our Subsidiary, Kestone, from which
we source, deploy and manage personnel requirements for corporate customers. Corporates outsource their
manpower requirements to us and pay us an agency fee/commission, over and above the salary and statutory
benefits payable to the employees deployed to meet the requirements of such corporations.
Our fees from event management services consist of the revenues which accrue to our Subsidiary, Kestone, for
conducting various marketing related activities, events, customer awareness and customer engagement and
development programs for industrial customers predominantly in the IT space. It also includes support of
integrated marketing services including the same in the digital medium.
Our income from pass through services which accrue to our Subsidiary, Kestone, arises on account of facility
provided to customers, in which Kestone facilitates receipt of various services/goods to customers from various
vendors by acting as a key vendor for the client. Revenue is recognized on the value of invoicing done to
customer for the services/goods.
Our soft skills fees primarily consist of the fees which is charged by us to the trusts that operate the Indus World
Schools under our K-12 business, for allowing them to operate these sFKRROVXQGHUWKHµ,QGXV:RUOG6FKRRO¶EUDQG
academic content, academic pedagogy, technology backbone required for operating the schools including business
and academic ERPs and teacher training. This is usually charged as a percentage of the fee collected from the
students at the school under each of the respective trusts.
Our school tuition fee primarily consist of the fees charged by us from the students in the day care and junior play
schools operated under the Indus World Schools in our K-12 business, through our Subsidiary, CLEIS. This school
fee from students is recognized on accrual basis.
Our other operating revenue includes one-time start up fees and licence fees from business partners operating
our test prep centers, advertising income received by us for advertisements released by advertisers in our
magazines or our websites, infrastructure fees charged by us from trusts operating the Indus World Schools for
providing infrastructure to enable to operate the Indus World Schools in our K-12 business, sale of scrap on
account of scrapping of old books and study material from the inventory which is either non-moving or
extremely slow moving, campus placement fees charged from various colleges to help prepare their students for
appearing in job interviews, bus fees collected from students in the Indus World Schools on account of transport
services provided to them, income from our day care centers at the Indus World Schools (which is recognized in
CLEIS), grant income, reflecting the amount received from the respective state or central government for
execution of vocational training programs, and other miscellaneous operating income.
Expenses
375
The following table shows our total expenses for the periods described below:
Cost of raw material and components consumed primarily consists of the cost of purchase of paper, which is our
most critical raw material for our publication business, conducted through our Subsidiary, GK Publications.
Cost of Services
Cost of services primarily consists of business partner payments; faculty expenses incurred by us to operate our
primary business of test prep. Further it contains printing, binding, packaging, material printing, content
development cost incurred by our Subsidiaries, CL Media and GK Publications.
Purchases of Stock-in-Trade
Increase or decrease in inventories of finished goods, work-in-progress and traded goods includes the increase or
decrease in inventory of finished goods, raw materials and work in progress and traded goods and consists of raw
paper, printed books, books under preparation and books held as stock for sale.
Personnel cost primarily consists of salary and benefits paid to our full time employees and would also
include salary and benefits paid to our employees contracted to meet the personnel requirements of various
corporates as part of our vocational services. This also includes costs included of employees employed under
the various manpower programs in our Subsidiary, Kestone.
Other Expenses
Our other expenses include all other general and administrative expenses incurred by us for the normal conduct
of our business, other than those mentioned above or below. This includes banquet and event material expenses,
primarily incurred through our Subsidiary, Kestone, advertisement, publicity and sales promotion expenses,
travelling, conveyance and vehicle maintenance expenses, rent expenses, office expenses, bad debts written off,
advances written off, and legal and professional expenses.
Interest expenses primarily consist of interest on unsecured loans from banks and others, bank charges and
interests on vehicle loans, term loans, overdrafts, land instalments and interest others.
Depreciation/Amortization
376
Depreciation expense primarily consists of depreciation of our fixed assets and amortization of the
intangible assets like intellectual property rights.
There have been no changes in our accounting policies in the preceding three years.
Our total revenue from operations increased by 9.91% from ` 1,989.72 million in fiscal 2013 to ` 2,186.85 million
in fiscal 2014, primarily on account of an increase in both sale of products and sale of services.
Income from sale of products increased by 9.18% from ` 336.55 million in fiscal 2013 to ` 367.46 million in fiscal
2014, primarily on account of a 20.94% increase in sale of textbooks, from ` 149.60 million in fiscal 2013 to `
180.93 million in fiscal 2014, as we introduced several new titles during fiscal 2014, including new bilingual titles
in Hindi introduced for the first time.
Income from sale of services increased by 11.13% from ` 1,503.73 million in fiscal 2013 to ` 1,671.07 million in
fiscal 2014, primarily on account of a 3.89% increase in education and training programs income from ` 782.21
million in fiscal 2013 to ` 812.62 million in fiscal 2014 ± the growth in our education and training programs
income during this period was primarily due to increase in enrolments in, and income from, our civil services
and other test prep courses, as enrolments in, and income from, our MBA test prep courses saw a decline during
this period due to challenging macroeconomic conditions and the lingering effects of the global financial crisis
in the Indian economy. In addition, there was a 45.71% increase in our vocational training services income, from `
67.25 million in fiscal 2013 to ` 97.99 million in fiscal 2014, as well as a 69.88% increase in our event
management services income, from ` 178.74 million in fiscal 2013 to ` 303.65 million in fiscal 2014, due to an
increase in average revenue earned per event. However, there was a 3.83% decrease in manpower services income
from ` 447.09 million in fiscal 2013 to ` 429.95 million in fiscal 2014, primarily due to a manpower rationalization
exercise carried out during this period by one of the corporate customers of our Subsidiary, Kestone.
Our other operating revenue marginally decreased marginally from ` 149.44 million in fiscal 2013to ` 148.32
million in fiscal 2014.
Other Income
Our other income decreased by 52.20% from ` 230.59 million in fiscal 2013 to ` 110.22 million in fiscal 2014,
primarily due to lower liability written back and lower provisions written back, as well as lower interest
income on income tax and loans and advances.
Expenditure
Our total expenditure including interest and finance charges and depreciation/amortization increased by
2.28% from ` 2,033.34 million in fiscal 2013 to ` 2,079.64 million in fiscal 2014, due to the reasons described
below.
Our cost of raw material and components consumed increased by 18.59% from ` 78.97 million in fiscal 2013 to `
93.65 million in fiscal 2014, primarily due to increased purchases of raw material for increased printing of study
material and text books by our Subsidiary, CL Media, in connection with our publishing and content development
business, as well as an increase in the average cost of paper during this period.
377
Cost of Services
Our cost of services decreased by 1.25% from ` 526.04 million in fiscal 2013 to ` 519.44 million in fiscal 2014,
primarily on account of a 11.96% decrease in business partner expenses from ` 372.10 million in fiscal 2013 to `
327.60 million in fiscal 2014. During fiscal 2014, the business done by centers operated by our business partners
reduced to ` 507.40 million, from ` 550.18 million in fiscal 2013, as 30 centers operated by our business partners
were shut or converted into owned centers during fiscal 2014, and also due to an increase in printing cost from `
37.23 million in fiscal 2013 to ` 49.19 million in fiscal 2014, as the number of books printed by our Subsidiary, CL
Media, increased in connection with the growth of our publishing and content development business.
Purchases of Stock-In-Trade
Our expenses on account of purchases of stock in trade increased by 23.84% from ` 13.17 million in fiscal 2013 to `
16.31 million in fiscal 2014, primarily due to increase in purchase of study material given to students enrolled in our
test prep courses, on account of increased enrolments in our test prep courses during fiscal 2014.
Our closing inventory increased by 63.78% from ` 62.57 million as on March 31, 2013 to ` 102.48 million as on
March 31, 2014, primarily due to an 82.21% increase in inventory of finished goods produced during fiscal 2014,
from ` 47.28 million in fiscal 2013 to ` 86.15 million in fiscal 2014, and a 144.83% increase in inventory of work in
progress, from ` 6.67 million in fiscal 2013 to ` 16.33 million in fiscal 2014, because, towards the end of fiscal 2014,
in order to reduce print cost per book, we entered into larger sized print orders, which were stored in our inventory
as on March 31, 2014 to be consumed in coming quarters. In addition, there was an increase in the average value of
our inventory due to sales returns received towards the end of fiscal 2014 in our Subsidiary, GK Publications, and
also due to an increase in the average cost of purchase due to increased production cost during this period.
Our employee benefit expenses increased by 1.77% from ` 674.64 million in fiscal 2013 to ` 686.57 million in
fiscal 2014, primarily due to a 2.57% increase in the salary, wages, bonus and other benefits component, from
` 628.15 million in fiscal 2013 to ` 644.29 million in fiscal 2014.
Finance Costs
Our finance costs decreased by 11.24% from ` 101.06 million in fiscal 2013 to ` 89.70 million in fiscal 2014,
primarily due to a 50.33% decrease in interest paid on term loans, from ` 30.40 million in fiscal 2013 to ` 15.10
million in fiscal 2014, as the amount of term loans decreased owing to repayment, despite an increase in the
average rate of interest being charged by the banks.
Depreciation/Amortization Expense
Our depreciation/amortization expense decreased by 2.29% from ` 55.97 million in fiscal 2013 to ` 54.69
million in fiscal 2014, primarily due to lower depreciation on furniture and fixtures in fiscal 2014, given that
several assets with a purchase price of ` 5,000 or less were purchased by us for government vocational
training projects in fiscal 2013, which were 100% depreciated in the same fiscal.
Other Expenses
Our other expenses increased by 7.91% from ` 610.87 million in fiscal 2013 to ` 659.19 million in fiscal 2014,
primarily on account of a 41.12% increase in banquet and event material expenses from ` 83.02 million in fiscal
2013 to ` 117.16 million in fiscal 2014, given an increase in the number of events conducted for corporate clients by
our Subsidiary, Kestone, and a 238.98% increase in legal and professional expenses, from ` 17.93 million in fiscal
2013 to ` 60.78 million in fiscal 2014. This was offset by a 98.27% decrease in advances written off, from ` 123.22
million in fiscal 2013 to ` 2.13 million in fiscal 2014, primarily because we wrote off a provision for advances
amounting to ` 112.88 million to CLEF in fiscal 2012 as well as writing back the actual balance amounting to
` 15.49 million due in the nature of short term loans and advances recoverable from CLEF.
378
Fiscal 2013 Compared To Fiscal 2012
Our total revenue from operations increased by 20.06%, from ` 1,657.31 million in fiscal 2012 to ` 1,989.72
million in fiscal 2013, primarily on account of increase in both sale of products and sale of services.
Our income from sale of products increased by 64.76% from ` 204.27 million in fiscal 2012 to ` 336.55 million in
fiscal 2013, primarily on account of a 25.61% increase in sale of study material, from ` 148.83 million in fiscal
2012 to ` 186.95 million in fiscal 2013, given the increase in the number of students enrolled in our test prep
courses, to whom this study material is provided, a 169.89% increase in sale of text books, from ` 55.43 million in
fiscal 2012 to ` PLOOLRQLQILVFDORQDFFRXQWRIRXUDFTXLVLWLRQRI*.3XEOLFDWLRQ¶VSXEOLVKLQJDQG
content development business in fiscal 2012, pursuant to which the full year impact of sales from the GK
Publications business was recognized in fiscal 2013.
Our income from sale of services increased by 12.15% from ` 1,340.78 million in fiscal 2012 to ` 1,503.73 million
in fiscal 2013, primarily on account of a 20.87% increase in our education and training services income, from `
647.16 million in fiscal 2012 to ` 782.21 million in fiscal 2013, given the increase in the number of students
enrolled in our test prep courses and an increase in average fee charged per student across courses, a marginal
increase in vocational training services income, from ` 65.57 million in fiscal 2012 to ` 67.25 million in fiscal
2013, and an 8.50% increase in manpower services income from ` 412.08 million in fiscal 2012 to ` 447.09
million in fiscal 2013, as we signed new manpower managing agreements with both existing and new clients
during fiscal 2013, mainly through our Subsidiary, Kestone.
Our other operating revenue increased by 33.12% from ` 112.26 million in fiscal 2012 to ` 149.44 million in
fiscal 2013, primarily on account of a substantial increase in grant income in our vocational training business,
from ` 5.10 million in fiscal 2012 to ` 78.86 million in fiscal 2013, despite a decrease in infrastructure fees,
from ` 49.47 million in fiscal 2012 to ` 15.28 million in fiscal 2013 (due to infrastructure fees being charged by
us from the Indus World School of Business in fiscal 2012, which was no longer charged in fiscal 2013).
Other Income
Our other income increased by 122.86% from ` 103.47 million in fiscal 2012 to ` 230.59 million in fiscal
2013, primarily due to higher provisions written back (on account of advances amounting to ` 112.88 million
made in fiscal 2012 to CLEF, which was written back in fiscal 2013), and higher liability written back (on
account of closing of Dubai test prep centers in fiscal 2013).
Expenditure
Our total expenses increased by 23.11% from ` 1,651.70 million in fiscal 2012 to ` 2,033.34 million in fiscal
2013, as further described below:
Our cost of raw material and components consumed increased by 346.41% from ` 17.69 million in fiscal 2012 to `
78.97 million in fiscal 2013, primarily because of increased purchases of raw material by us, given the increased
scale of printing of study material and text books by our Subsidiary, CL Media, in connection with the GK
Publications business, which was acquired by us in fiscal 2012 and scaled up in fiscal 2013, as well as on account of
an increase in the average cost of paper during this period.
Cost of Services
Our cost of services increased by 35.29% from ` 388.83 million in fiscal 2012 to ` 526.04 million in fiscal 2013,
379
primarily on account of a significant increase in printing cost from ` 4.56 million in fiscal 2012 to ` 37.23 million
in fiscal 2013 due to the full year impact of our acquisition of GK Publications in fiscal 2012 being recognized in
fiscal 2013, a 75.47% increase in faculty expense from ` 46.39 million in fiscal 2012 to ` 81.40 million in fiscal
2013, given the commencement of two new projects under our vocational training business as well as increase in
test prep business during fiscal 2013 on account of the opening of 16 new owned centers, where faculty payments
are managed by us, and a 15.08% increase in business partner expenses from ` 323.34 million in fiscal 2012 to `
372.10 million in fiscal 2013, on account of the opening of 22 new test prep centers operated by our business
partners as well as increased student enrolments by our business partners during fiscal 2013.
Purchases of Stock-In-Trade
Our expenses on account of purchases of stock in trade decreased by 75.16% from ` 53.01 million in fiscal 2012 to
` 13.17 million in fiscal 2013, primarily due to increase in purchase of study material from our Subsidiary, CL
Media, while until fiscal 2012, study material was purchased from third party sources and, to a lesser extent, on
account of increase in purchase of study material given to students enrolled in our test prep courses, on account of
increased enrolments in our test prep courses during fiscal 2013.
Our closing inventory increased by 77.81% from ` 35.19 million as on March 31, 2012 to ` 62.57 million as on
March 31, 2013, primarily due to a substantial increase in inventory of finished goods produced during fiscal 2013,
from ` 5.92 million in fiscal 2012 to ` 47.28 million in fiscal 2013 and a substantial increase in inventory of work in
progress, from ` 1.14 million in fiscal 2012 to ` 6.67 million in fiscal 2013, due to the full year impact of our
acquisition of GK Publications in fiscal 2012 being recognized in fiscal 2013.
Our employee benefit expenses increased by 8.69% from ` 620.72 million in fiscal 2012 to ` 674.64 million in
fiscal 2013, primarily due to a 8.93% increase in the salary, wages, bonus and other benefit component, from `
576.63 million in fiscal 2012 to ` 628.15 million in fiscal 2013, because of an increase in the number of our
employees and the average salary paid per employee per month.
Finance Costs
Our finance costs increased by 36.57% from ` 74.00 million in fiscal 2012 to ` 101.06 million in fiscal 2013,
primarily due to a 50.22% increase in interest paid on short term borrowings, from ` 43.91 million in fiscal
2012 to ` 65.96 million in fiscal 2013, as the amount of short term borrowings in the form of cash credit
increased by 42.57% during fiscal 2013.
Depreciation/Amortization Expense
Our depreciation/amortization expense increased by 21.67% from ` 46.00 million in fiscal 2012 to ` 55.97
million in fiscal 2013, primarily due to higher amortization on intellectual property rights in fiscal 2013, in
relation to intellectual property acquired by us during fiscal 2012, along with our acquisition of GK
PublicatLRQV¶SXEOLVKLQJDQGFRQWHQWGHYHORSPHQWEXVLQHVV
Other Expenses
Our other expenses increased by 30.09% from ` 469.57 million in fiscal 2012 to ` 610.87 million in fiscal 2013,
primarily on account of an increase in advances written off, from ` 1.96 million in fiscal 2012 to ` 123.22 million in
fiscal 2013. In fiscal 2013, we wrote off a provision for advances amounting to ` 112.3 million to CLEF in
fiscal 2012 as well as writing back the actual balance amounting to ` 15.49 million due in the nature of short
term loans and advances recoverable from CLEF.
We have historically funded our working capital and capital expenditure requirements principally from cash
flows from our revenue from operations, and a combination of working capital and long term debt as well as
equity and preference share capital.
380
The following table sets forth a summary of our cash flows for the periods indicated below.
(` in million)
Particulars Fiscal 2014 Fiscal 2013 Fiscal 2012
Net cash from/(used in) operating activities 98.26 59.60 (193.01)
Net cash used in investing activities (11.25) (36.44) (61.43)
Net cash from financing activities (94.03) 5.57 170.84
Cash and cash equivalents at end of period 53.81 60.81 44.04
Our net cash from operating activities aggregated to ` 98.26 million, during fiscal 2014, while our net profit
before tax and minority interest and after prior period items aggregated to ` 204.17 million. This difference was
primarily attributable to interest expense amounting to ` 84.16 million, depreciation and amortization of ` 54.69
million, and bad debts written off of ` 47.11 million, and certain working capital changes (primarily, an increase
in trade payables amounting to ` 49.01 million), with adjustments on account of interest income amounting to `
76.25 million, and certain changes in working capital (primarily, increase in trade receivables amounting to `
155.76 million, decrease in long term loans and advances amounting to ` 0.26 million, increase in other current
liabilities amounting to ` 22.52 million, increase in short term loans and advances amounting to ` 41.67 million,
and increase in inventories amounting to ` 38.06 million). As a result of the foregoing, as on March 31, 2014, we
had cash and cash equivalents aggregating to ` 53.81 million.
Our net cash generated from operating activities aggregated to ` 59.60 million, during fiscal 2013, although our
net profit before tax and minority interest and after prior period items aggregated to ` 186.97 million. This
difference was primarily attributable to advances and deposits written off amounting to ` 123.22 million, interest
expense amounting to `96.82 million, depreciation and amortization of ` 55.97 million, and bad debts written off
of ` 34.72 million, and certain working capital changes (primarily, an increase in trade payables amounting to `
24.85 million), with adjustments on account of interest income amounting to ` 64.84 million as well as liability
written back amounting to ` 33.05 million, and certain changes in working capital (primarily, increase in trade
receivables amounting to ` 110.36 million, and decrease in other current liabilities amounting to ` 39.04 million).
As a result of the foregoing, as on March 31, 2013, we had cash and cash equivalents aggregating to ` 60.81
million.
Our net cash used in operating activities aggregated to ` 193.01 million, during fiscal 2012, while our net loss
before tax and minority interest and after prior period items aggregated to ` 82.78 million. This difference was
primarily attributable to provision for doubtful advances amounting to ` 3.00 million, interest expense of ` 71.15
million, depreciation and amortization of ` 46.00 million, and bad debts written off amounting to ` 42.16 million
and certain working capital changes (primarily, an increase in trade payables amounting to ` 7.66 million), with
adjustments on account of interest income amounting to ` 78.03 million, and certain changes in working capital
(primarily, increase in trade receivables amounting to ` 160.14 million, and increase in short term loans and
advances amounting to ` 283.04 million). As a result of the foregoing, as on March 31, 2012, we had cash and
cash equivalents aggregating to ` 44.04 million.
During fiscal 2014, net cash used in investing activities aggregated to ` 11.25 million, primarily attributable to
interest received of ` 52.23 million, which was offset by, primarily, investment in subsidiaries of ` 47.91
million.
During fiscal 2013, net cash used in investing activities aggregated to ` 47.42 million, primarily on account of
interest received of ` 64.45 million, and proceeds from sale of fixed assets of ` 143.32 million, which was
offset by, primarily, loan given of ` 130.33 million, purchase of fixed assets of ` 78.98 million, and investment
in subsidiaries of ` 37.68 million.
During fiscal 2012, net cash used in investing activities aggregated to ` 50.70 million, primarily on account of
realization from deposits made of ` 134.75 million, interest received of ` 79.23 million, and proceeds of sale of
fixed assets of ` 17.74 million, which was offset by, primarily, purchase of fixed assets of ` 241.51 million,
loan availed of ` 30.84 million, and investment in subsidiaries of ` 73.13 million.
381
Cash Flow from (used in) Financing Activities
During fiscal 2014, net cash used in financing activities aggregated to ` 94.03 million, primarily on account net
proceeds from short term borrowing amounting to ` 59.12 million, and proceeds from long term borrowings of
` 35.00 million, which was offset by, primarily, interest paid of ` 84.80 million, and repayment of long term
borrowings of ` 116.96 million.
During fiscal 2013, net cash from financing activities aggregated to ` 5.57 million, primarily attributable to
proceeds from long term borrowings amounting to ` 505.84 million, and net proceeds from short term
borrowings amounting to ` 60.98 million, which was offset by, primarily, repayment of long term borrowings
of ` 582.17 million, and interest paid of ` 100.80 million.
During fiscal 2012, net cash from financing activities aggregated to ` 170.84 million, primarily attributable to
proceeds from long term borrowings amounting to ` 266.16 million, and net proceeds from short term
borrowings amounting to ` 181.14 million, which was offset by, primarily, repayment of long term borrowings
of `231.67 million, and interest paid of ` 71.04 million.
Capital Expenditure
We expect that our principal use of cash for fiscal 2015 will be for our operations and for investing in business
opportunities in our existing as well as proposed new areas of our business. We expect to meet our capital
expenditure, debt repayment and investment requirements for the next 12 months primarily from the cash
reserves already available with us.
Indebtedness
As on March 31, 2014, our net long term borrowings (including secured and unsecured long term borrowings)
aggregated to ` 235.02 million, as compared to ` 258.40 million as on March 31, 2013 and ` 329.64 million as
on March 31, 2012.
As on March 31, 2014, our net short term borrowings (including secured and unsecured short term borrowings)
aggregated to ` 340.81 million, as compared to ` 281.69 million as on March 31, 2013 and ` 220.71 million as
on March 31, 2012. These borrowings represented cash credit from banks as well as unsecured loans from
related parties, in each case, being repayable on demand.
Contingent Liabilities
As on March 31, 2014, we had the following contingent liabilities not provided for, as disclosed in the notes to
our audited restated consolidated financial statements.
x Demand for service tax aggregating ` 160.78 million for the period July 1, 2003 to September 30, 2010
is disputed by us. Penalty of ` 71.02 million has also been imposed under Section 78 of the Finance
Act, 1994. We have preferred an appeal with CESTAT against these orders of the Commissioner of
Service Tax.
x Demand for service tax aggregating ` 29.18 million for the period October 2010 to June 2012 is
disputed by us, against which we have filed an appeal before Commissioner (Appeals) of Service Tax.
x Demand for service tax aggregating ` 3.12 million for the period September 2004 to March 2008 due to
incorrect availment of service tax CENVAT credit is disputed by us. Penalty, aggregating ` 3.10
million has also been levied under Section 15 read with Rule 15 of CENVAT Credit Rules, 2004.
During the year, we received an order passed by Commissioner (Appeals) of Service tax. We have
preferred an appeal with CESTAT against the order of the Commissioner (Appeals) of Service Tax.
x Our Company had received a demand for service tax in earlier years aggregating ` 40.09 million for the
period April 2008 to March 2012 due to incorrect availment of service tax CENVAT credit. Our
Company has disputed the demand and has preferred an appeal with Commissioner (Appeals) Central
Excise and Customs.
382
x In case of one of the subsidiary named Kestone Integrated Marketing Services Private Limited, the
Assistant Commissioner of Income Tax has made some disallowances and raised a demand of ` 0.63
million (including interest) for Assessment year 2011-12. Our Company has filed an appeal against the
demand notice with Commissioner of Income Tax (Appeals).
x Our Company had been allotted a land located at Faridabad (Haryana) in an auction by Hon'ble High
Court of Jharkhand. When our Company applied for transfer of ownership in the records of Haryana
Urban Development Authority (HUDA), the transfer permission was granted with levy of extension fee
of ` 6.70 million on account of various dues not paid by the erstwhile owner. Our Company has
disputed the demand and has preferred an appeal with the Administrator, HUDA.
x Rashtriya Advertising & Prabhatam Advertising Pvt Ltd, a service provider has filed a claim against
our Company for recovery of an amount of ` 1.45 million with interest as balance of amounts due. Our
Company has disputed the demand and the case is under trial in the court of law.
x Triangle Education, a business partner of our Company in Jaipur, had arbitrarily terminated the
agreement and started a competing business using our brand. Our Company has filed a statement of
claim before the sole Arbitrator amounting ` 19.00 million against Triangle Education. Triangle
Education also filed a counter claim against our Company amounting ` 3.20 million.
x A student, Kshtiz Srivastava, has filled a case against our Company for refund of fees amounting `
0.62 million on the ground that he paid fees to Brilliant Tutorials considering the fact that our
Company has a tie-up with Brilliant Tutorials, which was subsequently called off by us.
Auditor Qualifications
The following disclosure regarding qualifications in the examination report to the restated standalone financial
statements and steps taken by our Company in view thereof has been set out below in compliance with
disclosure requirements under the Companies Act, 2013:
(i) The Company has granted interest free unsecured loans to four companies and one other party covered
in the register maintained under Section 301 of the Act. The maximum amount outstanding during the
year and the year-end balance of such loans are as follows:
(Amount in ` million)
Name of the entity Maximum amount outstanding Year-end balance
during the year
Career Launcher Education Foundation 61.25 45.76
CL Higher Educational Services Private Limited 0.12 0.12
Career Launcher Education Infrastructure and Services 2.59 0.43
Limited
Kestone Asia Hub Pte. Ltd. (formerly known as CL Asia 9.58 8.29
Educational Hub Pte. Ltd.)
Career Launcher USA Inc. (upto September 30, 2013) 38.39 Not applicable
The Company has also granted interest bearing unsecured loan to G.K. Publications Private Limited, a
company covered in the register maintained under Section 301 of the Act. The maximum amount involved
during the year was ` 25.17 million and the year-end balance of loan granted to such party was ` 20.65
million.
Our Company has granted interest-free loans to its wholly owned Subsidiaries for meeting their short term fund
requirements, and loans carrying interest at market rate to other entities as a part of funding of schools run under
our brand name. We believe that granting interest-free loans to RXU&RPSDQ\¶V wholly owned Subsidiaries is in
the interest of our shareholders, for protecting our investments. Similarly, we believe that loans to other entities
383
carrying interest at market rates are in the interest of shareholders of our Company, in view of interest income
arising in this relation. Further, the amount of interest has been considered while preparing restated financial
statements.
(i) In our opinion and according to the information and explanations given to us, the rate of interest and
other terms and conditions for loans given to CL Media Private Limited, Career Launcher Asia
Educational Hub Pte. Ltd., Career Launcher USA Inc. are prima facie, prejudicial to the interest of the
Company. The year-end balance of such loans was Nil, ` 9.36 million and ` 38.39 million respectively.
Maximum amount involved during the year on such loans was ` 47.76 million, ` 9.36 million and `
38.39 million respectively.
During the year, the Company has fully written off loan granted in earlier years to Career Launcher
Education Foundation aggregating ` 112.88 million. Accordingly, in our opinion such loan was
prejudicial to the interest of the Company.
In our opinion and according to the information and explanations given to us, the rate of interest and
other terms and conditions for loans given to other companies and parties covered in the register
maintained under section 301 of the Companies Act, are prima facie, not prejudicial to the interest of the
Company.
Our Company has granted interest-free loans to its wholly owned Subsidiaries for meeting their short term fund
requirements, and loans carrying interest at market rate to other entities as a part of funding of schools run under
our brand name. We believe that granting interest-free loans to our &RPSDQ\¶V wholly owned Subsidiaries is in
the interest of our shareholders, for protecting our investments. Similarly, we believe that loans to other entities
carrying interest at market rates are in the interest of shareholders of our Company, in view of interest income
arising in this relation. Further, the amount of interest has been considered while preparing restated financial
statements.
The loan written off was extended to CLEF towards infrastructure charges recoverable from it on account of
running the Indus World Business School from premises owned by our Company. In the initial years, due to
inability to pay such infrastructure charges, these were converted to repayable loans carrying interest at market
rates. Inability to pay due to closure of the Indus World Business School required write off of these charges by
our Company in its books, provision for which was made in full in the previous financial year.
(i) In our opinion and according to the information and explanations given to us, the rate of interest and
other terms and conditions for such loans given to CL Media Private Limited and Career Launcher Asia
Educational Hub Pte. Ltd., wholly owned subsidiaries of the Company, are prima facie, prejudicial to the
interests of the Company.
In our opinion and according to the information and explanations given to us, the rate of interest and
other terms and conditions for such loans given to parties other than above, are prima facie, not
prejudicial to the interest of the Company.
Our Company has granted interest-free loans to its wholly owned Subsidiaries for meeting their short term fund
requirements, and loans carrying interest at market rate to other entities as a part of funding of schools run under
our brand name. We believe that granting interest-free loans to RXU&RPSDQ\¶V wholly owned Subsidiaries is in
the interest of our shareholders, for protecting our investments. Similarly, we believe that loans to other entities
carrying interest at market rates are in the interest of shareholders of our Company, in view of interest income
arising in this relation. Further, the amount of interest has been considered while preparing restated financial
statements.
384
4XDOLILFDWLRQVLQUHVSHFWRIPDWWHUVVSHFLILHGLQSDUDJUDSKVDQGRI&RPSDQLHV$XGLWRUV¶5HSRUW2UGHU
DQGZKLFKIRUPSDUWRI,QGHSHQGHQW$XGLWRUV¶UHSRUWVWRWKHILQDQFLDOVWDWHPHQWVIRUWKH\HDUV¶HQGHG
March 31, 2014, 2013, 2012, 2011 and 2010, which do not require adjustments to the restated summary
financial statements are as below:
(i) During the year, the Company has fully written off accumulated interest on loan granted in earlier years
to Career Launcher Education Foundation, an entity over which key management personnel have
significant influence, aggregating ` 15.48 million. Accordingly, in our opinion such loan is prejudicial to
the interest of the Company.
In our opinion and according to the information and explanations given to us, the rate of interest,
wherever charged, and the other terms and conditions of loans granted to other parties except Career
Launcher Education Foundation are not, prima facie, prejudicial to the interest of the Company.
In view of closure of CLEF¶V operations, our interest on loans granted to CLEF has been written off. The
principal amount outstanding has been guaranteed by our Promoter, Bilakes, pursuant to a tripartite agreement
dated March 31, 2014 entered between our Company, Bilakes and CLEF.
(ii) The Company is regular in depositing with appropriate authorities undisputed statutory dues including
SURYLGHQW IXQG LQYHVWRU HGXFDWLRQ DQG SURWHFWLRQ IXQG HPSOR\HHV¶ VWDWH LQVXUDQFH DQG RWKHU PDWHULDO
statutory dues applicable to it. However, there are slight delays in depositing undisputed statutory dues
in respect of tax deducted at source and service tax.
According to the information and explanations given to us and on the basis of examination of the records
of the Company, no undisputed amount payable in respect of provident fund, investor education and
SURWHFWLRQ IXQG ZHDOWK WD[ VHUYLFH WD[ HPSOR\HHV¶ VWDWH LQVXUDQFH LQFRPH-tax and other undisputed
statutory dues were outstanding, at the year end, for a period of more than six months from the date they
became payable.
Since the last day for deposit of service tax is March 31, every year, and due to the nature of our business,
wherein significant business happens on the last day, our Company deposits service tax on March 31 on an
estimated basis. The difference is subsequently deposited before filing the return.
(i) In our opinion, the Company is not maintaining proper records of inventory. Further, in the absence of
proper records, the discrepancies, if any, between the book records and the physical verification cannot
be ascertained. However, as explained, the Company has initiated the process of implementing software
to maintain records of inventory.
Our Company has started maintaining inventory of books from fiscal 2013. A new ERP system was
implemented in the last quarter of fiscal 2013. Going forward, all records of inventory, including all inward and
outward challans and other records would be maintained through the ERP system.
(ii) In our opinion and according to the information and explanations given to us, there exists an adequate
internal control system commensurate with the size of the Company and the nature of its business with
regard to purchase of fixed assets and with regard to the sale of goods and services. During the course of
our audit, we have not observed any continuing failure to correct major weakness in internal control
system of the Company in this regard.
In our opinion, the internal control system with regard to purchase of inventory needs to be strengthened
385
to be commensurate with the size of the Company and nature of its business.
According to the information and explanations given to us, the Company has initiated the process of
rectifying such weakness in internal controls related to purchase of inventory and accordingly, we have
not observed continuing failure to correct major weakness in internal control system of the Company in
this regard.
We have enhanced controls related to inventory management. Such steps include improving the quality of
inventory records through upgradation of our ERP system. We have ensured completeness and effectiveness of
system to cover major weakness identified during previous years.
(iii) The Company is regular in depositing with appropriate authorities undisputed statutory dues including
SURYLGHQW IXQG LQYHVWRU HGXFDWLRQ DQG SURWHFWLRQ IXQG HPSOR\HHV¶ VWDWH LQVXUDQFH LQFRPH-tax and
other material statutory dues applicable to it. However, there have been delays in depositing undisputed
statutory dues in respect of service tax.
Statutory dues including sales tax, wealth tax, custom duty, cess payable under section 441 A of the
Companies Act, 1956 and excise duty are currently not applicable to the Company.
Our Company has since then deposited all its statutory dues. The delay in deposit of service tax was on account
of the introduction of reverse charge mechanism in fiscal 2013 on certain service items, and lack of clarity on
the method of compliance. We believes our Company has now put in place the necessary checks and internal
controls pertaining to this.
(i) In our opinion and according to the information and explanations given to us, there exists an adequate
internal control system commensurate with the size of the Company and nature of its business with
regard to purchase of fixed assets and with regard to sale of goods and services. During the course of
our audit, we have not observed any continuing failure to correct weakness in internal control system of
the Company.
However, internal control system with regard to purchase of inventory needs to be strengthened in order
to be commensurate with the size of the Company and the nature of its business. The Company is in the
process of rectifying such weaknesses subsequent to the reporting date.
We have focused on specific areas related to inventory to strengthen our internal control system. Such steps
include maintenance of inventory in ERP and widening our organization¶s internal audit scope to cover gaps in
the system.
(i) In our opinion and according to the information and explanations given to us, there exists an adequate
internal control system commensurate with the size of the Company and the nature of its business with
regard to purchase of fixed assets and with regard to the sale of services. There are no transactions in
respect of purchase of inventories and for sale of goods.
In our opinion internal controls relating to accounting of revenue, discount for course fees and refunds
are inadequate and requires strengthening. There has been a continuing failure to correct major
weaknesses in internal controls in accounting of discount for course fees.
386
As per industry norms, there was a general practice of increasing the MRP and giving higher discount, so as to
attract more students in certain product categories. Post fiscal 2010, we decided to stop this practice. Authority
to fix pricing and give discounts, which used to be discretionary at the center level, were significantly curtailed.
Significant parts in ERP were centralized to take care of this weakness.
(ii) Except for delays in deposit of taxes deducted at source, Service Tax, Income Tax and Professional Tax,
the Company is generally regular in depositing statutory dues payable in respect of provident fund,
HPSOR\HHV¶VWDWHLQVurance, Value added tax, Cess and other material statutory dues applicable to it with
the appropriate authorities.
Delay has mainly due to adjustment entries during the books reconciliation process at the end of the financial
year.
(iii) There were no undisputed amounts payable in respect of Taxes deducted at source, Income Tax, Service
Tax, Provident Fund, Value added Tax, Professional Tax and other material statutory dues in arrears as
at 31st March 2010 for a period more than six months from the date they became payable.
The company has not paid service tax aggregating ` 0.066 million on royalty payments made to a foreign
party in respect of intellectual property service.
The abovementioned amount of service tax on royalty payment to a foreign party in respect of intellectual
property service was delayed since there was a dispute on the amount due, which has since been resolved.
We do not have any off balance sheet arrangements, derivative instruments or other relationships with any
entities that would have been established for the purpose of facilitating off balance sheet arrangements.
We are exposed to various types of market risks, in the ordinary course of our business. Market risk is the risk
that the fair value of future cash flows of a financial instrument will fluctuate because of changes in market
prices. The financial instruments that are affected by such market risk include loans and borrowing, deposits,
available-for-sale investments and derivative financial instruments.
Commodity price risk is the possibility of impact from changes in the prices of raw materials, such as paper.
While we seek to pass on commodity price increases to students enrolled in our test prep courses, vocational
training courses and in the Indus World Schools, as well as to our corporate customers, we may not be able to
achieve this at all times or to the fullest extent.
We are subject to interest rate risk due to fluctuations in interest rates, primarily in relation to our debt
obligations with floating interest rates.
As on March 31, 2014, all our bank loans at the consolidated level carried floating interest rates.
Further, as on March 31, 2014, 2013 and 2012, our interest expense aggregated to ` 84.05 million, ` 96.82
million, and ` 71.15 million, respectively, on a consolidated basis.
387
Credit risk
We are subject to the risk that our counterparties under various agreements and in various transactions will not
meet their obligations towards us. Our credit risk exposure relates to our operating activities and our financing
activities.
As on March 31, 2014, 2013 and 2012, our bad debts written off amounted to ` 47.11 million, ` 34.72 million
and ` 42.16 million, respectively, on a consolidated basis, and our advances written off amounted to ` 60.70
million as on March, 31, 2012. Further, as on March 31, 2014, 2013 and 2012, our provision for doubtful
advances amounted to ` 0.85 million, ` 3.08 million and ` 3.00 million on a consolidated basis.
To the best of our knowledge on due inquiry, there have been no other events or transactions that may be
GHVFULEHGDV³XQXVXDO´RU³LQIUHTXHQW´GXULQJWKHODVWWKUHHIiscals, except as disclosed in this Draft Red Herring
Prospectus.
To the best of our knowledge on due inquiry, there have been no significant economic or regulatory changes that
may have a material adverse effect on our results of operations and financial condition, except as described in
³Risk Factors´DQG³Regulations and Policies in India´RQSDJHV11 and 136, respectively.
To the best of our knowledge on due inquiry, there are no significant factors that may have a material adverse
HIIHFW RQ WKH UHODWLRQVKLS EHWZHHQ RXU FRVWV DQG LQFRPH H[FHSW DV GHVFULEHG LQ WKLV VHFWLRQ DQG XQGHU ³Risk
Factors´DQG³Our Business´RQSDJHV11 and 117, respectively.
To the best of our knowledge on due inquiry, there are no significant trends or uncertainties that have or had or
are expected to have a material adverse impact on our results of operations or financial condition, except as
describeGXQGHU³Risk Factors´DQG³Our Business´RQSDJHV11 and 117, respectively,
Cyclicality of business
Our test prep as well as publication and content development businesses are closely linked to the academic cycle
and the timing of competitive entrance examinations for admission to various professional institutions. For
instance, the CAT for entrance to IIMs is typically held during October and November of each year, the CLAT
is typically held in the month of May of each year, and the GATE is generally conducted in February every
year. As a result of such factors, our quarter-on-quarter data regarding enrolments and cash flows may not be
comparable or provide a meaningful indicator of our enrolments and revenues for any other or future fiscal
quarters or periods.
We have, in the ordinary course of our business, entered into transactions with certain related parties. While, in
our view, all such related party transactions that we have entered into are legitimate business transactions
FRQGXFWHGRQDQDUPV¶OHQJWKEDVLVZHFDQQRWDVVXUH\RXWKDWZHFRXOGQRWKDYHDFKLHYHGPRUHIDYRUDEOHWHUPV
had such arrangements not been entered into with related parties. Further, we cannot assure you that these or any
future related party transactions that we may enter into, individually or in the aggregate, will not have an
adverse effect on our financial condition and results of operations.
Our test prep operations and revenues are primarily concentrated in north India (Delhi, Haryana, Himachal
Pradesh, Jammu & Kashmir, Punjab, Rajasthan, Union Territory of Chandigarh, Uttar Pradesh and
Uttarakhand), where we had 91 test prep centers as of March 31, 2014 and an aggregate of 35,208 students
388
enrolled, representing 55.49% and 52.12% of our total test prep centers and enrolled students, respectively.
Further, we are significantly dependent on one of our business partners, for the operation of three test prep
centers in Kolkata, where we had an aggregate of 3,913 enrolments as of March 31 2014. Our significant
concentration in these regions exposes us to any adverse developments in these regions, due to local political,
administrative, infrastructural or other factors, whose effective resolution may require investment of significant
financial, management or other resources on our part, as well as increased competition from local or national
test prep course providers in these regions.
While our strategic objectives include geographical expansion as well as increasing our penetration across India,
in the event of a significant drop in enrolments from the Delhi NCR or Kolkata regions or any factors requiring
us or our business partners to close down existing centers or otherwise scale down operations in these regions,
or the emergence of a strong pan-India education company (or an aggregation of several strong regional
players) competing in the areas in which we operate, our business and prospects may be adversely affected.
In the opinion of our Board, except as disclosed in this section and elsewhere in this Draft Red Herring Prospectus,
no circumstances have arisen since March 31, 2014, which materially and adversely affect or are likely to affect the
trading price of the Equity Shares, or our profitability, or the value of our assets, or our ability to pay our liabilities
within the next 12 months.
389
FINANCIAL INDEBTEDNESS
Set forth below is a brief summary of all borrowings of our Company amounting, in aggregate, to ` 286.17
million, as on August 31, 2014, along with certain significant terms of such financing arrangements.
Set forth below is a summary of our secured borrowings as on August 31, 2014.
390
Lender Description Amount Interest Repayment/Tenor Security
outstanding
as on
August 31,
` in
2014 (`
million)
of entry for
mortgage by
constructive
delivery of
title deed
dated July 2,
2014.
There has not been any re-scheduling, prepayment, penalty or default by our Company in respect of the term
loan detailed above, until the date of this Draft Red Herring Prospectus.
Our secured financing arrangement contains various restrictive covenants, including, among others, cross
default, cross acceleration, a right entitling the lender, to cancel the sanctioned facilities or amend or rescind any
terms of the facilities with prior notice to our Company but without assigning any reasons and cancel or modify
any unutilized limits under the facilities, without assigning any reason and without prior notice to our Company.
Under our secured financing arrangement, the lender also has a right to appoint one nominee director on the
Board of Directors.
Further, under the secured financing arrangement, our Company would require WKHOHQGHU¶VSULRUZULWWHQFRQVHQW
for the following actions:
i. FKDQJHRUDOWHURXU&RPSDQ\¶VFDSLWDOVWUXFWXUH
ii. effect any change in the shareholding of the directors at present, promoters and shareholders (including
by issue of new shares or transfer of shares) of our Company during the currency of the facilities or in
our management;
iii. effect any change in shareholding/directorship/ownership in our Company;
iv. make alterations to the memorandum and articles of association of our Company;
v. effect any scheme of amalgamation or reconstitution;
vi. HQWHU LQWR DQ\ FRPSURPLVH ZLWK DQ\ RI RXU &RPSDQ\¶V VKDUHKROGHUV RU FUHGLWRUV RU HQWHU LQWR RWKHU
arrangements, mergers, amalgamations, consolidations, structuring, restructuring, sip offs, hive offs;
vii. implement a new scheme of expansion or take up an allied line of business or manufacture;
viii. withdraw or allow withdrawal of any monies brought in by the promoters and directors or relatives and
friends of the promoters or directors of our Company;
ix. FKDQJHRXU&RPSDQ\¶VQDPHRUWUDGHQDPH
x. FKDQJHRXU&RPSDQ\¶VDFFRXQWLQJVWDQGDUGVDVZHOODVDFFRXQWLQJ\HDU
xi. GLVSRVHRIRXU&RPSDQ\¶VDVVHWVRUFRPSURPLVHZLWKDQ\RIRXU&RPSDQ\¶VFUHGLWRUV
xii. deal with other baQNV LQ UHODWLRQ WR RXU &RPSDQ\¶V PHUFKDQW EDQNLQJ WUDQVDFWLRQV IRUHLJQ H[FKDQJH
business, inland bill business and deposits;
xiii. withdraw deposits lying with the lender or lease or sell or exchange or create any mortgage, charge, lien
or encumbrance of any kind over our undertaking or assets (including uncalled share capital or any part
thereof) except to the lender nor suffer any such mortgage, charge, lien or encumbrance to affect the
same or any part thereof nor do or allow anything to be done that may prejudice the security until this
facility and dues remain outstanding;
xiv. guarantee or pay or provide any collateral for obligations of others;
xv. borrow money from any other bank or other sources apart from temporary loans obtained in the ordinary
course of business and so conveyed to the lender, while our Company continues to be indebted to the
lender under the aforementioned secured financing arrangement; and
xvi. iQYHVWDQ\RIRXU&RPSDQ\¶VIXQGVLQWKHVKDUHVGHEHQWXUHVGHSRVLWVRURWKHULnvestments of any other
company.
)XUWKHU XQGHU RXU &RPSDQ\¶V VHFXUHG ILQDQFLQJ DUUDQJHPHQWV ZH DUH UHTXLUHG WR give notice to the lender as
soon as any call in respect of our share capital or issuance of share capital or creation of new shares has been
resolved upon. Until the expiry of seven days from such notice, our Company cannot issue any notice to our
members. If the lender so requires, every notice/ prospectus/ application form/ allotment letter sent out by our
391
Company shall direct our members/ applicants for allotment of shares to pay the money to the lender or as it shall
VRGLUHFW,QFDVHRIQRVXFKGLUHFWLRQWKHPRQH\VKDOOEHSDLGLQWRWKHOHQGHU¶VRIILFHWRWKHMRLQWDFFRXQWRIRXU
Company and the lender or in any such manner that the lender may direct. The lender shall be entitled to require
all such money received to be applied wholly or partly in or towards the satisfaction of the principal plus interest
DQGRWKHUPRQH\VGXHWRWKHOHQGHU2XU&RPSDQ\PD\DSSO\WKHEDODQFHIURPWKHSD\PHQWRIOHQGHU¶VGXHVWR
oXUJHQHUDOSXUSRVHVZLWKRXWWKHOHQGHU¶VFRQVHQWLIWKHOHQGHUGRHVQRWUHTXLUHWKHDSSOLFDWLRQRIPRQH\VZLWKLQ
a month of its payment.
Our Company does not have any unsecured borrowings as on the date of the Draft Red Herring Prospectus.
392
SECTION VI ± LEGAL AND OTHER INFORMATION
OUTSTANDING LITIGATION AND MATERIAL DEVELOPMENTS
Except as described below DQG RWKHU WKDQ DV GLVFORVHG LQ WKH VHFWLRQ ³Financial Statements´ RQ SDJH 167,
there are no outstanding litigation, suits or criminal or civil proceedings or tax liabilities against us, our
Promoters, Directors, Subsidiaries or Group Entities, whose outcome would have a material adverse effect on
our business and there are no defaults, non-payment or overdues of statutory dues, institutional or bank dues or
dues payable to holders of any debentures, bonds and fixed deposits, that would have a material adverse effect
on our business, other than unclaimed liabilities against us and our Directors as of the date of this Draft Red
Herring Prospectus. Further, except as described below, there are no inquiries, inspections or investigations,
initiated or conducted against our Company or our Subsidiaries under the Companies Act, 2013 or any previous
companies law, or any fines imposed or compounding of offences or any litigation or legal action pending or
taken by any Ministry or Department of the Government or a statutory authority against our Promoters, in the
five years preceding the date of this Draft Red Herring Prospectus. Further, there have been no material
frauds committed against our Company in the five years preceding the date of this Draft Red Herring
Prospectus.
Except as described below, there are no proceedings initiated for economic or civil offences or any disciplinary
action taken by SEBI or any stock exchange, penalties imposed by any authorities against our Company and
Directors and no adverse findings in respect of our Company as regards compliance with securities laws.
Further, except as described below, there are no instances where our Company or Directors have been found
guilty in suits or criminal or civil prosecutions, or proceedings initiated for economic or civil offences or any
disciplinary action by SEBI or any stock exchange, or tax liabilities.
Income Tax
There are 12 income tax proceedings against our Company involving an aggregate amount of ` 852.23 million,
details of which are provided below:
7KH $GGLWLRQDO &RPPLVVLRQHU RI ,QFRPH 7D[ ³Ad. CIT), Range - 3, New Delhi through assessment order
dated December 24, 2008 for assessment year 2006-07, disallowed certain deductions claimed by our Company,
including payment made to business partners, non-refundable portion of the advance fee received from the
students and bonus paid to directors and initiated penalty proceedings. Consequently, by a demand notice dated
December 24, 2008, the ACIT issued a demand of `106,369,435 as total tax payable by our Company. Our
Company filed an appeal (No. 217/08-09) before the CIT(A) - VI, New Delhi.
The CIT(A), by common order dated November 16, 2009, partly allowed the appeals (No. 56/07-08 and No.
217/08-09). Our Company filed two appeals (No. 4924(Del)/2009 and No. 4925(Del)/2009) and the ACIT,
Circle 3(1), New Delhi filed two cross appeals (No. 523(Del)/2010 and No. 524(Del)/2010), before the Income
7D[$SSHOODWH7ULEXQDO³ITAT´'HOKL%HQFKµ%¶'HOKL7KH,7$7 by an order dated December 27, 2010,
SDUWO\ DOORZHG RXU &RPSDQ\¶V DSSHDOV 1R 'HO DQG 1R 'HO SDUWO\ DOORZHG WKH
$&,7¶VDSSHDO1R'HOIRUDVVHVVPHQW\HDU-06 and dismissed the appeal (No. 524(Del)/2010)
of the ACIT for assessment year 2006-07.
7KH&RPPLVVLRQHURI,QFRPH7D[³CIT´ filed two appeals before the High Court of Delhi (ITA No. 911/2011
and ITA No. 926/2011). The High Court of Delhi by a common order dated April 19, 2012 partly upheld the
393
order of the ITAT in relation to appeal (ITA No. 911/2011) and dismissed the appeal (ITA No. 926/2011). The
&,7KDVILOHGWZRVSHFLDOOHDYHSHWLWLRQV³SLPs´1RDQG1RDJDLQVWWKHRUGHUVRIWKH
ITAT.
The DCIT also issued a show cause notice dated December 24, 2009, for showing cause as to why a penalty
should not be imposed, for assessment year 2007-08.
The ACIT, through assessment order dated December 16, 2010 for assessment year 2008-09, disallowed certain
deductions claimed by our Company, including payment made to business partners, non-refundable portion of
the advance fee received from the students, advertisement, publicity and sales promotion expenses and bonus
paid to directors. Consequently, by a demand notice dated December 16, 2010 the ACIT issued a demand of `
174,051,122 as total tax payable by our Company. Our Company filed an appeal (No. 136/10-11) before the
CIT(A) - VI, Delhi. The CIT(A) by an order dated June 13, 2011 allowed the appeal of our Company. The
'&,7&LUFOH1HZ'HOKLILOHGDQDSSHDO1R,7$1R'HOEHIRUHWKH,7$7'HOKL%HQFKµ%¶
New Delhi.
The ACIT, Circle 3(1), New Delhi through assessment order dated December 29, 2011 for assessment year
2009-10, disallowed deductions claimed by our Company for non-refundable portion of the advance fee
received from the students, depreciation on computer accessories and advertisement and publicity and sales
promotion expenses and initiated penalty proceedings. Consequently, by a demand notice dated December 29,
2011, the ACIT issued a demand of ` 109,517,828 as total tax payable by our Company. Our Company filed an
appeal (No. 231/11-12) before the CIT(A) - VI, Delhi. The CIT(A) by an order dated July 27, 2012 allowed the
appeal of our Company. The DCIT, Circle 3(1), New Delhi filed an appeal (No. ITA No. 5125/Del/2012) before
WKH,7$7'HOKL%HQFKµ%¶1HZ'HOKL
The ITAT, by common order dated May 31, 2013, partly upheld the order of the CIT(A) in relation to the appeal
(ITA No. 3657/Del/2011) and dismissed the appeals (No. ITA No. 3941/Del/2011) and (No. ITA No.
5125/Del/2012) of the DCIT.
The DCIT, Circle 3(1), New Delhi through assessment order dated March 8, 2013 for assessment year 2010-11,
disallowed deductions claimed by our Company for non-refundable portion of the advance fee received from the
students and advertisement and publicity and sales promotion expenses. Consequently, by a demand notice
dated March 8, 2013, the DCIT issued a demand of ` 94,910,495 as total tax payable by our Company. Our
Company filed an appeal (No. 24/13-14) before the CIT(A) - VI, Delhi. The CIT(A) by an order dated February
14, 2014 partly allowed the appeal of our Company. Our Company filed an appeal dated March 3, 2014 before
the ITAT, Delhi.
The DCIT also issued a show cause notice dated March 8, 2013, to our Company, for showing cause as to why a
penalty should not be imposed.
The DCIT, Circle 3(1), New Delhi through assessment order dated March 19, 2014 for assessment year 2011-
12, disallowed deductions claimed by our Company for non-refundable portion of the advance fee received from
the students and advertisement and publicity and sales promotion expenses. Consequently, by a demand notice
394
dated March 19, 2014, the DCIT issued a demand of ` 87,668,910 as total tax payable by our Company. Our
Company filed an appeal before the CIT(A) - VI, Delhi.
7D['HGXFWLRQDW6RXUFH³TDS´
The Ad. CIT, Range ± 49, New Delhi through assessment order dated March 31, 2011, for assessment years
2003-04, 2004-05, 2005-06 and 2006-07, declared our Company to be in default, on account of not having
deducted TDS on payments made to business partners and teachers on retainership and on service tax in relation
to payments made towards advertisement charges, courier charges and professional charges. Consequently, by a
demand notice dated March 31, 2011, the ACIT issued a demand of ` 35,557,912 as total TDS by our
Company. Our Company filed an appeal (No. 2063/2011-12) before the CIT(A) ± XXX, New Delhi. The
CIT(A) by an order July 31, 2013 allowed the appeal of our Company.
The Ad. CIT also issued a show cause notice (F.No.Addl.CIT/R-49/Penalty/271 C/2009-10/) dated March 31,
2013, requiring our Company to show cause as to why penalty should not be levied on our Company for not
deducting tax aggregating to ` 20,174,224 at source and for not disclosing it in the TDS returns filed for
financial years 2002-03 to 2005-06.
The Ad. CIT, Range ± 49, New Delhi through assessment order dated March 31, 2011, for assessment years
2007-08, 2008-09 and 2009-10, declared our Company to be in default, on account of, among other things, not
having deducted TDS on payment made to business partners and teachers on retainership as well as
discrepancies in the filing of returns for assessment years 2008-09 and 2009-10. Consequently, by a demand
notice dated March 31, 2011, the Ad. CIT issued a demand of ` 27,330,519 as total TDS by our Company. Our
Company filed an appeal (No. 2064/2011-12) before the CIT(A) ± XXX, New Delhi. The CIT(A) by an order
dated August 6, 2013 allowed the appeal of our Company.
The Ad. CIT, Range ± 49, New Delhi also issued a show cause notice (F.No.Addl.CIT/R-49/Penalty/271
C/2009-10/) dated March 31, 2011, requiring our Company to show cause as to why penalty should not be
levied on our Company for not deducting tax aggregating to ` 18,964,174 at source and for not disclosing it in
the TDS returns filed for assessment years 2007-08 to 2009-10. The Ad. CIT, Range ± 49, New Delhi issued a
notice (F.No.Addl.CIT/R-49/Penalty/272(A)(2)(k)/2010-11/) dated March 31, 2011, requiring our Company to
show cause as to why penalty proceedings should not be initiated for late filing of TDS returns. The Ad. CIT by
order dated September 29, 2011 imposed a penalty for late filing. The Ad. CIT by a demand notice dated
September 29, 2011 issued a demand of ` 647,300 as penalty payable by our Company for the late filing.
The ACIT, Circle ± 49(1), New Delhi through assessment order dated March 30, 2012, for assessment year
2010-11, declared our Company to be in default, on account of TDS deduction being made on payments to
business partners under the incorrect statutory provision and non-deduction of TDS on payment made to
teachers on retainership and directed that penalty proceedings be initiated. Consequently, by a demand notice
dated March 30, 2012, the ACIT issued a demand of ` 38,064,894 as total TDS payable by our Company. Our
Company filed an appeal (No. 1138/2012-13) before the CIT(A) ± XXX, New Delhi. The CIT(A) by an order
dated August 8, 2013 allowed the appeal of our Company.
The DCIT, Circle ± 49(1), New Delhi through assessment order dated March 28, 2014, for assessment year
2011-12, declared our Company to be in default, on account of TDS deduction being made on payments to
business partners under the incorrect statutory provision and non-deduction of TDS on payment made to
teachers on retainership and directed that penalty proceedings be initiated. Consequently, by a demand notice
dated March 28, 2014, the DCIT issued a demand of ` 15,156,790 as total TDS payable by our Company. Our
Company has filed an appeal dated April 24, 2014 before the CIT(A) ± XXX, New Delhi.
Service Tax
395
There are six service tax proceedings against our Company involving an aggregate amount of ` 276.54, details
of which are provided below:
1. The &RPPLVVLRQHURI6HUYLFH7D[1HZ'HOKL³CST´ issued demand show cause notices (C. No. DL-
II/ST/R-16/IAR/CL/128/07/12486 and C. No.DL-II/ST/R-16/IAR/128/07/1194) dated September 5, 2008
and February 6, 2009 requiring our Company to show cause as to why service tax amounting to `
63,947,644 and ` 14,973,187, for the periods from July 1, 2003 until March 31, 2008 and from April 1,
2008 until September 30, 2008, respectively, should not be levied in relation to non-payment of service
tax for the study material being provided by our Company. Further, our Company was required to show
cause as to why interest and penalty for non-payment of service tax, non-filing of service tax returns and
suppression of facts for evasion of tax should not be imposed on our Company.
Our Company filed replies to these demand show cause notices on January 13, 2009 and April 15, 2009,
respectively. The CST, by an order-in-original (No. 11-12/JM/2009) dated September 1, 2009, confirmed
an aggregate demand of ` 71,006,706, with interest for delayed payment. Further, the CST imposed
penalties of ` 1,000 for failure to furnish service tax return and ` 71,006,706 for suppression of facts with
the intention of evasion of service tax. Our Company filed an appeal before the Customs, Excise and
6HUYLFH 7D[ $SSHOODWH 7ULEXQDO 1HZ 'HOKL ³CESTAT´ The CESTAT, by an order dated July 26,
2011, granted stay with the condition that 30% of the amount of service tax confirmed will have to be
deposited with the CESTAT.
2. The CST issued demand show cause notices (C. No. DL-II/ST/R-16/IAR/128/07/2659, C. No. DL-
II/ST/R-16/IAR/128/07/364 and C. No. DL-II/ST/IAR/R-16/CL/128/07/734) dated October 26, 2009,
April 15, 2010 and April 7, 2011, requiring our Company to show cause as to why service tax amounting
to ` 7,932,185, ` 11,797,636 and ` 79,562,595 for the periods from October 1, 2008 until March 31,
2009, from April 1, 2009 until September 30, 2009 and from October 1, 2009 until September 30, 2010,
respectively, should not be levied in relation to non-payment of service tax for the study material being
provided by our Company. Further, our Company was required to show cause as to why interest and
penalty for non-payment of service tax, non-filing of service tax returns and suppression of facts for
evasion of tax should not be imposed on our Company. Pursuant to a corrigendum dated March 18, 2011
the service tax demand amount for the period from April 1, 2009 to September 30, 2009 was revised to `
11,819,639.
Our Company filed replies to these demand show cause notices on December 17, 2009, July 8, 2010 and
August 10, 2011, respectively. The CST, by an order dated November 6, 2012 confirmed a demand of `
7,367,108, ` 10,659,276 and ` 71,751,745 for the periods from October 1, 2008 until March 31, 2009,
from April 1, 2009 until September 30, 2009 and from October 1, 2009 until September 30, 2010,
respectively, with interest, penalty of ` 200 per day or 2% of tax payable per month, whichever higher,
until the service tax is paid and penalty of ` 5,000 for each of such periods. Our Company filed an appeal
(No. 57880/2013) before the CESTAT along with an application dated February 15, 2013 for stay of the
demand of service tax amounting to ` 89,778,129. We have been intimated by our Counsel that the
CESTAT has granted stay on the demand.
3. The CST issued a demand show cause notice (No. 374/DL-II/2012) and show cause notice (C. No. DL-
II/ST/R-16/IAR/CL/128/07/2253) dated April 2, 2012 for the period from October 1, 2010 until
September 30, 2011, requiring our Company to show cause as to why service tax amounting to `
16,635,768 should not be levied in relation to the non ± payment of service tax for study material being
provided by our Company. Further, our Company was required to show cause as to why interest and
penalty for non-payment of service tax, non-filing of service tax returns and suppression of facts for
evasion of tax should not be imposed on our Company. Our Company filed a reply to the demand cum
show cause notice on January 10, 2013.
4. The CST issued a demand show cause notice (No. 739/DL-II/2013) and show cause notice (C. No. DL-
II/ST/R-16/IAR/CL/128/07/23) dated April 16, 2013 for the period from October 1, 2011 until June 30,
2012, requiring our Company to show cause as to why service tax amounting to ` 12,553,238 should not
be levied in relation to the non-payment of service tax for study material being provided by our
Company. Further, our Company was required to show cause as to why interest and penalty for non-
payment of service tax, non-filing of service tax returns and suppression of facts for evasion of tax should
396
not be imposed on our Company. Our Company filed a reply to the demand cum show cause notice on
May 8, 2013.
5. The Joint Commissioner, Service Tax, New Delhi, issued a show cause notice (C. No. I-
26(494)ST/Adt/G-IV/AMR No. 34/2008/1506) dated January 22, 2009, requiring our Company to show
cause as to why service tax amounting to ` 1,548,826, along with applicable interest, should not be
demanded for incorrect utilization of CENVAT credit in excess of 20% of the duty liability for the period
2004-05 to 2006-07, alleging that our Company was not maintaining separate accounts for the common
inputs used in providing commercial training and coaching service, which was a taxable service and
providing space of for publicity in its magazine, which was a non-taxable service, during such period.
Further, our Company was required to show cause as to why interest and penalty for non-payment of
service tax, non-filing of service tax returns and suppression of facts, should not be imposed. Our
Company filed a reply to the show cause notice dated March 12, 2009. The Additional Commissioner, of
Central Excise, Delhi-IV, by an order-in-original dated December 14, 2009 confirmed the demand, with
interest for the period of delay and levied penalty of ` 5,000 for non-filing of service tax returns and `
3,100,000 for suppression of facts with the intent of evading service tax payment. Our Company filed an
appeal (No. 136/S.Tax/Appeal/DII/2010) before the Commissioner (Appeals) Central Excise Gurgaon
against the order-in-original dated December 14, 2009, who by order-in-appeal dated March 24, 2011,
rejected the appeal. Our Company filed an appeal before the CESTAT and a stay application for waiver
of pre-deposit of CENVAT credit with interest and penalty.
6. The CST, issued a demand cum show cause notice (No. I-26(494)ST/AMR/Group B-10/285/2012/20935)
dated April 18, 2013, requiring our Company to show cause as to why service tax amounting to `
40,097,178 should not be levied on our Company for incorrect utilization of CENVAT credit in excess of
20% of the duty liability for the period 2007-08 to 2011-12, alleging that our Company was not
maintaining separate accounts for the common inputs used for providing commercial training and
coaching service, which was a taxable service and was claiming exemption for provision of study
material as a non-taxable service, during such period. Further, our Company was required to show cause
as to why interest on service tax and penalty for non-payment of service tax and suppression of facts
should not be imposed on our Company. Our Company filed a reply with the CST, seeking that the
proceedings under the show cause notice be dropped. The demand is subject to the outcome of the appeal
filed by our Company before the CESTAT, against the order-in-original (No. 11-12/JM/2009) dated
September 1, 2009 issued by the CST.
Civil Proceedings
There are three civil proceedings against our Company involving an aggregate amount of ` 1.57 million, details
of which are provided below:
1. Dinesh Gupta and Prabhatam Advertising Private Limited have filed a civil suit (No. 137 of 2011) before
the Court of District Judge, Tis Hazari, New Delhi against our Company and our Promoter and Director,
Nikhil Mahajan, for recovery of ` 1,456,079, with interest, on account of non-payment of balance fee
due towards advertisement and publication services provided.
2. Nitin Gupta has filed a civil miscellaneous petition (Civil Misc. (Main) No. 1071 of 2011) dated August
24, 2011, before the High Court of Delhi against our Company, a former director of our Company and
S.K. Vashishta, the sole arbitrator in the arbitration claims (No. 01/2009) and (No. 01/2010), challenging
the arbitration award dated April 15, 2010, dismissing his claim (No. 01/2009). Nitin Gupta has further
filed a petition (CS 11/2011) dated January 10, 2011, before the Court of District Judge, Tis Hazari,
Delhi against our Company, a former director of our Company, and S.K. Vashishta for setting aside the
ex-parte award dated September 10, 2010 in the claim (No. 1/2010) filed by our Company.
Nitin Gupta had instituted a claim (No. 01/2009) against our Company and a former director, in relation
to a dispute over outstanding dues on termination of the retainership agreement dated June 1, 2007,
entered into between our Company and Nitin Gupta appointing him as faculty. The arbitrator by an
award dated April 15, 2010 dismissed his claim in default. Thereafter, Nitin Gupta filed a petition (CS
No. 12/2011) before the Court of the District Judge, North Tis Hazari, Delhi, against the order dated
April 15, 2010. The Court of the District Judge, North Tis Hazari, Delhi by its order dated April 25,
2011, dismissed his claim. Our Company filed a claim (No. 01/2010) before the arbitrator, against Nitin
397
Gupta, on account of non-payment of outstanding dues on the termination of his retainership agreement.
By an award dated September 10, 2010, the arbitrator directed Nitin Gupta to pay an amount of `
108,000, with interest.
Our Company has filed an execution petition dated June 9, 2011 before the Court of District Judge, Tis
Hazari for execution of the award dated September 10, 2010.
3. The Civil Judge, Nuh, Haryana, had issued a judgment in August 2011, declaring title in favor of Krishan
Avatar over a certain property situated at village Gajarpur, district Mewat, Haryana, which had been
purchased by CLEIS in November 2006 and subsequently sold by CLEIS to a certain Saurabh Sood.
CLEIS and Saurabh Sood, neither of whom were impleaded in this matter, have challenged this judgment
before the District Judge, Mewat Nuh, Haryana.
Consumer Complaints
1. Our Company has filed an appeal (F.A. No. 818/2013) dated July 25, 2013 before the State Consumer
Disputes Redressal Commission, Delhi against Mukesh Kumar and Brilliant Tutorials Private Limited
³Brilliant Tutorials´ FKDOOHQJLQJ WKH RUGHU GDWHG-XQH RI WKH &RQVXPHU 'LVSXWHV 5HGUHVVDO
Forum ± II, New Delhi in relation to dispute over deficiency in services provided by Brilliant Tutorials.
Mukesh Kumar had filed a complaint (No. 36/2013) before the District Consumer Disputes Redressal
Forum, Mehrauli, Delhi against Brilliant Tutorials and our Company, for refund of his FKLOG¶V tuition fees
for the period from June 2011 to April 2013 of ` 104,152, with interest and compensation of ` 200,000
for the harassment caused to him, on account of discontinuation of classes by Brilliant Tutorials at its
Noida center from August 2011. The Consumer Disputes Redressal Forum ± II, New Delhi by order
dated June 3, 2013 directed our Company and Brilliant Tutorials to refund ` 104,152 with interest and
pay ` 25,000, on account of damages and litigation expenses. Our Company was impleaded as a party to
this matter, on account of a communication dated November 18, 2011 to Mukesh Kumar, informing him
of a tie-up between our Company and Brilliant Tutorials, pursuant to which classes would be resumed.
Our Company has also filed an application dated July 25, 2013 before the State Consumer Disputes
Redressal Commission, Delhi seeking ex-parte stay of the order dated June 3, 2013 until the disposal of
the appeal. The State Consumer Disputes Redressal Commission, Delhi has by an order dated August 6,
2013, granted stay of the operation of the order pending the appeal.
Criminal Cases
There are three criminal cases initiated by our Company involving an aggregate amount of ` 1.28 million,
details of which are provided below:
1. Our Company filed a criminal complaint against Arvind Srivastava, director of Vision Success Educate
Private Limited before the Court of the Metropolitan Magistrate, Tis Hazari Courts, Delhi for criminal
defamation.
2. Our Company has filed two complaints (CC No. 583/1/2014) and (CC No. 584/1/2014) before the Court
of Additional Chief Metropolitan Magistrate, Saket Courts, New Delhi against Vision College of
Engineering & Technology, Srinagar and its director G.N. Var, under section 138 of the Negotiable
,QVWUXPHQWV$FW³N.I. Act´ alleging dishonor of four checks amounting to ` 1,100,000, received
on account of test preparation and training services provided.
3. Our Company has filed a complaint (CC No. 573/1/2013) before the Court of the Chief Metropolitan
Magistrate, West District, Tis Hazari Courts, Delhi against Mosaic Global and its sole proprietor Harish
Kumar Arora, under section 138 of the N.I. Act alleging dishonor of a check amounting to ` 181,181,
received on account of development and customization of a test prep center and provision of pre-
commencement training by our Company.
Contempt Proceedings
398
1. Our Company has filed a contempt petition (CCPO/68/2013) dated July 5, 2013 before the High Court of
'HOKL DJDLQVW 7ULDQJOH (GXFDWLRQ 6HUYLFH &HQWHU 3ULYDWH /LPLWHG ³TESC´ LWV GLUHFWRUV 3UDVKDQW -DLQ
and Pranav Mishra and Team CLAT Possible, on account of alleged breach of interim orders of the High
Court of Delhi dated March 20, 2013 and April 4, 2013 in a suit (O.M.P. No. 292/2013), restraining
7(6& LWV GLUHFWRUV DQG 7HDP &/$7 3RVVLEOH IURP XVLQJ WKH QDPH ³/67 -DLSXU 7HDP([-LST Jaipur
7HDP´ LQ UHODWLRQ WR WKHLU WHDFKLQJ IDFXOW\ 7KH +LJK &RXUW RI 'HOKL by its order dated November 27,
2013 disposed of suit (O.M.P. No. 292/2013) and directed the interim order dated March 20, 2013 to
continue until the disposal of the claim (No. 01/2013) filed by our Company before the arbitrator Divya
Darshan Sharma, against TESC and its directors Prashant Jain and Pranav Mishra.
Our Company has also filed a claim (No. 01/2013) before the arbitrator Divya Darshan Sharma, against
TESC and its directors Prashant Jain and Pranav Mishra, in relation to dispute over conduct of services
under the services agreement dated February 24, 2011 entered into between our Company and TESC for
operating a test prep center. Our Company has alleged, among other things, that TESC arbitrarily
terminated the services agreement and started a similar and competing business under the brand CLAT
Possible and illegally used the brand name, data, trademark and goodwill of our Company. Our Company
has claimed ` 19,000,000, including arbitration costs, with interest, direction to TESC to allow the
administrator appointed by our Company to take charge of the test prep center until the completion of
current batches, order restraining TESC and others from carrying out a similar and competitive business
under the brand CLAT Possible or any other brand name, during the term of the services agreement and
DQ RUGHU UHVWUDLQLQJ 7(6& DQG RWKHUV IURP XVLQJ RXU &RPSDQ\¶V GDWD LQIRUPDWLRQ WUDGHPDUN WUDGH
name or goodwill. Our Company has filed an interim application (Misc. App. No. 01 of 2013) dated May
20, 2013 seeking an ex-parte ad-interim injunction on the same grounds as the arbitration claim
(01/2013) until the final disposal of the claim. TESC and its directors, Prashant Jain and Pranav Mishra
have filed a reply to the claim and counter claim dated July 17, 2013 claiming ` 3,205,961, including
litigation costs, on account of, loss incurred due to payment of initial fee to the new business partners,
excess money spent on advertisement for the period March 2013 to June 2013 and hosting of seminars.
Civil Proceedings
There are six civil proceedings initiated by our Company involving an aggregate amount of ` 13.36 million,
details of which are provided below:
1. Our Company has filed a civil suit (No. 312 of 2007) before the Court of District Judge, Tis Hazari, New
Delhi against Subramaniam Krishnamoorthy, a former employee, for recovery of ` 1,056,700, with
interest, on account of violation of the terms and conditions of his appointment as the center manager for
RXU&RPSDQ\¶VRIILFHLQ'XEDL
2. Our Company has filed a civil suit (CS (OS) No. 1718/2009) dated September 3, 2009 before the High
Court of Delhi against Triumphant Institute of Management Education PrivatH/LPLWHG³T.I.M.E.´IRU
recovery of ` 2,500,000 with interest and seeking a decree of mandatory and permanent injunction
against T.I.M.E. and others, to withdraw the comparative advertisements published in the Times of India,
Delhi edition, on account of the advertisements disparaging and denigrating the services and courses of
our Company. Our Company has also filed a miscellaneous application (No. 11853/2009) dated
September 3, 2009 before the High Court of Delhi, for ex-parte ad-interim injunction restraining
T.I.M.E. and others, from publishing the advertisement in print or electronic media. T.I.M.E. has filed an
interim application (No. 14705 of 2009) dated November 6, 2009 seeking dismissal of the suit with
exemplary costs.
3. Our Company has filed an execution petition (Ex. No. 01/2013) dated September 20, 2013 before the
Court of District Judge, Saket, New Delhi for execution of the award dated April 21, 2011 in the
arbitration claim (No. 1/2011) for an aggregate amount of ` 1,494,710, with interest awarded to our
Company, on account of loss caused to us by Arun Sangwan on violation of the terms and conditions of
his appointment letter dated February 1, 2010, appointing him as a marketing manager of our Company.
The Court of the District and Session Judge, South East, District Saket, New Delhi has transferred the
execution petition to the Court of District Judge, Bangalore by an order dated September 24, 2013, on
account of Arun Sangwan residing and having his property within the jurisdiction of the Court of District
Judge, Bangalore.
399
4. Our Company has filed an execution petition (Ex. No. 65/2011) dated June 9, 2011 before the District
Judge, Saket, New Delhi, for execution of the award dated November 3, 2010 in the arbitration claim
(No. 1/2009), for an amount of ` 1,640,000, with interest and direction to Raj Jha to not get involved in
activities similar to or directly competitive with activities of our Company, in relation to dispute over
conduct of services under the service agreement dated June 1, 2008 entered into between our Company
and Raj Jha for operating of a test prep center. The Court of the District and Session Judge, South East,
District Saket, New Delhi has transferred the execution petition to the District Judge, Vadodara, Gujarat
by an order dated September 7, 2011. Our Company has filed an execution petition (EA No. 174/2012)
dated February 29, 2012 before the District Judge, Vadodara, Gujarat.
5. Our Company filed a special leave pHWLWLRQ³SLP´&LYLO1R-17074/2013) before the Supreme
&RXUW RI ,QGLD ³SC´ DJDLQVW WKH &KLHI $GPLQLVWUDWRU +DU\DQD 8UEDQ 'HYHORSPHQW $XWKRULW\
³HUDA´ $GPLQLVWUDWRU +8'$ DQG RWKHUV DPRQJ RWKHU WKLQJV VHHNLQJ VSHFLDO OHDYH WR DSSHDO
against the orders dated October 4, 2012 and August 17, 2012 of the High Court of Punjab and Haryana
at Chandigarh in writ petitions (CWP No. 3821/2008 (O&M)) and (CWP No. 2297 of 2007 (O&M)),
UHVSHFWLYHO\7KHRUGHUGDWHG2FWREHUUHMHFWHGRXU&RPSDQ\¶VFKDOOHQJHWRWKHDOOHJHGDUELWUDU\
allotment of land by HUDA in Sectors 20-A and 20-B of Faridabad, on grounds of delay and latches and
the order dated August 17, 2012 in the matter of Bareja Automobiles Private Limited v. the State of
Haryana and others, in which our Company was not impleaded, ruled on questions of law, including
whether the scheme of allotment of sites by modes other than public auction were required to published
by way of regulations or can they be culled out from the brochure, whether the criteria of staff education
and training center related to training of in-house staff or third persons, when commercial and
manufacturing activities were not permissible on institutional sites, whether the principle of promissory
estoppel could be invoked against petitioners on grounds of participation in the selection process and
whether the court in exercise of its judicial powers, could take a different view regarding suitability of
applicants for allotment of plots in absence of proof of malafide intentions, favoritism and nepotism.
6. Our Company challenged the order of the Estate Officer (No. 29685) dated September 8, 2010 before the
Administrator, HUDA, Faridabad, seeking the waiver of the extension fee of ` 6,669,823 charged by
HUDA in respect of industrial plot No. 9A, Sector 27A, Faridabad. The Administrator, HUDA, having
taken note of documents presented as proof of construction on the plot, passed an order dated May 3,
2011, remanding the case to the Estate Officer for reconsideration.
Arbitration Proceedings
There are six arbitration proceedings initiated by our Company involving an aggregate amount of ` 24.41
million and AED 3,090,395, details of which are provided below:
1. Our Company has filed a claim dated July 7, 2014 before a sole arbitrator, against Monika Oli, in relation
to a dispute over violation of the employment agreement dated February 15, 2010, for her appointment as
SULQFLSDO FRQVXOWDQW LQ RXU &RPSDQ\¶V 'XEDL WHVW SUHSDUDWLRQ FHQWUH 2XU &RPSDQ\ KDV FODLPHG AED
3,090,395, including arbitration cost, with interest, on account of Monika Oli leaving the services of our
Company without serving notice period and commencing a competing business, Knowledge Planet LLC.
2. Our Company has filed a claim (No. 01/2014) dated January 30, 2014 before a sole arbitrator, against
Shantanu Das, in relation to dispute over violation of terms of the employment agreement dated May 30,
2013 and the innovation and confidentiality agreement dated June 1, 2012, entered into between our
Company and Shantanu Das for his appointment as an assistant manager of our Company. Our Company
has claimed ` 2,408,941, including arbitration costs, with interest, on account of Shantanu Das leaving
the services of our Company without serving notice period and joining a rival competitor (Think and
Learn Private Limited).
3. Our Company filed a claim (No. 01/2013) dated January 30, 2013 before a sole arbitrator, against C.B.
0RU$JHQFLHV3ULYDWH /LPLWHG³Mor Agencies´DQGLWVGLUHFWRU1LKLW0RULQUHODWLRQWRGLVSXWHRYHU
payments and conduct of services under the services agreement dated January 1, 2011 entered into
between our Company and Mor Agencies for operating a test prep center. Our Company has claimed `
4,462,329, including arbitration cost, with interest, on account of short deposit of fee collected from
students, refund of fees to students whose services were not completed, administrator appointed for the
center from June 1, 2012 to June 30, 2012, damage caused to the goodwill and reputation of our
400
Company, loss caused by starting a similar business in the same premises, impersonation as study center
RIRXU&RPSDQ\DQGLOOHJDODQGXQDXWKRULVHGXVHRIRXU&RPSDQ\¶VVWXG\PDWHULDO. Our Company also
filed an application dated January 30, 2013, seeking an ad-interim injunction against Mor Agencies and
RWKHUV UHVWUDLQLQJ WKHP IURP XVLQJ RXU &RPSDQ\¶V WUDGHPDUN ORJR DQG VWXG\ PDWHULDO 0RU $JHQFLHV
filed an application dated April 17, 2013 seeking declaration of the arbitration agreement as invalid as it
DOORZHG IRU DSSRLQWPHQW RI WKH DUELWUDWRU ZLWKRXW 0RU $JHQFLHV¶ FRQVHQW 1LKLW 0RU KDV ILOHG DQ
application dated April 17, 2013 seeking, among other things, recall of the notice issued to him under the
claim.
4. Our Company filed a claim (No. 05/2012) dated January 17, 2013 before a sole arbitrator, against Path
Finder and its proprietor Ritesh Mundhada, in relation to dispute over payments and conduct of services
under the services agreement dated May 15, 2009 entered into between our Company and Path Finder for
operating a test prep center. Our Company has claimed ` 2,929,571, including arbitration costs, with
interest, on account of short deposit of fee collected from students, outstanding payment towards debit
notes, purchase of material, loss caused by becoming a business partners of T.I.M.E. and illegal and
unauthorised usHRIRXU&RPSDQ\¶VGDWDWHFKQLFDONQRZ-how and training methodology. Our Company
has also sought a decree of injunction restraining Path Finder and others IURPXVLQJRXU&RPSDQ\¶VGDWD
technical know-how and training methodology.
5. Aptitude Learning ServLFHV 3 /LPLWHG ³Aptitude Learning´ ILOHG DQ DUELWUDWLRQ SHWLWLRQ 1R
ARBTN/126 of 2012) before the Court of District Judge and Additional Sessions Judge, I/C South
District, New Delhi, against our Company and Satya Narayanan .R, for quashing an arbitration award
dated July 31, 2012, passed by Satya Narayanan .R, acting as the sole arbitrator. Satya Narayanan .R,
was appointed to act as a sole arbitrator, in the claim (No. 1 of 2011) instituted by our Company against
Aptitude Learning in relation to a dispute over pending payments under the service agreement dated
April 1, 2008, entered into between our Company and Aptitude Learning for the grant of licenses in
connection with the operations of a test prep center. By an award dated July 31, 2012, the arbitrator
directed Aptitude Learning to pay ` 829,031 including arbitration cost, with interest on account of short
deposit of fee, purchase of material and outstanding license fee. Aptitude Learning has also filed an
interim application dated September 3, 2012, seeking an ad-interim stay against the arbitration award
dated July 31, 2012.
6. Our Company had instituted an arbitration claim (No. 01 of 2010) against Crest Education Private
/LPLWHG ³Crest´ DQG LWV GLUHFWRUV 6DW\DP 6KDQNDU 6DKDL DQG 6XUDEKL 0RGL 6ahai, in relation to a
dispute over rescission of a service agreement, entered into between our Company and Crest in
connection with the operation of test prep centers. Our Company also claimed that Crest had started a
similar and competitive business undeUWKH EUDQGQDPH µ7HDP 6DW\DP¶IURPWKHVDPH SUHPLVHV where
RXU&RPSDQ\¶VWHVWSUHSFHQWHUVZHUHEHLQJUXQ. The sole arbitrator by an ex parte order dated August
18, 2012, awarded our Company ` 13,780,987 with costs. Crest has filed a petition (O.M.P. No. 201 of
2013) dated November 22, 2012 against the order dated August 18, 2012. Crest has also filed an
application seeking condonation of delay in filing of the petition.
Crest has also filed an arbitration petition (No. 12 of 2013) dated May 1, 2013 before the High Court of
Allahabad, Lucknow Bench against our Company, for the appointment of an arbitrator, on account of the
order of the arbitrator dated August 18, 2012 being ex parte WKXV QRW UXOLQJ RQ &UHVW¶V GHPDQG IRU `
3,300,000 with interest on account of damages caused to it by our alleged breach of the agreement and
subsequent rejection of its requests for appointment of an arbitrator by our Company.
Our Company has filed a contempt petition (No. 98/2010) before the High Court of Delhi against Crest
and others, on account of breach of interim orders dated May 24, 2010 in two petitions (O.M.P. No. 138
of 2010) and (O.M.P. No. 213 of 2010) filed by our Company before the High Court of Delhi, against
Crest, seeking, among other things, an interim order restraining Crest and others from carrying out
business, similar and competitive to that of our Company, during the term of the service agreement. The
High Court of Delhi, by interim orders dated May 24, 2010, directed Crest and others, to be bound by
theiUVWDWHPHQWLQWKHKHDULQJWKDWµ7HDP6DW\DP¶ZDVQRWLQDQ\ZD\FRQQHFWHGZLWK&UHVWDQGWKDWLW
had not commenced any competitive business. Our Company has however, withdrawn petitions (O.M.P.
No. 138 of 2010) and (O.M.P. No. 213 of 2010) during the hearing of the petitions on August 25, 2010.
1. CLIP filed a civil miscellaneous petition (No. 632/2014) dated July 22, 2014 before the Court of District
Judge, Pune seeking an injunction against Pune .RQGKZD 5HDOW\ 3ULYDWH /LPLWHG ³PKRPL´ IURP
creating third party interests over a plot of land purchased by CLIP from PKRPL for the construction of a
school building. The Court of District Judge, Pune has passed an order dated July 24, 2014 granting an
ad-interim injunction restraining PKRPL. CLIP is in the process of invoking arbitration proceedings as
under the agreement for sale of the concerned plot dated October 18, 2011.
Income Tax
There are two income tax proceedings against CLEIS involving an aggregate amount of ` 289,400, details of
which are provided below:
The ACIT, through assessment order and notice dated November 30, 2010 for assessment year 2008-09,
disallowed certain deductions claimed by CLEIS, including payment of RoC charges, depreciation claimed on
&/(,6¶VZHEVLWHDQGSURYLVLRQIRUJUDWXLW\DQGFRPSXWHGWKHWRWDOWD[DEOHORVVDV ` 7,707, 052. Our Company
filed an appeal dated January 19, 2011 before the CIT(A) - VI, Delhi.
The ITO, New Delhi, through assessment order dated January 31, 2014 for assessment year 2011-12, disallowed
certain deductions claimed by CLEIS as bad debts. Consequently, by a demand notice dated January 31, 2014
the ACIT issued a demand of ` 2,89,400 as the additional tax payable by our Company. Our Company filed an
appeal dated March 24, 2014 before the CIT(A) - VI, Delhi.
Civil proceedings
There are two civil proceeding against CLEIS involving an aggregate amount of ` 14.09 million, details of
which are provided below:
2. 6UL /DNVKPL6DUDVZDWKL(GXFDWLRQDO6RFLHW\³SLSES´ILOHGD FLYLOVXLW26 1R. 652 of 2013) before
the Court of the III Additional District and Sessions Judge, Ranga Reddy District at L.B. Nagar, Andhra
Pradesh against CLEIS, seeking a permanent injunction restraining CLEIS from interfering with the
activities undertaken by SLSES, including the use of the brand name Indus World School. SLSES also
filed an interim application (I.A. No. 311 of 2013) for ad-interim injunction against CLEIS. CLEF ± AP
had entered into an agreement with SLSES dated April 30, 2007 to transfer the assets and liabilities of the
school from CLEF - AP Trust to SLSES, and CLEIS had entered into an agreement granting the SLSES a
five-year non-exclusive licence to use the Indus World School trademark and educational soft skills, to
operate the school under the Indus World School brand for this period. By an order dated August 2, 2013,
the Court of the III Additional District and Sessions Judge, Ranga Reddy District at L.B. Nagar directed
the parties to maintain status quo until September 2, 2013. CLEIS filed a written statement cum counter
claim dated August 21, 2013 claiming ` 13,286,493, with interest until final payment, as royalty due under
the agreement dated April 30, 2007, wherein non-exclusive license to use the brand name Indus World
School was granted to SLSES, and seeking directions to SLSES to render true and correct accounts for
402
fiscal 2014 and make payments as determined by the Court in relation to such accounts for fiscal 2014.
CLEIS also filed an interim application (I.A. No. 784 of 2013) before the Court of the III Additional
District and Sessions Judge, Ranga Reddy District at L. B, Nagar, Andhra Pradesh alleging that this court
did not have jurisdiction to try the present case pursuant to the terms of the agreement dated April 30,
2007. The Court of the III Additional District and Sessions Judge, Ranga Reddy District by an order dated
November 20, 2013 dismissed the application. CLEIS filed a revision petition (No. 125 of 2014) before
the High Court of Andhra Pradesh, seeking a stay on all further proceedings in O.S. No. 652 of 2013.
Civil Proceeding
1. CLEIS sent a legal notice dated June 23, 2014 to tKH2QDP(GXFDWLRQ6RFLHW\³2(6´) for non-payment
of license fees pursuant to an agreement entered into between CLEIS and OES on February 7, 2008. OES
filed a civil suit before the Court of the Civil Judge, Mandi, Himachal Pradesh against CLEIS seeking the
performance of the terms of the abovementioned agreement, as well as a permanent prohibitory injunction
against CLEIS terminating the agreement and acting contrary to the terms of the agreement.
Criminal Proceedings
1. CLEIS filed a criminal complaint (CC No. 177/2012) before the Additional Chief Metropolitan
Magistrate, Karkardooma Courts, Delhi against Bhupesh Masta, under Section 138 of the N.I. Act for
dishonor of a check amounting to ` 51,128 on grounds of insufficient funds and has claimed an amount
equivalent to twice the amount of the check.
Income Tax
1. The ACIT, through assessment order dated February 28, 2014 for assessment year 2011-12, disallowed
certain deductions claimed by Kestone as miscellaneous expenditures and provision of expenses. By the
same order, the ACIT declared Kestone to be in default, on account of, among other things, short
deduction of TDS and directed that penalty proceedings be initiated. Consequently, by a demand notice
dated February 28, 2014, the ACIT issued a demand of ` 628,160 as the total tax payable by Kestone.
Kestone filed an appeal dated March 24, 2014 before the CIT(A) - VI, Delhi.
V. Litigation by Kestone
Civil proceedings
1. Kestone filed a civil suit (No. 289 of 2012) before the Court of the Additional District Judge, Saket, New
Delhi against Edreamz and Shashank Shekhar Jha for recovery of ` 1,728,769, with pendente lite and
future interest, on account of non-payment of balance amount due towards event management services
provided by Kestone.
Criminal Proceedings
1. Gautam Puri filed a criminal complaint dated July 29, 2008 before the Additional Chief Metropolitan
Magistrate, Patiala House Courts, New Delhi against Neeraj Swaroop, CEO of Standard Chartered Bank,
for offences relating to extortion of money from Gautam Puri by the collection officers of the bank. The
Additional Chief Metropolitan Magistrate passed an order dated June 6, 2009 directing the police to
register an FIR and investigate further. We have been intimated by his counsel that a closure report was
filed by the police, in relation to which the Additional Chief Metropolitan Magistrate directed further
investigation. The matter is currently pending before the Court of the Metropolitan Magistrate, Saket.
403
II. Litigation against Satya Narayanan .R
Civil Proceedings
1. Arti Deshmukh and others have filed a civil suit dated June 3, 2013 against Indus World School and
Satya Narayanan .R before the Civil Judge, Aurangabad, seeking recovery of deposits and tuitions fees
amounting to ` 80,000, and a perpetual injunction restraining the Indus World School from running till
affiliation with the relevant board has been accorded. An application for temporary injunction has also
been filed.
Consumer complaints
1. Satya Narayanan .R has filed an appeal (F.A. No. 1092/2013) dated October 8, 2013 before the State
Consumer Disputes Redressal Commission, Delhi against M.K. Batra and Brilliant Tutorials, challenging
the order dated August 26, 2013 of the District Consumer Disputes Redressal Forum, New Delhi in
relation to a dispute over deficiency of services provided by Brilliant Tutorials. M. K. Batra had filed a
consumer complaint (CC No. 159 of 2012) before the District Consumer Disputes Redressal Forum, New
Delhi against Brilliant Tutorials centers through their managing director, Satya Narayanan .R, our
3URPRWHU DQG RWKHUV IRU UHIXQG RI KLV GDXJKWHU¶V WXLWLRQ IHH IRU WKH \HDUV -12 and 2012-13 of `
86,714, return of a check of ` 10,920, compensation of ` 70,000 and declaring the act of our Promoter
and others in ceasing to have any centers in Delhi as unlawful. The District Consumer Disputes Redressal
Forum, Saini Enclave, New Delhi, by order dated August 26, 2013, found Satya Narayanan .R and other
respondents to be deficient in services provided, and directed them to pay ` 77,262, with interest.
Further, Mukesh Kumar was directed to stop payment of the check of ` 10,920. Our Company has also
filed an application dated October 8, 2013 for stay of the order dated August 26, 2013. Satya Narayanan
.R has been impleaded as a party on account of a communication dated November 18, 2011 to Mukesh
Kumar, informing him of a tie-up between our Company and Brilliant Tutorials, pursuant to which
classes would be resumed. The State Consumer Disputes Redressal Commission, Delhi has by an order
dated November 7, 2013 granted stay of the operation of the order until further orders.
Civil proceedings
1. Nikhil Mahajan is a party to a suit for recovery of money filed by Dinesh Gupta and another (No. 137 of
)RUPRUHLQIRUPDWLRQVHH³Litigation against our Company´RQSDJH393.
Civil proceedings
1. Nikhil Mahajan is a party to a suit for recovery of money filed by Dinesh Gupta and another (No. 137 of
)RUPRUHLQIRUPDWLRQVHH³Litigation against our Company´RQSDJH393.
Consumer complaints
1. Kshitij Srivastava, through his mother Mona Srivastava, has filed a complaint (No. 273/13) dated March
1, 2013 before the District Consumer Dispute Redressal Forum, Delhi against our Managing Director,
Gautam Puri and the managing director of Brilliant Tutorials, for an amount of ` 619,594, on account of
Brilliant Tutorials not holding classes at its Kalu Sarai, Sarvapriya Vihar, New Delhi center. Our
Managing Director has been impleaded as a party to the matter on account of a communication dated
November 18, 2011 to Kshitij Srivastava, informing him of a tie-up between our Company and Brilliant
Tutorials, pursuant to which classes would be resumed.
As on the date of this Draft Red Herring Prospectus, our Company does not owe any amount to any micro, small
and medium enterprises or other creditors which has been outstanding for more than 30 days except in the
ordinary course of business. For further details, VHH³Financial Statements´RQSDJH167.
STATUTORY DUES
As on September 22, 2014, our Company has paid the outstanding statutory dues as on March 31, 2014. For
details of statutory dues in the ODVWILYHILVFDOVVHH³Financial Statements´RQSDJH167.
MATERIAL DEVELOPMENTS
([FHSW DV VWDWHG LQ ³0DQDJHPHQW¶V 'LVFXVVLRQ DQG $QDO\VLV RI )LQDQFLDO &RQGLWLRQ DQG 5HVXOWV RI
Operation´ on page 359, there have not arisen, since the date of the last financial statements disclosed in this
Draft Red Herring Prospectus, any circumstances which materially and adversely affect or are likely to affect
our profitability taken as a whole or the value of our consolidated assets or our ability to pay our liabilities
within the next 12 months.
405
GOVERNMENT AND OTHER APPROVALS
We have received the necessary consents, licenses, permissions and approvals from the GoI and various
governmental agencies required for our present business and except as disclosed in this Draft Red Herring
Prospectus no further material approvals are required for carrying on our present business operations.
The main objects clause of the Memorandum of Association, objects incidental to the main objects and other
objects clause enable the Company to undertake its existing activities.
1. Certificate of incorporation dated April 25, 1996 issued to our Company by the RoC.
2. Fresh certificate of incorporation dated June 17, 2000 issued to our Company by the RoC on account of
FKDQJHRIQDPHIURPµ&DUHHU/DXQFKHU,QGLD3ULYDWH/LPLWHG¶WRµ&DUHHU/DXQFKHU,QGLD/LPLWHG¶ upon
conversion to a public limited company.
3. Fresh certificate of incorporation dated March 18, 2011 issued to our Company by the RoC on account of
change of name from µ&DUHHU/DXQFKHU,QGLD/LPLWHG¶WRµ&/(GXFDWH/LPLWHG¶
Set forth below is a brief description of the approvals received by our Company for its operations. The approvals
obtained in respect of our operations and listed below are valid as of the date of filing of this Draft Red Herring
Prospectus. Some of these may expire in the ordinary course of business and applications for renewal of these
approvals are submitted in accordance with applicable procedures and requirements. Further, these approvals
and licenses are subject to the effective implementation of the conditions contained therein.
Shops and Establishment Acts are state legislations that seek to govern and regulate the working conditions of
workers/ employees employed in shops and commercial establishments within that state. We obtain registration
for our owned test prep centers, under the relevant shops and establishment act, as per the procedures laid down
therein from time to time, and, as on the date of this Draft Red Herring Prospectus, we are yet to apply for the
registration of one owned test prep centers.
Miscellaneous approvals
In addition to the approvals listed above, our Company is also required to obtain certain approvals from the
central/concerned state government departments and other local or municipal authorities, for the conduct of its
business operations and taxation registrations, including PAN, service tax registrations, professional tax
registrations, as applicable.
Trademark Registrations
Our Company owns the following trademarks registered under the Trademarks Act:
406
S. Description Class Registration/ Date of Date of Expiry
No. Reference No. Registration
8. Career Launcher ± Kits K 16 1168944 January 23, 2003 January 23, 2023
9. Career Launcher ± Kits K 41 1246832 October 30, 2003 October 30, 2023
10. Career Launcher ± 16 1168941 January 23, 2003 January 23, 2023
Magiclamp
11. Career Launcher ± 41 1246840 October 30, 2003 October 30, 2023
Magiclamp
12. Career Launcher ± PDP 41 1246833 October 30, 2003 October 30, 2023
13. Career Launcher ± Pegasus 41 1246839 October 30, 2003 October 30, 2023
14. Seagull 16 853896 April 29,1999 April 29, 2019
15. Seagull 41 1246834 October 30, 2003 October 30, 2023
16. A Career Launcher Product ± 16 1246829 October 30, 2003 October 30, 2023
Speak Easy
17. A Career Launcher Product ± 41 1246830 October 30, 2003 October 30, 2023
Speak Easy
Pending Applications
Our Company has made the following applications for the registration of its trademarks, which are pending as
on date of this Draft Red Herring Prospectus:
Further, we are in the process of transferring six trademarks registered in the name of LST to our Company.
In addition, our Subsidiary, CLIP, has applied for registration of the WUDGHPDUNVµAnanda ± WKHMR\RIOHDUQLQJ¶
DQGµIndus World School ± know thyself¶LQFODVVHVDQGRQ$XJXVW
407
OTHER REGULATORY AND STATUTORY DISCLOSURES
Corporate Approvals
x Our Board of Directors has, pursuant to its resolution dated July 22, 2014, authorized the Offer, subject
to the approval by the shareholders of our Company under Section 62(1)(c) of the Companies Act,
2013.
x Our shareholders have, pursuant to a resolution dated September 5, 2014, under Section 62(1)(c) of the
Companies Act, 2013, authorized the Offer.
The details of the approvals received from the Selling Shareholders are set forth below:
x We have received an in-principle approval from the BSE for the listing of our Equity Shares pursuant
WRDOHWWHUGDWHG>Ɣ@
x We have received an in-principle approval from the NSE for the listing of our Equity Shares pursuant
WRDOHWWHUGDWHG>Ɣ@
Except (i) Sangeeta Bhagwatiprasad Modi who is a settlor of Access India Fund ±I, and (ii) Gopal Jain who is a
director of Bonanza Portfolio Limited, none of our Directors are in any manner associated with the securities
market. Except as stated below, based on information provided to us by our Directors, there has been no action
taken by the SEBI against our Directors or any entity in which our Directors are involved in as promoters or
directors.
Details of any enquiry/ investigation conducted or penalty imposed by SEBI on Bonanza Portfolio Limited
³Bonanza´):
1. SEBI has issued a letter dated May 19, 2004, to Bonanza, alleging non-exercise of due care and diligence
in conduct of its business as a broker, while dealing with clients in the scrip of Radaan Mediaworks India
Private Limited, and levied a penalty of ` 1.55 million, which has been noted and complied with by
Bonanza.
2. SEBI has issued a letter dated February 2, 2005, to Bonanza, alleging non exercise of due skill, care and
diligence while dealing with clients in the scrip of Shukun Construction Limited, and levied a penalty of
` 0.1 million, which has been noted and complied with by Bonanza.
3. SEBI has issued a letter dated January 6, 2004, to Bonanza, alleging indulgence in creation of artificial
volume in scrip of Shree Yaax Pharma & Cosmetics Limited, further to which, SEBI has, by a letter
dated August 25, 2008, advised Bonanza to be careful in future in the conduct of its affairs as a capital
market intermediary, which has been noted and complied with by Bonanza.
4. SEBI has issued a letter dated February 13, 2004, to Bonanza, alleging non exercise of due skill, care and
diligence while dealing with clients in the scrip of Information Technologies (India) Limited. SEBI has,
by an order dated June 28, 2007, advised Bonanza to be careful and cautious in its dealings in securities
market, which has been noted and complied with.
5. SEBI has issued an order dated April 17, 2013, to Bonanza, in relation to alleged violation under the
SEBI Intermediaries Regulations, 2008 in the matter of Shiv Raj Puri-Relationship Manager-Citibank
Gurgaon & Others, in the period April 2009-December 2010, by which SEBI disposed of its show cause
notice (No. IVD/ID4/SKS/SL/20823/2012) dated September 17, 2012, observing that, considering the
facts and circumstances, the matter was not fit for taking action by Bonanza.
6. SEBI has issued a letter dated January 15, 2008, to Bonanza, in the matter of TCI Industries Limited
(August 31, 2004 to December 31, 2004), further to which SEBI has, by a letter dated September 18,
2008, advised Bonanza to be cautious in the future to avoid recurrence of such instances, which has been
noted and complied with by Bonanza.
7. SEBI has issued a letter dated December 29, 2008, to Bonanza, in the matter of Vipul Limited (May 21,
2008 to July 7, 2008), further to which, SEBI has, by a letter dated June 10, 2009, advised Bonanza to be
careful to avoid recurrence of such instances and to take corrective steps and improve systems and keep
SEBI informed of this matter, which has been noted and complied with by Bonanza.
8. SEBI has issued a letter dated March 2008, to Bonanza, alleging circular/reversal trades in the scrips of
BSEL Information Systems Limited and Maharashtra Seamless Limited, in the period December 1, 2003-
March 31, 2004, further to which SEBI, by a letter dated October 17, 2008, advised Bonanza to be more
careful in future to avoid recurrence of such instances, which has been noted and complied with by
Bonanza.
409
9. SEBI has issued a letter dated February 17, 2004, to Bonanza, alleging dealing in illiquid scrips in the
matter of Oriental Trade Limited in the period August 30, 2002-October 28, 2002, further to which, SEBI
has, by a letter dated July 11, 2008, SEBI has advised Bonanza to be careful in future to avoid recurrence
of such instances, which has been noted and complied with by Bonanza.
10. In relation to an inspection by SEBI of books and records of Bonanza for the period 2009-2010, SEBI
has, by its letter dated August 11, 2011, advised Bonanza to be careful in future to improve compliance
standards and place findings of the inspection and corrective steps taken before SEBI, which has been
noted and complied with by Bonanza.
11. In relation to an inspection by SEBI of Bonanza with respect to prevention of money laundering
operations for the period 2011-2012, SEBI has, by a letter dated December 20, 2012, advised Bonanza to
ensure strict compliance of the Prevention of Money Laundering Act, 2002 and rules and regulations
issued thereunder, which has been noted and complied with by Bonanza.
12. In May 2013, SEBI has initiated inspection in relation to certain investor grievances, pursuant to which
%RQDQ]DKDVILOHGDUHSO\GDWHG'HFHPEHUDQG6(%,¶VILQDOREVHUYDWLRQOHWWHULVDZDLWHG
Neither our Company, any of our Promoters, Group Entities, nor our Directors, or the relatives (as per the
Companies Act, 2013) of our Promoters, have been detained as wilful defaulters by the RBI or any other
governmental authorities.
Our Company is eligible for the Offer in accordance with Regulation 26 (1) of the SEBI ICDR Regulations as
described below:
(a) it has net tangible assets of at least three crore rupees in each of the preceding three full years (of
twelve months each), of which not more than fifty per cent. are held in monetary assets:
Provided that if more than fifty per cent. of the net tangible assets are held in monetary assets, the
issuer has made firm commitments to utilise such excess monetary assets in its business or project;
Provided further that the limit of fifty per cent. on monetary assets shall not be applicable in case the
public offer is made entirely through an offer for sale.
(b) it has a minimum average pre-tax operating profit of rupees fifteen crore, calculated on a restated and
consolidated basis, during the three most profitable years out of the immediately preceding five years.
(c) it has a net worth of at least one crore rupees in each of the preceding three full years (of twelve
months each);
(d) the aggregate of the proposed issue and all previous issues made in the same financial year in terms of
the issue size does not exceed five times its pre-issue net worth as per the audited balance sheet of the
preceding financial year;
(e) if it has changed its name within the last one year, at least fifty per cent. of the revenue for the
preceding one full year has been earned by it from the activity indicated by the new name´
Set forth below are the net tangible assets, monetary assets, monetary assets as a percentage of our net tangible
assets, our pre tax operating profit and net worth, which are derived from our restated consolidated financial
statements, as of and for the five years ended March 31, 2010, March 31, 2011, March 31, 2012, March 31,
2013 and March 31, 2014 included in this Draft Red Herring Prospectus.
Particulars Fiscal 2014 Fiscal 2013 Fiscal 2012 Fiscal 2011 Fiscal 2010
Pre-tax operating profit (1) 183.65 170.32* (112.33) 133.34 54.09
Networth (2) 1,130.46 1,105.13 898.56 846.22 635.70
410
Particulars Fiscal 2014 Fiscal 2013 Fiscal 2012 Fiscal 2011 Fiscal 2010
Net tangible assets (3) 1,725.49 1,657.88 1,536.80 1,465.09 1,239.38
Monetary assets (4) 849.91 812.84 748.44 761.08 643.29
Monetary assets as a % of net tangible 49.26% 49.03% 48.70% 51.95% 51.90%
assets (4/3)
*For the fiscal year 2013, pre-tax operating profit is profit before tax as per restated and consolidated financial statements
as increased by finance cost and as reduced by other income (excluding provision for doubtful debts written back
aggregating ` 112.88 millions). Provision for debts written back has not been excluded from pre-tax operating profit as per
there is a corresponding bad debts debited to restated summary statement of profit and loss and did not have any impact on
profit for fiscal year 2013.
Notes:
(1) Pre-tax operating profit is profit before tax as per restated and consolidated financials as increased by finance cost and
as reduced by other income.
(2) 'Net worth' has been defined as the aggregate of the paid up share capital and reserves and surplus (excluding
revaluation reserve) as reduced by the aggregate of the miscellaneous expenditure (to the extent not adjusted or written-off)
as per restated unconsolidated financial statements.
(3) 'Net tangible assets' means the sum of all net assets of the Company as per restated unconsolidated financial statements
excluding intangible assets as defined in Accounting Standard 26 notified pursuant to Companies (Accounting Standards)
Rules 2006.
(4) Monetary assets comprise of cash and bank balance, security deposits, loan to employees, trade receivables and other
current/non-current assets, except fixed assets held for sale.
Our average pre-tax operating profit calculated on a restated basis, during the three most profitable years being
year ended on March 31, 2011, March 31, 2013 and March 31, 2014 out of the immediately preceding five years
is ` 162.44 million.
Hence, we are eligible for the Offer as per Regulation 26(1) of the SEBI ICDR Regulations. Further, in
accordance with Regulation 26(4) of the SEBI ICDR Regulations, our Company shall ensure that the number of
Allottees under the Offer shall be not less than 1,000, otherwise, the entire application money will be refunded
forthwith. If the Company does not allot Equity Shares pursuant to the Offer within 12 Working Days from the
Bid/Offer Closing Date or within such timeline as prescribed by SEBI, it shall repay without interest all monies
received from bidders, failing which interest shall be due to be paid to the applicants at the rate of 15% per
annum for the delayed period.
All expenses with respect to the Offer will be shared between the Selling Shareholders and our Company, in
proportion to the Equity Shares contributed to the Offer.
411
1. WE HAVE EXAMINED VARIOUS DOCUMENTS INCLUDING THOSE RELATING TO
LITIGATION SUCH AS COMMERCIAL DISPUTES, PATENT DISPUTES, DISPUTES WITH
COLLABORATORS, ETC. AND OTHER MATERIAL IN CONNECTION WITH THE
FINALISATION OF THE DRAFT RED HERRING PROSPECTUS PERTAINING TO THE SAID
OFFER;
2. ON THE BASIS OF SUCH EXAMINATION AND THE DISCUSSIONS WITH THE COMPANY,
ITS DIRECTORS AND OTHER OFFICERS, OTHER AGENCIES, INDEPENDENT
VERIFICATION OF THE STATEMENTS CONCERNING THE OBJECTS OF THE ISSUE,
PRICE JUSTIFICATION AND THE CONTENTS OF THE DOCUMENTS AND OTHER PAPERS
FURNISHED BY THE COMPANY,
WE CONFIRM THAT:
A. THE DRAFT RED HERRING PROSPECTUS FILED WITH THE SEBI IS IN CONFORMITY
WITH THE DOCUMENTS, MATERIALS AND PAPERS RELEVANT TO THE OFFER;
C. THE DISCLOSURES MADE IN THE DRAFT RED HERRING PROSPECTUS ARE TRUE,
FAIR AND ADEQUATE TO ENABLE THE INVESTORS TO MAKE A WELL-INFORMED
DECISION AS TO INVESTMENT IN THE PROPOSED OFFER AND SUCH DISCLOSURES
ARE IN ACCORDANCE WITH THE REQUIREMENTS OF THE COMPANIES ACT, 1956,
AS AMENDED AND REPLACED BY THE COMPANIES ACT, 2013, TO THE EXTENT IN
FORCE, THE SECURITIES AND EXCHANGE BOARD OF INDIA (ISSUE OF CAPITAL
AND DISCLOSURE REQUIREMENTS) REGULATIONS, 2009 AND OTHER APPLICABLE
LEGAL REQUIREMENTS.
5. WE CERTIFY THAT WRITTEN CONSENT FROM THE PROMOTERS HAS BEEN OBTAINED
FOR INCLUSION OF THEIR (48,7< 6+$5(6 $6 3$57 2) 7+( 352027(56¶
CONTRIBUTION SUBJECT TO LOCK-IN AND THE EQUITY SHARES PROPOSED TO FORM
3$57 2) 7+( 352027(56¶ &2175,%87,21 68%-(&7 72 /2&.-IN SHALL NOT BE
DISPOSED/ SOLD/ TRANSFERRED BY THE PROMOTERS DURING THE PERIOD
STARTING FROM THE DATE OF FILING THE DRAFT RED HERRING PROSPECTUS WITH
THE SEBI UNTIL THE DATE OF COMMENCEMENT OF LOCK-IN PERIOD AS STATED IN
THE DRAFT RED HERRING PROSPECTUS;
8. WE CERTIFY THAT THE PROPOSED ACTIVITIES OF THE COMPANY FOR WHICH THE
)81'6 $5( %(,1* 5$,6(' ,1 7+( 35(6(17 2))(5 )$// :,7+,1 7+( µ0$,1
2%-(&76¶/,67(',17+(2%-(&7&/$86(2)7+(0(025$1'802)$662&,$7,21
OR OTHER CHARTER OF THE COMPANY AND THAT THE ACTIVITIES WHICH HAVE
BEEN CARRIED OUT UNTIL NOW ARE VALID IN TERMS OF THE OBJECT CLAUSE OF
ITS MEMORANDUM OF ASSOCIATION;
10. WE CERTIFY THAT A DISCLOSURE HAS BEEN MADE IN THE DRAFT RED HERRING
PROSPECTUS THAT THE INVESTORS SHALL BE GIVEN AN OPTION TO GET THE
SHARES IN DEMAT OR PHYSICAL MODE ± NOT APPLICABLE;
12. WE CERTIFY THAT THE FOLLOWING DISCLOSURES HAVE BEEN MADE IN THE DRAFT
RED HERRING PROSPECTUS:
14. WE ENCLOSE A NOTE EXPLAINING HOW THE PROCESS OF DUE DILIGENCE HAS BEEN
EXERCISED BY US IN VIEW OF THE NATURE OF CURRENT BUSINESS BACKGROUND OF
THE COMPANY, SITUATION AT WHICH THE PROPOSED BUSINESS STANDS, THE RISK
)$&7256352027(56¶(;3(5,(1&((7&
16. :( (1&/26( 67$7(0(17 21 µ35,&( ,1)250$7,21 2) 3$67 ,668(6 +$1'/(' %<
MERCHANT BANKERS (WHO ARE RESPONSI%/( )25 35,&,1* 7+,6 ,668(¶ $6 3(5
FORMAT SPECIFIED BY THE SEBI THROUGH CIRCULAR;
17. WE CERTIFY THAT PROFITS FROM RELATED PARTY TRANSACTIONS HAVE ARISEN
FROM LEGITIMATE BUSINESS TRANSACTIONS ± COMPLIED WITH TO THE EXTENT OF
THE RELATED PARTY TRANSACTIONS REPORTED IN ACCORDANCE WITH
ACCOUNTING STANDARD 18 IN THE FINANCIAL STATEMENTS OF THE COMPANY
INCLUDED IN THE DRAFT RED HERRING PROSPECTUS.
THE FILING OF THE DRAFT RED HERRING PROSPECTUS DOES NOT, HOWEVER, ABSOLVE
THE COMPANY FROM ANY LIABILITIES UNDER SECTION 34 OR SECTION 36 OF THE
COMPANIES ACT 2013 OR FROM THE REQUIREMENT OF OBTAINING SUCH STATUTORY
AND OTHER CLEARANCES AS MAY BE REQUIRED FOR THE PURPOSE OF THE PROPOSED
OFFER. SEBI FURTHER RESERVES THE RIGHT TO TAKE UP AT ANY POINT OF TIME, WITH
THE BRLM, ANY IRREGULARITIES OR LAPSES IN THE DRAFT RED HERRING PROSPECTUS.
S Issue Name Issue Size Issue Listing Openi Closing % Benchm Closing Benchm Closing Benchm Closing Benchm
. (in ` price date ng price on Change ark price as ark price as ark price as ark
N million) (in `) price listing in Price index on 10th index as on 20th index as on 30th index as
o on date on on calenda on 10th calenda on 20th calenda on 30th
. listing listing listing r day calenda r day calenda r day calenda
date date date from r day from r day from r day
(Closin (Closin listing from listing from listing from
g) vs. g) day listing day listing day listing
Issue day day day
Price (Closin (Closin (Closin
g) g) g)
1. Bharti 41,727.60 220.00 December 200.00 191.65 -12.89% 5,908.35 207.40 5,988.40 204.40 6,001.85 210.30 6,074.80
Infratel 28, 2012
Limited(1)
2. PC Jeweller 6,013.08 135.00 December 137.00 149.20 10.52% 5,870.10 181.65 5,988.40 168.90 6,056.60 157.55 6,074.65
Limited(2) 27, 2012
3. Credit 5,399.78 750.00 December 940.00 922.55 23.01% 5,905.60 934.75 6,016.15 923.45 6,024.05 920.85 6,019.35
Analysis & 26, 2012
Research
Limited
4. Speciality 1,760.91 150.00 May 30, 152.00 159.60 6.40% 4,950.75 182.45 5,068.35 206.65 5,064.25 213.05 5,149.15
Restaurants 2012
Limited
(1)
In Bharti Infratel Limited, the anchor investor issue price was ` 230 per equity share and the issue price after discount to Retail Individual Bidders was ` 210
per equity share.
(2)
In PC Jeweller Limited, the issue price after discount to Retail Individual Bidders and Eligible Employees was ` 130 per equity share.
Fiscal Total Total No. of IPOs trading at No. of IPOs trading at No. of IPOs trading at No. of IPOs trading at
Year No. Funds discount on listing date premium on listing date discount as on 30th premium as on 30th
of Raised (` calendar day from listing calendar day from listing
IPOs Million) day day
Over Between Less Over Between Less Over Between Less Over Between Less
50% 25-50% than 50% 25-50% than 50% 25-50% than 50% 25-50% than
25% 25% 25% 25%
April - - - - - - - - - - - - - -
1, 2014
±
August
31,
2014
2013- - - - - - - - - - - - - - -
14
2012- 4 54,901.36 - - 1 - - 3 - - 1 - 1 2
414
13
For details regarding the track record of the BRLM, as specified under Circular reference CIR/MIRSD/1/2012
dated January 10, 2012 issued by the SEBI, please refer to the website of the BRLM, at
http://investmentbank.kotak.com/track-record/index.html.
Caution ± Disclaimer from our Company, our Directors, the Selling Shareholders and the BRLM
Our Company, our Directors and the BRLM accept no responsibility for statements made otherwise than in this
Draft Red Herring Prospectus or in the advertisements or any other material issued by or at our instance and
anyone placing reliance on any other source of information, including our websites, www.cleducate.com,
www.clzone.in, www.careerlauncher.com, www.lst.com, gkpublication.com, www.indusworldschool.com and
www.kestone.in, or the websites of any of our Promoters, Promoter Group and Group Entities would be doing
so at his or her own risk. The Selling Shareholders, their directors, affiliates, associates and their respective
directors and officers accept no responsibility for any statements made other than those made in relation to them
and/or to the Equity Shares offered by them respectively, through the Offer for Sale.
The BRLM accepts no responsibility, save to the limited extent as provided in the Offer Agreement entered into
among the BRLM, the Selling Shareholders and our Company dated September 26, 2014 and the Underwriting
Agreement to be entered into among the Underwriters, the Selling Shareholders and our Company.
All information shall be made available by our Company, the Selling Shareholders and the BRLM to the
Bidders and public at large and no selective or additional information would be available for a section of the
investors in any manner whatsoever, including at road show presentations, in research or sales reports, at
bidding centers or elsewhere.
Neither our Company, the Selling Shareholders nor the Syndicate shall be liable to the Bidders for any failure in
uploading the Bids, due to faults in any software or hardware system, or otherwise.
The BRLM and their associates may engage in transactions with, and perform services for our Company, the
Selling Shareholders, our Group Entitles and our respective affiliates and associates in the ordinary course of
business, and have engaged, or may in the future engage in commercial banking and investment banking
transactions with our Company, the Selling Shareholders, our Group Entities or our respective affiliates or
associates for which they have received, and may in future receive compensation.
Bidders that bid in the Offer will be required to confirm, and will be deemed to have represented to our
Company, the Selling Shareholders, the Underwriters and their respective directors, officers, agents, affiliates
and representatives that they are eligible under all applicable laws, rules, regulations, guidelines and approvals
to acquire the Equity Shares, and will not issue, sell, pledge or transfer the Equity Shares to any person who is
not eligible under applicable laws, rules, regulations, guidelines and approvals to acquire the Equity Shares. Our
Company, the Selling Shareholders, the Underwriters and their respective directors, officers, agents, affiliates
and representatives accept no responsibility or liability for advising any investor on whether such investor is
eligible to acquire our Equity Shares.
This Offer is being made in India to persons resident in India (including Indian nationals resident in India,
+LQGX 8QGLYLGHG )DPLOLHV ³HUFs´ companies, other corporate bodies and societies registered under the
applicable laws in India and authorized to invest in equity shares, Indian Mutual Funds registered with the SEBI,
Indian financial institutions, commercial banks, regional rural banks, co-operative banks (subject to permission
from the RBI), or trusts under the applicable trust laws, and who are authorized under their constitution to hold
and invest in equity shares, public financial institutions as specified under Section 2(72) of the Companies Act,
2013, venture capital funds, permitted insurance companies and pension funds and, to permitted non-residents
including Eligible NRIs, $OWHUQDWLYH ,QYHVWPHQW )XQGV ³AIFs´, Foreign Portfolio Investors registered with
6(%, ³FPIs´ DQG 4,%V 7KLV 'UDIW Red Herring Prospectus does not, however, constitute an invitation to
subscribe to Equity Shares offered hereby, in any jurisdiction to any person to whom it is unlawful to make an
offer or invitation in such jurisdiction. Any person into whose possession this Draft Red Herring Prospectus
415
comes is required to inform himself or herself about, and to observe, any such restrictions. Any dispute arising
out of this Offer will be subject to the jurisdiction of appropriate court(s) at New Delhi, India only.
No action has been, or will be taken to permit a public offering in any jurisdiction where action would be
required for that purpose, except that the Draft Red Herring Prospectus was filed with SEBI for its observations.
Accordingly, the Equity Shares represented hereby may not be offered or sold, directly or indirectly, and this
Draft Red Herring Prospectus may not be distributed, in any jurisdiction, except in accordance with the legal
requirements applicable in such jurisdiction. Neither the delivery of this Draft Red Herring Prospectus, nor any
offer or sale hereunder, shall, under any circumstances, create any implication that there has been no change in
our affairs from the date hereof or that the information contained herein is correct as of any time subsequent to
this date.
The Equity Shares offered in the Offer have not been and will not be registered under the U.S. Securities
$FW³866HFXULWLHV$FW´RUDQ\VWDWHVHFXULWLHVODZVLQWKH8QLWHG6WDWHVDQGXQOHVVVRUHJLVWHUHG
may not be offered or sold within the United States, except pursuant to an exemption from, or in a
transaction not subject to, the registration requirements of the U.S. Securities Act and applicable state
securities laws. Accordingly, such Equity Shares are being offered and sold outside of the United States in
offshore transactions in reliance on Regulation S under the U.S. Securities Act and the applicable laws of
the jurisdiction where those offers and sales occur.
The Equity Shares have not been and will not be registered, listed or otherwise qualified in any other
jurisdiction outside India and may not be offered or sold, and Bids may not be made by persons in any
such jurisdiction, except in compliance with the applicable laws of such jurisdiction.
Bidders are advised to ensure that any single bid from them does not exceed the investment limits or maximum
number of Equity Shares that can be held by them under applicable law.
As required, a copy of this Draft Red Herring Prospectus shall be submitted to the BSE. The disclaimer clause
as intimated by the BSE to us, shall be included in the Red Herring Prospectus prior to filing with the RoC.
As required, a copy of this Draft Red Herring Prospectus shall be submitted to the NSE. The disclaimer clause
as intimated by the NSE to us, shall be included in the Red Herring Prospectus prior to filing with the RoC.
Filing
A copy of this Draft Red Herring Prospectus has been filed with the SEBI at 5th floor, Bank of Baroda Building,
16, Sansad Marg, New Delhi 110 001, India.
A copy of the Red Herring Prospectus, along with the documents required to be filed, will be delivered for
registration to the RoC in accordance with Section 32 of the Companies Act, 2013, and a copy of the Prospectus
required to be filed under Section 26 of the Companies Act, 2013 will be delivered for registration to the RoC
situated at the address mentioned below.
Listing
Application has been made to the Stock Exchanges for obtaining permission for listing of the Equity Shares
being issued and sold in the Offer and [Ɣ] is the Designated Stock Exchange, with which the Basis of Allotment
will be finalized for the Offer.
416
If the permission to deal in and for an official quotation of the Equity Shares is not granted by the Stock
Exchanges, our Company shall forthwith repay, without interest, all monies received from the applicants in
reliance of the Red Herring Prospectus. Our Company shall ensure that all steps for the completion of the
necessary formalities for listing and commencement of trading at the Stock Exchanges are taken within 12
Working Days of the Bid/Offer Closing Date. If our Company does not allot Equity Shares pursuant to the Offer
within 12 Working Days from the Bid/Offer Closing Date or within such timeline as prescribed by SEBI, it shall
repay without interest all monies received from bidders, failing which interest shall be due to be paid to the
applicants at the rate of 15% per annum for the delayed period.
The Selling Shareholders undertake to provide such reasonable support and extend reasonable cooperation as
may be requested by our Company, to the extent such support and cooperation is required from such party to
facilitate the process of listing and commencement of trading of the Equity Shares on the Stock Exchanges. All
expenses with respect to the Offer will be shared between the Selling Shareholders and our Company, in
proportion to the Equity Shares contributed to the Offer. Further, each of the Selling Shareholders shall
reimburse our Company for any interest paid by it, on behalf of the Selling Shareholder, in proportion to the
Equity Shares offered for sale by each of the Selling Shareholder in the Offer, in so far as any delays pertain to
the Equity Shares offered for sale by such Selling Shareholder.
Impersonation
Attention of the Bidders is specifically drawn to the provisions of sub-section (1) of Section 38 of the
Companies Act, 2013 which is reproduced below:
³$Q\SHUVRQZKR±
(a) makes or abets making of an application in a fictitious name to a company for acquiring, or subscribing
for, its securities, or
(b) makes or abets making of multiple applications to a company in different names or in different
combinations of his name or surname for acquiring or subscribing for its securities; or
(c) otherwise induces directly or indirectly a company to allot, or register any transfer of, securities to him, or
to any other person in a fictitious name,
VKDOOEHOLDEOHIRUDFWLRQXQGHUVHFWLRQ´
The liability prescribed under Section 447 of the Companies Act, 2013 includes imprisonment for a term of not
less than six months extending up to 10 years (provided that where the fraud involves public interest, such term
shall not be less than three years) and fine of an amount not less than the amount involved in the fraud,
extending up to three times of such amount.
Consents
Consents in writing of: (a) the Selling Shareholders, our Directors, the Company Secretary and Compliance
Officer, the Auditors, the legal counsels, the Bankers to our Company, the Bankers to the Offer, lenders (where
such consent is required), industry sources; and (b) the BRLM, the Syndicate Members and the Registrar to the
Offer to act in their respective capacities, will be obtained and filed along with a copy of the Red Herring
Prospectus with the RoC and such consents shall not be withdrawn up to the time of delivery of the Red Herring
Prospectus and the Prospectus with the RoC.
Haribhakti & Co. LLP, Chartered Accountants, our Auditors, have given their written consent to the inclusion of
WKHLU UHSRUW LQ WKH IRUP DQG FRQWH[W LQ ZKLFK LW DSSHDUV LQ ³Financial Statements´ RQ SDJH 167 and of their
report relating to tax benefits accruing to our Company in the form and context in which it appears in
³Statement of Tax Benefits´RQSDJH93 and such consent and report shall not be withdrawn up to the time of
delivery of the Red Herring Prospectus and the Prospectus for registration with the RoC.
Expert Opinion
Except for the report of our Auditors on the financial statements and the statement of tax benefits included in
this Draft Red Herring Prospectus on pages 167 and 93, respectively, our Company has not obtained any expert
417
opinion.
The total expenses of the Offer are estimated to be approximately ` >Ɣ@ PLOOLRQ The expenses of this Offer
include, among others, underwriting and management fees, printing and distribution expenses, legal fees,
advertisement expenses and listing fees. The estimated Offer expenses are as follows:
(` in million)
Activity Estimated expenses* As a % of the As a % of the total
total estimated Offer size
Offer expenses
Fees payable to the Book Running Lead Manager >Ɣ@ >Ɣ@ >Ɣ@
Advertising and marketing expenses >Ɣ@ >Ɣ@ >Ɣ@
Fees payable to the Registrar >Ɣ@ >Ɣ@ >Ɣ@
Underwriting commission, fees payable to the Bankers to >Ɣ@ >Ɣ@ >Ɣ@
the Offer, brokerage and selling commission payable to
Registered Brokers, as applicable**
Processing fees to SCSBs for ASBA Applications procured >Ɣ@ >Ɣ@ >Ɣ@
by the members of the Syndicate or Registered Brokers and
submitted with the SCSBs**
Others (listing fees, legal fees, etc.) >Ɣ@ >Ɣ@ >Ɣ@
Total estimated Offer expenses >Ɣ@ >Ɣ@ >Ɣ@
*Will be incorporated at the time of filing of the Prospectus.
** Disclosure of commission and processing fees will be incorporated at the time of filing the Red Herring Prospectus.
All expenses with respect to the Offer will be shared among the Selling Shareholder and our Company, in the
proportion of the Equity Shares being offered by them in this Offer.
The total fees payable to the BRLM and Syndicate Members (including underwriting and selling commissions),
and reimbursement of their out of pocket expenses, will be as stated in the engagement letter with the BRLM
dated September 25, 2014 and the Syndicate Agreement to be executed among our Company, the Selling
Shareholders and the members of the Syndicate, copies of which shall be available for inspection at our
Registered Office, from 10.00 am to 4.00 p.m. on Working Days from the date of filing the Red Herring
Prospectus until the Bid/Offer Closing Date.
The fees payable to the Registrar to the Offer including fees for processing of Bid cum Application Forms, data
entry, printing of Allotment Advice, refund order, preparation of refund data on magnetic tape, printing of bulk
mailing register will be as per the agreement dated September 26, 2014 signed among our Company, the Selling
Shareholders and the Registrar to the Offer, a copy of which shall be made available for inspection at our
Registered Office.
The Registrar to the Offer will be reimbursed for all out-of-pocket expenses including cost of stationery,
postage, stamp duty and communication expenses. Adequate funds will be provided to the Registrar to the Offer
to enable it to send refund orders or Allotment Advice by registered post/speed post (subject to postal rules).
Particulars regarding Public or Rights Issues during the Last Five Years
There have been no public or rights issues undertaken by our Company during the five years preceding the date
of this Draft Red Herring Prospectus.
Since this is the initial public offering of the Equity Shares of our Company, no sum has been paid or has been
payable as commission or brokerage for subscribing to or procuring or agreeing to procure public subscription
for any of our Equity Shares since our incorporation.
418
Previous Issues Otherwise than for Cash
([FHSW DV GLVFORVHG LQ ³Capital Structure´ RQ SDJH 61, our Company has not issued any Equity Shares for
consideration otherwise than for cash.
([FHSWDVGLVFORVHGLQ³Capital Structure´our Company has not made any capital issues during the three years
preceding the date of this Draft Red Herring Prospectus. Our Group Entities have not made any capital issues
during the three years preceding the date of this Draft Red Herring Prospectus.
Our Company has not completed any public or rights issue in the 10 years preceding the date of this Draft Red
Herring Prospectus.
Performance vis- à-vis Objects: Last Issue of Group Entities or Associate Companies
None of our Group Entities have made any public or rights issues in the 10 years preceding the date of this Draft
Red Herring Prospectus.
As on the date of this Draft Red Herring Prospectus, our Company does not have any outstanding debentures,
bonds or redeemable preference shares.
As on the date of this Draft Red Herring Prospectus, there are no partly paid up Equity Shares of our Company.
This being the initial public offering of the Equity Shares of our Company, the Equity Shares of our Company
are not listed on any stock exchange and hence no stock market data is available for our Equity Shares.
The agreement dated September 26, 2014 among the Registrar to the Offer, the Selling Shareholders and our
Company, provides for retention of records with the Registrar to the Offer for a minimum period of three years
from the last date of dispatch of letters of Allotment, demat credit or refund orders to enable the investors to
approach the Registrar to the Offer for redressal of their grievances.
Investors may contact the BRLM for any complaint pertaining to the Offer. All grievances relating to the non-
ASBA process must be addressed to the Registrar to the Offer quoting the full name of the sole or first Bidder,
%LGFXP$SSOLFDWLRQ)RUPQXPEHU%LGGHUV¶'3,'&OLHQW,'3$1QXPEHURI(TXLW\6KDUHVDSSOLHGIRUGDWH
of Bid cum Application Form, name and address of the Syndicate Member or the Registered Broker where the
Bid was submitted and cheque or draft number and issuing bank thereof.
All grievances relating to the ASBA process may be addressed to the Registrar to the Offer, with a copy to the
relevant SCSB or the member of the Syndicate if the Bid was submitted to a member of the Syndicate at any of
the Specified Locations, or the Registered Broker if the Bid was submitted to a Registered Broker at any of the
Broker Centers, as the case may be, quoting the full name of the sole or first Bidder, Bid cum Application Form
QXPEHU%LGGHUV¶'3,' Client ID, PAN, number of Equity Shares applied for, date of Bid cum Application
Form, name and address of the member of the Syndicate or the Designated Branch or the Registered Broker, as
the case may be, where the ASBA Bid was submitted and ASBA Account number in which the amount
equivalent to the Bid Amount was blocked.
419
We estimate that the average time required by our Company or the Registrar to the Offer for the redressal of
routine investor grievances shall be seven Working Days from the date of receipt of the complaint. In case of
non-routine complaints and complaints where external agencies are involved, our Company will seek to redress
these complaints as expeditiously as possible.
Our Company has appointed Rachna Sharma, Company Secretary, as the Compliance Officer and she may be
contacted in case of any pre-Offer or post-Offer related problems, at the following address:
Changes in Auditors
([FHSWDVGLVFORVHGLQ ³Capital Structure´ RQSDJH 61, we have not capitalized our reserves or profits at any
time during the five years preceding the date of this Draft Red Herring Prospectus.
Revaluation of Assets
Our Company has not revalued its assets since its incorporation.
420
SECTION VII ± OFFER RELATED INFORMATION
OFFER STRUCTURE
The Offer of upto 4,000,000 Equity Shares of face value ` 10 each, at an Offer Price of ` >Ɣ@IRUFDVKLQFOXGLQJ
a premium of ` >Ɣ@ SHU (TXLW\ 6KDUH DJJUHJDWLQJ ` >Ɣ@ PLOOLRQ LV EHLQJ PDGH WKURXJK WKH %RRN %XLOGLQJ
Process. The Offer comprises a Fresh Issue of 2,017,478 Equity Shares by our Company and an Offer for Sale
of upto 1,982,522 Equity Shares by the Selling Shareholders. The Offer will constitute 29.28% of the post-Offer
equity share capital of our Company.
Percentage of 50% of the Offer will be available Not less than 15% of the Not less than 35% of the Offer or
Offer size for allocation to QIBs. However, Offer or Offer less the Offer less allocation to QIBs
available for 5% of the QIB Category, excluding allocation to QIBs and and Non-Institutional Investors
allocation the Anchor Investor Portion, will be Retail Individual Investors
available for allocation
proportionately to Mutual Funds
only. Mutual Funds participating in
the 5% reservation portion will also
be eligible for allocation in the
remaining QIB Category. The
unsubscribed portion in the Mutual
Fund portion will be available for
allocation to QIBs
Basis of Proportionate as follows: Proportionate Allotment to each Retail
Allotment if Individual Investor shall not be
respective (a) [Ɣ] Equity Shares will be less than the minimum Bid Lot,
category is available for allocation on a subject to availability of Equity
oversubscribed proportionate basis to Mutual Shares in the Retail Category, and
Funds; and the remaining available Equity
(b) [Ɣ] Equity Shares will be Shares, if any, shall be allotted on
available for allocation on a a proportionate basis. For more
proportionate basis to QIBs information VHH ³Offer
including Mutual Funds receiving Procedure´RQSDJH428.
allocation as per (a) above
Mode of Through ASBA process only Through ASBA process Both the ASBA process and the
Bidding only non-ASBA process are available
to Retail Individual Investors
Minimum Bid Such number of Equity Shares in Such number of Equity >Ɣ@ Equity Shares
multiples of >Ɣ@ Equity Shares so Shares in multiples of >Ɣ@
that the Bid Amount exceeds ` Equity Shares so that the
2,00,000 Bid Amount exceeds `
2,00,000
Maximum Bid Such number of Equity Shares in Such number of Equity Such number of Equity Shares in
PXOWLSOHV RI >Ɣ@ (TXLW\ 6KDUHV VR 6KDUHV LQ PXOWLSOHV RI >Ɣ@ multiples of >Ɣ@ Equity Shares so
that the Bid does not exceed the Equity Shares so that the that the Bid Amount does not
Offer, subject to applicable limits Bid does not exceed the exceed ` 200,000
Offer, subject to applicable
limits
Mode of Compulsorily in dematerialized form
Allotment
Bid Lot >Ɣ@(TXLW\6KDUHVDQGLQPXOWLSOHVRI>Ɣ@(TXLW\6KDUHVWKHUHDIWHU
421
QIBs* Non-Institutional Retail Individual Investors
Investors
Who can Public financial institutions specified Resident Indian individuals,
Resident Indian individuals,
Apply*** in Section 4A of the Companies Act, HUFs (in the name of HUFs (in the name of the Karta)
FPIs (other than category III FPIs), Karta), companies,
and Eligible NRIs applying for
scheduled commercial banks, mutual corporate bodies, Eligible
Equity Shares such that the Bid
funds registered with the SEBI, NRIs, Eligible Amount does not exceed `
QFIs,
venture capital funds registered with scientific institutions
200,000 in value
SEBI, FVCIs, Alternative societies and trusts and any
Investment Funds, multilateral and category III FPIs registered
bilateral development financial with SEBI, which is a
institutions, state industrial foreign corporate or foreign
development corporations, insurance individual for Equity Shares
companies registered with the such that the Bid Amount
Insurance Regulatory and exceeds ` 200,000 in value
Development Authority, provident
funds with a minimum corpus of `
250 million, pension funds with a
minimum corpus of ` 250 million,
the National Investment Fund set up
by resolution F. No. 2/3/2005-DD-II
dated November 23, 2005 of the
GoI, published in the Gazette of
India, insurance funds set up and
managed by the army, navy, or air
force of the Union of India and
insurance funds set up and managed
by the Department of Posts, India
Terms of The entire Bid Amount will be payable at the time of submission of the Bid cum Application Form to the
Payment Syndicate or the Designated Branch or the member of the Syndicate at the Specified Location or the
Registered Broker at the Broker Center, as the case may be. In case of ASBA Bidders, the SCSB will be
authorized to block funds equivalent to the Bid Amount in the relevant ASBA Account as detailed in the
Bid cum Application Form.
* The IPO Committee of our Company may allocate up to 60% of the QIB Category to Anchor Investors at the Anchor Investor Offer Price,
on a discretionary basis, subject to there being (i) a maximum of two Anchor Investors, where allocation in the Anchor Investor Portion is
up to ` 100.00 million, (ii) minimum of two and maximum of 15 Anchor Investors, where the allocation under the Anchor Investor Portion is
more than ` 100.00 million but up to ` 2,500.00 million, subject to a minimum Allotment of ` 50.00 million per Anchor Investor, and (iii)
minimum of five and maximum of 25 Anchor Investors, where the allocation under the Anchor Investor Portion is more than ` 2,500.00
million, subject to a minimum Allotment of ` 50.00 million per Anchor Investor. An Anchor Investor will make a minimum Bid of such
number of Equity Shares, that the Bid Amount is at least ` 100.00 million. One-third of the Anchor Investor Portion will be reserved for
domestic Mutual Funds, subject to valid Bids being received at or above Anchor Investor Offer Price.
**This Offer is being made through the Book Building Process 50% of the Offer will be available for allocation to QIBs on a proportionate
basis, provided that the Anchor Investor Portion may be allocated on a discretionary basis. Further, not less than 15% of the Offer will be
available for allocation on a proportionate basis to Non-Institutional Investors subject to valid Bids being received at or above the Offer
Price. Further, not less than 35% of the Offer will be available for allocation to Retail Individual Investors in accordance with SEBI ICDR
Regulations, subject to valid Bids being received at or above the Offer Price. Under-subscription, if any, in any category, except the QIB
Category, would be met with spill-over from any other category or categories, as applicable, at the discretion of the IPO Committee of our
Company in consultation with the BRLM and the Designated Stock Exchange, on a proportionate basis, subject to applicable laws.
**If the Bid is submitted in joint names, the Bid cum Application Form should contain only the name of the first Bidder whose name should
also appear as the first holder of the depository account held in joint names. The signature of only the first Bidder would be required in the
Bid cum Application Form and such first Bidder would be deemed to have signed on behalf of the joint holders.
Bidders will be required to confirm and will be deemed to have represented to our Company, the Selling Shareholders, the Underwriters,
their respective directors, officers, agents, affiliates and representatives that they are eligible under applicable law, rules, regulations,
guidelines and approvals to acquire the Equity Shares.
Our Company and the Selling Shareholders in consultation with the BRLM, reserves the right not to proceed
with the Offer at any time after the Bid Opening Date but before Allotment. If our Company and the Selling
Shareholders withdraw the Offer, our Company will issue a public notice within two days, providing reasons for
not proceeding with the Offer. The BRLM, through the Registrar to the Offer, will instruct the SCSBs to
unblock the ASBA Accounts within one Working Day from the day of receipt of such instruction. The notice of
withdrawal will be issued in the same newspapers where the pre-Offer advertisements have appeared and the
Stock Exchanges will also be informed promptly.
422
If our Company and the Selling Shareholders withdraw the Offer after the Bid Closing Date and thereafter
determine that they will proceed with a public offering of Equity Shares, they will file a fresh offer document
with SEBI and/or the Stock Exchanges, as the case may be.
Notwithstanding the foregoing, the Offer is also subject to obtaining (i) the final listing and trading approvals of
the Stock Exchanges, which our Company will apply for only after Allotment and within 12 Working Days of
the Bid Closing Date; and (ii) the final RoC approval of the Prospectus after it is filed with the Stock Exchanges.
Bid/Offer Period
This timetable, other than Bid/Offer Opening and Closing Dates, is indicative in nature and does not
constitute any obligation or liability on our Company, the Selling Shareholders or the members of the
Syndicate. While our Company will use best efforts to ensure that listing and trading of our Equity
Shares on the Stock Exchanges commences within 12 Working Days of the Bid/Offer Closing Date, the
timetable may be subject to change for various reasons, including extension of the Bid/Offer Period by
our Company and the Selling Shareholders due to revision of the Price Band or any delays in receipt of
final listing and trading approvals from the Stock Exchanges. The commencement of trading of the
Equity Shares will be entirely at the discretion of the Stock Exchanges in accordance with applicable law.
Except in relation to Anchor Investors, Bids and any revision in Bids will be accepted only between 10.00 a.m.
and 5.00 p.m. (Indian Standard Time) during the Bid/Offer Period at the Bidding centers mentioned in the Bid
cum Application Form, or in the case of ASBA Bidders, at the Designated Branches (a list of such branches is
available at the website of the SEBI at http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-
Intermediaries) or with the members of the Syndicate at the Specified Locations or with the Registered Brokers
at the Broker Centers (a list of such Broker Centers is available at the websites of the Stock Exchanges), as the
case may be, except that on the Bid/Offer Closing Date (which for QIBs is a day prior to the Bid/Offer Closing
Date for non-QIBs), Bids will be accepted only between 10.00 a.m. and 3.00 p.m. (Indian Standard Time) and
uploaded until (i) 4.00 p.m. (Indian Standard Time) by QIBs and Non-Institutional Investors; and (ii) 5.00 p.m.
(Indian Standard Time) in case of Bids by Retail Individual Investors. On the Bid/Offer Closing Date, extension
of time may be granted by the Stock Exchanges only for uploading Bids received from Retail Individual
Investors after taking into account the total number of Bids received up to closure of timings for acceptance of
Bid cum Application Forms as stated herein and reported by the BRLM to the Stock Exchanges. Due to
limitation of time available for uploading Bids on the Bid/Offer Closing Date, Bidders are advised to submit
Bids one day prior to the Bid/Offer Closing Date and, in any case, no later than 1.00 p.m. (Indian Standard
Time) on the Bid/Offer Closing Date. If a large number of Bids are received on the Bid/Offer Closing Date, as is
typically experienced in public issues, which may lead to some Bids not being uploaded due to lack of sufficient
time to upload, such Bids that cannot be uploaded on the electronic bidding system will not be considered for
allocation in the Offer. Our Company, the Selling Shareholders, the members of the Syndicate, the SCSBs and
the Registered Brokers will not be responsible for any failure in uploading Bids due to faults in any
hardware/software system or otherwise. Bids will be accepted only on Working Days.
Our Company and the Selling Shareholders in consultation with the BRLM, reserves the right to revise the Price
Band during the Bid/Offer Period, in accordance with the SEBI ICDR Regulations, provided that the Cap Price
will be less than or equal to 120% of the Floor Price and the Floor Price will not be less than the face value of
the Equity Shares. Subject to compliance with the foregoing, the Floor Price may move up or down to the extent
of 20% of the Floor Price as disclosed at least one Working Day prior to the Bid/Offer Opening Date and the
Cap Price will be revised accordingly.
423
In case of revision in the Price Band, the Bid/Offer Period will be extended for at least three additional
Working Days after revision of Price Band subject to the Bid/Offer Period not exceeding 10 Working
Days. Any revision in the Price Band and the revised Bid/Offer Period, if applicable, will be widely
disseminated by notification to the Stock Exchanges by issuing a press release and by indicating the
change on the website of the members of the Syndicate and by intimation to SCSBs and the Registered
Brokers.
In case of discrepancy in data entered in the electronic book vis-à-vis data contained in the Bid cum Application
Form for a particular Bidder, the details as per the Bid file received from the Stock Exchanges shall be taken as
the final data for the purpose of Allotment.
424
TERMS OF THE OFFER
The Equity Shares issued and allotted in the Offer will be subject to the provisions of the Companies Act, the
SEBI ICDR Regulations, the SCRR, the Memorandum of Association, the Articles of Association, the Equity
Listing Agreements, the terms of the Red Herring Prospectus and the Prospectus, the Bid cum Application
Form, the Revision Form, the abridged prospectus and other terms and conditions as may be incorporated in the
Allotment Advice and other documents and certificates that may be executed in respect of the Offer. The Equity
Shares will also be subject to all applicable laws, guidelines, rules, notifications and regulations relating to the
issue and sale of capital and listing and trading of securities, issued from time to time, by the SEBI, GoI, Stock
Exchanges, the RoC, the RBI and/or other authorities to the extent applicable.
The Equity Shares being issued and allotted in the Offer will be subject to the provisions of the Companies Act,
the Memorandum of Association and the Articles of Association and will rank pari passu with the existing
Equity Shares of our Company, including in respect of dividends and other corporate benefits, if any, declared
by our Company after the date of Allotment. For more information, sHH ³Main Provisions of the Articles of
Association´RQSDJH471.
Our Company will pay dividend, if declared, to our equity shareholders, as per the provisions of the Companies
Act, the Equity Listing Agreements, our Memorandum of Association and Articles of Association, and any
guidelines or directives that may be issued by the GoI in this respect. Any dividends declared, after the date of
Allotment (including pursuant to the transfer of Equity Shares from the Offer for Sale) in this Offer, will be
received by the Allottees. For more information, sHH³Dividend Policy´RQSDJH166.
The face value of each Equity Share is ` 10. At any given point of time there will be only one denomination for
the Equity Shares.
The Price Band and the minimum Bid lot will be decided by our Company and the Selling Shareholders in
consultation with the BRLM, and published by our Company at least five Working Days prior to the Bid/Offer
Opening Date, in >Ɣ@HGLWLRQRI>Ɣ@(a widely circulated English national newspaper) and [Ɣ] edition of [Ɣ] (a
widely circulated Hindi national newspaper), and shall be made available to the Stock Exchanges for the
purpose of uploading on their websites.
Subject to applicable law, the equity shareholders will have the following rights:
For a detailed description of the main provisions of our Articles of Association relating to voting rights,
dividend, forfeituUH OLHQ WUDQVIHU WUDQVPLVVLRQ FRQVROLGDWLRQ DQG VSOLWWLQJ VHH ³Main Provisions of the
Articles of Association´RQSDJH471.
Since trading of our Equity Shares is in dematerialized form, the tradable lot is one Equity Share. Allotment in
the Offer will be only in electronic form in multiples of one Equity Share, subject to a minimum Allotment of
[Ɣ] Equity Shares. )RUWKHPHWKRGRI%DVLVRI$OORWPHQWVHH³Offer Procedure´RQSDJH428.
Joint Holders
Where two or more persons are registered as the holders of any Equity Shares, they will be deemed to hold such
Equity Shares as joint-tenants with benefits of survivorship.
Nomination Facility
In accordance with Section 72 of the Companies Act, 2013, read with Companies (Share Capital and
Debentures) Rules, 2014, the sole or first Bidder, with other joint Bidders, may nominate any one person in
whom, in the event of the death of sole Bidder or in case of joint Bidders, death of all the Bidders, as the case
may be, the Equity Shares Allotted, if any, will vest. A nominee entitled to the Equity Shares by reason of the
death of the original holder(s), will, in accordance with Section 72 of the Companies Act, 2013, be entitled to
the same benefits to which he or she will be entitled if he or she were the registered holder of the Equity Shares.
Where the nominee is a minor, the holder(s) may make a nomination to appoint, in the prescribed manner, any
person to become entitled to Equity Share(s) in the event RIWKHKROGHU¶VGHDWKGXULQJPLQRULW\$QRPLQDWLRQ
may be cancelled, or varied by nominating any other person in place of the present nominee, by the holder of the
Equity Shares who has made the nomination, by giving a notice of such cancellation or variation to our
Company in the prescribed form.
Further, any person who becomes a nominee by virtue of Section 72 of the Companies Act, 2013, will, on the
production of such evidence as may be required by the Board, elect either:
Further, the Board may at any time give notice requiring any nominee to choose either to be registered himself
or herself or to transfer the Equity Shares, and if the notice is not complied with within a period of 90 days, the
Board may thereafter withhold payment of all dividend, interests, bonuses or other monies payable in respect of
the Equity Shares, until the requirements of the notice have been complied with.
Since the Allotment of Equity Shares in the Offer will be made only in dematerialized form, there is no need to
make a separate nomination with our Company. Nominations registered with the respective Depository
Participant of the Bidder will prevail. If Bidders want to change their nomination, they are advised to inform
their respective Depository Participant.
Bid/Offer Period
Minimum Subscription
If our Company does not receive the minimum subscription of 90% of the Fresh Issue, including through the
426
devolvement to the Underwriters, as applicable, our Company shall forthwith refund the entire subscription
amount received no later than 15 days from the Bid/Offer Closing Date, failing which, the directors of our
Company who are officers in default shall jointly and severally be liable to repay that money with interest at the
rate of 15% per annum. Further in terms of Regulation 26(4) of the SEBI ICDR Regulations, our Company will
ensure that the number of Bidders to whom the Equity Shares are Allotted in the Offer will be not less than
1,000.
The requirement for minimum subscription is not applicable to the Offer for Sale.
Except for lock-in of pre-Offer equity shareholding and Anchor Investor lock-in in the Offer, as detailed in
³Capital Structure´ on page 61 DQGDVSURYLGHGLQRXU$UWLFOHVDVGHWDLOHGLQ³Main Provisions of the Articles
of Association´RQSDJH471, there are no restrictions on transfers and transmission of shares/debentures and on
their consolidation/splitting.
Allotment of Equity Shares to successful Bidders will only be in the dematerialized form. Bidders will not have
the option of Allotment of the Equity Shares in physical form. The Equity Shares on Allotment will be traded
only in the dematerialized segment of the Stock Exchanges.
427
OFFER PROCEDURE
All Bidders should review the General Information Document for Investing in Public Issues prepared and issued
in accordance with the circular &,5&)'',/GDWHG2FWREHUQRWLILHGE\ 6(%,³General
Information Document´LQFOXGHGEHORZXQGHUVHFWLRQWLWOHG³± Part B - General Information Document´
which highlights the key rules, processes and procedures applicable to public issues in general in accordance
with the provisions of the Companies Act, the Securities Contracts (Regulation) Act, 1956, the Securities
Contracts (Regulation) Rules, 1957 and the SEBI ICDR Regulations. The General Information Document is also
available on the websites of the Stock Exchanges and the BRLM. Please refer to the relevant portions of the
General Information Document which are applicable to this Offer.
Our Company, the Selling Shareholders and the Syndicate do not accept any responsibility for the completeness
and accuracy of the information stated in this section and the General Information Document. Bidders are
advised to make their independent investigations and ensure that their Bids do not exceed the investment limits
or maximum number of Equity Shares that can be held by them under applicable law or as specified in the Red
Herring Prospectus and the Prospectus.
PART A
The Offer is being made through the Book Building Process where 50% of the Offer will be available for
allocation to QIBs on a proportionate basis, provided that our Company and the Selling Shareholders may
allocate up to 60% of the QIB Category to Anchor Investors at the Anchor Investor Offer Price, on a
discretionary basis, of which at least one-third will be available for allocation to domestic Mutual Funds.
Further, 5% of the QIB Category (excluding the Anchor Investor Portion) will be available for allocation on a
proportionate basis to Mutual Funds only. The remainder will be available for allocation on a proportionate
basis to all QIBs including Mutual Funds, subject to valid Bids being received at or above the Offer Price.
Further, not less than 15% of the Offer will be available for allocation on a proportionate basis to Non-
Institutional Investors subject to valid Bids being received at or above the Offer Price. Further, not less than
35% of the Offer will be available for allocation to Retail Individual Investors in accordance with SEBI ICDR
Regulations, subject to valid Bids being received at or above the Offer Price.
Under-subscription, if any, in any category, except the QIB Category, would be met with spill-over from any
other category or categories, as applicable, at the discretion of our Company and the Selling Shareholders in
consultation with the BRLM and the Designated Stock Exchange, on a proportionate basis, subject to applicable
laws.
There is a common Bid cum Application Form for ASBA Bidders as well as non-ASBA Bidders. Copies of the
Bid cum Application Form will be available with the members of the Syndicate, the Registered Brokers at the
Broker Centers, at our Registered Office and our Corporate Office. The Bid cum Application Forms will also be
available for download on the websites of the Stock Exchanges at least one day prior to the Bid/Offer Opening
Date.
Retail Individual Investors may Bid through the ASBA process at their discretion. However, QIBs (excluding
Anchor Investors) and Non Institutional Investors must compulsorily use the ASBA process to participate in the
Offer. Anchor Investors are not permitted to participate in this Offer through the ASBA process.
ASBA Bidders must provide bank account details in the relevant space provided in the Bid cum Application
Form and the Bid cum Application Form that does not contain such detail are liable to be rejected. In relation to
non-ASBA Bidders, the bank account details shall be available from the depository account.
ASBA Bidders shall ensure that the Bids were submitted at the Bidding centers only on Bid cum Application
Forms bearing the stamp of a member of the Syndicate or the Registered Broker or the SCSB, as the case may
be, (except in case of electronic Bid-cum-Application Forms) and Bid cum Application Forms not bearing such
specified stamp maybe liable for rejection.
428
The prescribed colour of the Bid cum Application Forms for various categories is as follows:
In addition to the category of Bidders VHWIRUWKXQGHU³- General Information Document for Investing in Public
Issues - Category of Investors Eligible to Participate in an Offer´WKHIROORZLQJSHUVRQVDUHDOVR eligible to
invest in the Equity Shares under all applicable laws, regulations and guidelines, including:
(i) Mutual Funds registered with SEBI. Bids by asset management companies or custodians of Mutual
Funds should clearly indicate the name of the concerned scheme for which the Bid is submitted;
(ii) Venture Capital Funds and Alternative Investment Funds registered with SEBI;
(iii) Foreign Venture Capital Investors registered with SEBI;
(iv) Foreign Portfolio Investor registered with SEBI, provided that any QFI or FII who holds a valid
certificate of registration shall be deemed to be an FPI until the expiry of the block of three years for
which fees have been paid as per the Securities and Exchange Board of India (Foreign Institutional
Investors) Regulations, 1995;
(v) State Industrial Development Corporations;
(vi) Scientific and/or industrial research organisations in India, authorised to invest in equity shares;
(vii) Insurance companies registered with IRDA;
(viii) Provident funds and pension funds with a minimum corpus of ` 250 million and who are authorised
under their constitutional documents to hold and invest in equity shares;
(ix) National Investment Fund set up by resolution no. F. No. 2/3/2005-DD-II dated November 23, 2005 of
the GoI published in the Gazette of India;
(x) Insurance funds set up and managed by the army, navy or air force of the Union of India or by the
Department of Posts, India;
(xi) Multilateral and bilateral development financial institutions; and
(xii) Any other person eligible to Bid in the Offer under applicable laws.
Only Bids accompanied by payment in Indian Rupees or freely convertible foreign exchange will be considered
for Allotment.
Eligible NRIs bidding on repatriation basis may make payments by inward remittance in foreign exchange
through normal banking channels or by debits to the Non-5HVLGHQW([WHUQDO³NRE´RU)RUHLJQ&XUUHQF\1RQ
5HVLGHQW%DQN³FCNR´DFFRXQWVPDLQWDLQHGZLWKDXWKRULVHGGHDOHUVUHJLVWHUHGZLWK5%,XQGHUWKH)RUHLJQ
Exchange Management (Foreign Currency Accounts) RegulatiRQV³Authorised Dealer´Eligible NRIs
bidding on repatriation basis are advised to use the Bid cum Application Form for Non-Residents (Blue in
colour), accompanied by a bank certificate confirming that the payment has been made by debiting the NRE or
FCNR account, as the case may be.
Eligible NRIs bidding on non-repatriation basis may make payments by inward remittance in foreign exchange
through normal banking channels or by debits to NRE/FCNR accounts as well as the Non-Resident Ordinary
5XSHH $FFRXQW ³NRO´ Eligible NRIs bidding on non-repatriation basis are advised to use the Bid cum
Application Form for Residents (White in colour).
429
set of ultimate beneficial owner(s) investing through multiple entities) is permitted up to 10% of our post-Offer
Equity Share capital.
Any QFI or FII who holds a valid certificate of registration shall be deemed to be an FPI until the expiry of the
block of three years for which fees have been paid as per the Securities and Exchange Board of India (Foreign
Institutional Investors) Regulations, 1995. An FIIs or a sub-account may, subject to payment of conversion fees
under the SEBI FPI Regulations, participate in this Offer, until the expiry of its registration with SEBI as an FII
or a sub-account, or if it has obtained a certificate of registration as an FPI, whichever is earlier. Further, a QFI
may participate in this Offer until January 6, 2015 (or such date as may be specified by SEBI) or if it has
obtained a certificate of registration as an FPI, whichever is earlier.
In case of Bids made by FPIs, a certified copy of the certificate of registration issued by the designated
depository participant under the FPI Regulations is required to be attached to the Bid cum Application Form,
failing which our Company reserves the right to reject any Bid without assigning any reason. Further, in case of
Bids made by SEBI-registered FIIs or sub-accounts, which are not registered as FPIs, a certified copy of the
certificate of registration as an FII issued by SEBI is required to be attached to the Bid cum Application Form,
failing which our Company reserves the right to reject any Bid without assigning any reason.
In accordance with foreign investment limits applicable to our Company, total foreign investment including FPI
investment may be up to 100% with the approval of our Board and a special resolution of our shareholders,
subject to intimation to RBI. Currently, total foreign investment including FPI investment is not permitted to
exceed 74% of our total issued capital.
FPIs who wish to participate in the Offer are advised to use the Bid cum Application Form for Non-Residents
(blue in colour). FPIs are required to Bid through the ASBA process to participate in the Offer. FPIs can use
special non-resident Rupee accounts to make payments.
Bids by SEBI registered Venture Capital Funds, Alternative Investment Funds and Foreign Venture
Capital Investors
The Securities and Exchange Board of India (Venture Capital Funds) Regulations, 1996 as amended, (the
³SEBI VCF Regulations´) and the Securities and Exchange Board of India (Foreign Venture Capital Investor)
Regulations, 2000, as amended, among other things prescribe the investment restrictions on VCFs and FVCIs
registered with SEBI. Further, the Securities and Exchange Board of India (Alternative Investment Funds)
5HJXODWLRQV WKH ³SEBI AIF Regulations´ SUHVFULEH DPRQJVW RWKHUV WKH LQYHVWPHQW UHVWULFWLRQV RQ
AIFs.
Accordingly, the holding by any individual VCF registered with SEBI in one venture capital undertaking should
not exceed 25% of the corpus of the VCF. Further, VCFs and FVCIs can invest only up to 33.33% of the
investible funds by way of subscription to an initial public offering.
The category I and II AIFs cannot invest more than 25% of the corpus in one investee company. A category III
AIF cannot invest more than 10% of the corpus in one investee company. A venture capital fund registered as a
category I AIF, as defined in the SEBI AIF Regulations, cannot invest more than 1/3 rd of its corpus by way of
subscription to an initial public offering of a venture capital undertaking. Additionally, the VCFs which have not
re-registered as an AIF under the SEBI AIF Regulations shall continue to be regulated by the SEBI VCF
Regulations.
Pre-Offer Advertisement
Subject to Section 30 of the Companies Act, 2013, our Company will, after registering the Red Herring
Prospectus with the RoC, publish a pre-Offer advertisement, in the form prescribed by the SEBI ICDR
Regulations, in LQ>Ɣ@HGLWLRQRI>Ɣ@(a widely circulated English national newspaper) and [Ɣ] edition of [Ɣ] (a
widely circulated Hindi national newspaper).
Payment instructions
430
In terms of the RBI circular (No. DPSS.CO.CHD.No./133/04.07.05/2013-14) dated July 16, 2013, non-CTS
cheques will be processed in three CTS centers thrice a week until April 30, 2014, twice a week until October
31, 2014 and once a week from November 1, 2014 onwards. In order to enable listing and trading of Equity
Shares within 12 Working Days of the Bid/Offer Closing Date, investors are advised to use CTS cheques or use
the ASBA facility to make payment. Investors are cautioned that Bid cum Application Forms accompanied by
non-CTS cheques are liable to be rejected due to any delay in clearing beyond six Working Days from the
Bid/Offer Closing Date.
Payment into Escrow Accounts for Bidders other than ASBA Bidders
The payment instruments for payment into the Escrow Accounts should be drawn in favor of:
Our Company and the Selling Shareholders in consultation with the BRLM, will decide the list of Anchor
Investors to whom the Allotment Advice will be sent, pursuant to which the details of the Equity Shares
allocated to them in their respective names will be notified to such Anchor Investors. The payment instruments
for payment into the Escrow Account(s) for Anchor Investors should be drawn in favor of:
(i) ,QFDVHRIUHVLGHQW$QFKRU,QYHVWRUV³>Ɣ@´
(i) That the complaints received in respect of the Offer shall be attended to by our Company expeditiously
and satisfactorily;
(ii) That all steps will be taken for completion of the necessary formalities for listing and commencement
of trading at all the Stock Exchanges where the Equity Shares are proposed to be listed within 12
Working Days of the Bid/Offer Closing Date;
(iii) That funds required for making refunds to unsuccessful Bidders as per the mode(s) disclosed shall be
made available to the Registrar to the Offer by our Company;
(iv) That where refunds are made through electronic transfer of funds, a suitable communication shall be
sent to the applicant within 12 Working Days from the Bid/ Offer Closing Date, giving details of the
bank where refunds shall be credited along with amount and expected date of electronic credit of
refund;
(v) That the certificates of the securities or refund orders to the Eligible NRIs shall be despatched within
specified time;
(vi) That no further issue of Equity Shares shall be made until the Equity Shares issued in the Fresh Issue
through the Red Herring Prospectus are listed or until the Bid monies are refunded on account of non-
listing, under-subscription etc.;
(vii) That adequate arrangements shall be made to collect all Bid cum Application Forms in relation to
ASBA and to consider them similar to non-ASBA applications while finalizing the basis of allotment;
and
(viii) That our Company shall not have recourse to the Offer Proceeds until the final approval for listing and
trading of the Equity Shares from all the Stock Exchanges where listing is sought has been received.
(ii) The Selling Shareholders will not have recourse to the proceeds of the Offer For Sale, until approval
for trading of the Equity Shares from all Stock Exchanges where listing is sought has been received;
(iii) The Selling Shareholders will not sell, transfer, dispose of in any manner the Equity Shares available in
the Offer for Sale; and
(iv) The Selling Shareholders will take all such steps as may be required to ensure that the Equity Shares
being sold by them in the Offer for Sale are available for transfer in the Offer for Sale.
The Promoters have authorized the Compliance Officer of our Company and the Registrar to the Offer to redress
any complaints received from Bidders in respect of the Offer for Sale.
(i) all monies received from the Fresh Issue shall be transferred to separate bank account other than the
bank account referred to in sub-section (3) of section 40 of the Companies Act, 2013;
(ii) details of all monies utilised out of the Fresh Issue referred to in sub item (i) shall be disclosed and
continue to be disclosed until the time any part of the Offer proceeds remains unutilised, under an
appropriate separate head in the balance-sheet of the Issuer indicating the purpose for which such
monies had been utilised;
(iii) details of all unutilised monies out of the Fresh Issue referred to in sub-item (i) shall be disclosed under
an appropriate separate head in the balance sheet of our Company indicating the form in which such
unutilised monies have been invested;
432
PART B
This General Information Document highlights the key rules, processes and procedures applicable to public
issues in accordance with the provisions of the Companies Act, 2013 (to the extent notified and in effect), the
Companies Act, 1956 (without reference to the provisions thereof that have ceased to have effect upon the
notification of the Companies Act, 2013), the Securities Contracts (Regulation) Act, 1956, the Securities
Contracts (Regulation) Rules, 1957 and the Securities and Exchange Board of India (Issue of Capital and
Disclosure Requirements) Regulations, 2009. Bidders/Applicants should not construe the contents of this
General Information Document as legal advice and should consult their own legal counsel and other advisors in
relation to the legal matters concerning the Issue. For taking an investment decision, the Bidders/Applicants
should rely on their own examination of the Issuer and the Issue, and should carefully read the Red Herring
Prospectus/Prospectus before investing in the Issue.
This document is applicable to the public issues undertaken through the Book-Building process as well as to the
)L[HG 3ULFH ,VVXHV 7KH SXUSRVH RI WKH ³*HQHUDO ,QIRUPDWLRQ 'RFXPHQW IRU ,QYHVWLQJ LQ 3XEOLF ,VVXHV´ LV WR
provide general guidance to potential Bidders/Applicants in IPOs and FPOs, on the processes and procedures
governing IPOs and FPOs, undertaken in accordance with the provisions of the Securities and Exchange Board
RI,QGLD,VVXHRI&DSLWDODQG'LVFORVXUH5HTXLUHPHQWV5HJXODWLRQV³SEBI ICDR Regulations, 2009´
Bidders/Applicants should note that investment in equity and equity related securities involves risk and
Bidder/Applicant should not invest any funds in the Issue unless they can afford to take the risk of losing their
investment. The specific terms relating to securities and/or for subscribing to securities in an Issue and the
relevant information about the Issuer undertaking the Issue are set out in the Red Herring Prospectus ³RHP´/
Prospectus ILOHG E\ WKH ,VVXHU ZLWK WKH 5HJLVWUDU RI &RPSDQLHV ³RoC´ %LGGHUV$SSOLFDQWV VKRXOG FDUHIXOO\
read the entire RHP/Prospectus and the Bid cum Application Form/Application Form and the Abridged
Prospectus of the Issuer in which they are proposing to invest through the Issue. In case of any difference in
interpretation or conflict and/or overlap between the disclosure included in this document and the
RHP/Prospectus, the disclosures in the RHP/Prospectus shall prevail. The RHP/Prospectus of the Issuer is
available on the websites of stock exchanges, on the website(s) of the BRLM(s) to the Issue and on the website
RI6HFXULWLHVDQG([FKDQJH%RDUGRI,QGLD³SEBI´DWwww.sebi.gov.in.
For the definitions of capitalized terms and abbreviations used herein Bidders/Applicants may refer to the
VHFWLRQ³*ORVVDU\DQG$EEUHYLDWLRQV´
An IPO means an offer of specified securities by an unlisted Issuer to the public for subscription and
may include an Offer for Sale of specified securities to the public by any existing holder of such
securities in an unlisted Issuer.
For undertaking an IPO, an Issuer is inter-alia required to comply with the eligibility requirements of
in terms of either Regulation 26(1) or Regulation 26(2) of the SEBI ICDR Regulations, 2009. For
details of compliance with the eligibility requirements by the Issuer Bidders/Applicants may refer to
the RHP/Prospectus.
An FPO means an offer of specified securities by a listed Issuer to the public for subscription and may
include Offer for Sale of specified securities to the public by any existing holder of such securities in a
listed Issuer.
For undertaking an FPO, the Issuer is inter-alia required to comply with the eligibility requirements in
terms of Regulation 26/27 of SEBI ICDR Regulations, 2009. For details of compliance with the
eligibility requirements by the Issuer Bidders/Applicants may refer to the RHP/Prospectus.
433
2.3 Other Eligibility Requirements:
In addition to the eligibility requirements specified in paragraphs 2.1 and 2.2, an Issuer proposing to
undertake an IPO or an FPO is required to comply with various other requirements as specified in the
SEBI ICDR Regulations, 2009, the Companies Act, 2013 (to the extent notified and in effect), the
Companies Act, 1956 (without reference to the provisions thereof that have ceased to have effect upon
the notification of the Companies Act, 2013), the Securities Contracts (Regulation) Rules, 1957 (the
³6&55´LQGXVWU\-specific regulations, if any, and other applicable laws for the time being in force.
For details in relation to the above Bidders/Applicants may refer to the RHP/Prospectus.
2.4 Types of Public Issues ± Fixed Price Issues and Book Built Issues
In accordance with the provisions of the SEBI ICDR Regulations, 2009, an Issuer can either determine
WKH ,VVXH 3ULFH WKURXJK WKH %RRN %XLOGLQJ 3URFHVV ³Book Built Issue´ RU XQGHUWDNH D )L[HG 3ULFH
,VVXH³Fixed Price Issue´$Q,VVXHUPD\PHQWLRQ)ORRU3ULFHRU3ULFH%DQGLQWKH5+3LQFDVHRID
Book Built Issue) and a Price or Price Band in the Draft Prospectus (in case of a fixed price Issue) and
determine the price at a later date before registering the Prospectus with the Registrar of Companies.
The cap on the Price Band should be less than or equal to 120% of the Floor Price. The Issuer shall
announce the Price or the Floor Price or the Price Band through advertisement in all newspapers in
which the pre-issue advertisement was given at least five Working Days before the Bid/Issue Opening
Date, in case of an IPO and at least one Working Day before the Bid/Issue Opening Date, in case of an
FPO.
The Floor Price or the Issue price cannot be lesser than the face value of the securities.
Bidders/Applicants should refer to the RHP/Prospectus or Issue advertisements to check whether the
Issue is a Book Built Issue or a Fixed Price Issue.
The Issue may be kept open for a minimum of three Working Days (for all category of
Bidders/Applicants) and not more than ten Working Days. Bidders/Applicants are advised to refer to
the Bid cum Application Form and Abridged Prospectus or RHP/Prospectus for details of the Bid/Issue
Period. Details of Bid/Issue Period are also available on the website of Stock Exchange(s).
In case of a Book Built Issue, the Issuer may close the Bid/Issue Period for QIBs one Working Day
prior to the Bid/Issue Closing Date if disclosures to that effect are made in the RHP. In case of revision
of the Floor Price or Price Band in Book Built Issues the Bid/Issue Period may be extended by at least
three Working Days, subject to the total Bid/Issue Period not exceeding 10 Working Days. For details
of any revision of the Floor Price or Price Band, Bidders/Applicants may check the announcements
made by the Issuer on the websites of the Stock Exchanges and the BRLM(s), and the advertisement in
the newspaper(s) issued in this regard.
A flow chart of process flow in Fixed Price and Book Built Issues is as follows. Bidders/Applicants
may note that this is not applicable for Fast Track FPOs.:
x In case of Issue other than Book Build Issue (Fixed Price Issue) the process at the following of
the below mentioned steps shall be read as:
434
435
SECTION 3: CATEGORY OF INVESTORS ELIGIBLE TO PARTICIPATE IN AN ISSUE
Each Bidder/Applicant should check whether it is eligible to apply under applicable law. Furthermore, certain
FDWHJRULHVRI%LGGHUV$SSOLFDQWVVXFKDV15,V),,¶V)3,V4),VDQG)9&,VPay not be allowed to Bid/Apply
in the Issue or to hold Equity Shares, in excess of certain limits specified under applicable law.
Bidders/Applicants are requested to refer to the RHP/Prospectus for more details.
x Indian nationals resident in India who are competent to contract under the Indian Contract Act, 1872, in
single or joint names (not more than three);
x Bids/Applications belonging to an account for the benefit of a minor (under guardianship);
x Hindu Undivided Families or HUFs, in the individual name of the Karta. The Bidder/Applicant should
specify that the Bid is being made in the name of the HUF in the Bid cum Application
)RUP$SSOLFDWLRQ )RUP DV IROORZV ³1DPH RI VROH or first Bidder/Applicant: XYZ Hindu Undivided
Family applying through XYZ, where XYZ is the name of the Karta´%LGV$SSOLFDWLRQVE\+8)VPD\
be considered at par with Bids/Applications from individuals;
x Companies, corporate bodies and societies registered under applicable law in India and authorised to
invest in equity shares;
x QIBs;
x NRIs on a repatriation basis or on a non-repatriation basis subject to applicable law;
x Qualified Foreign Investors subject to applicable law;
x Indian Financial Institutions, regional rural banks, co-operative banks (subject to RBI regulations and
the SEBI ICDR Regulations, 2009 and other laws, as applicable);
x FIIs and sub-accounts registered with SEBI, other than a sub-account which is a foreign corporate or
foreign individual, bidding under the QIBs category;
x Sub-accounts of FIIs registered with SEBI, which are foreign corporates or foreign individuals only
under the Non Institutional Investors (NIIs) category;
x FPIs other than Category III foreign portfolio investors bidding under the QIBs category;
x FPIs which are Category III foreign portfolio investors, bidding under the NIIs category;
x Trusts/societies registered under the Societies Registration Act, 1860, or under any other law relating to
trusts/societies and who are authorised under their respective constitutions to hold and invest in equity
shares;
x Limited liability partnerships registered under the Limited Liability Partnership Act, 2008; and
x Any other person eligible to Bid/Apply in the Issue, under the laws, rules, regulations, guidelines and
policies applicable to them and under Indian laws.
x As per the existing regulations, OCBs are not allowed to participate in an Issue.
Book Built Issue: Bidders should only use the specified Bid cum Application Form either bearing the stamp of
a member of the Syndicate or bearing a stamp of the Registered Broker or stamp of SCSBs as available or
downloaded from the websites of the Stock Exchanges.
Bid cum Application Forms are available with the members of the Syndicate, Registered Brokers, Designated
Branches of the SCSBs and at the registered office of the Issuer. Electronic Bid cum Application Forms will be
available on the websites of the Stock Exchanges at least one day prior to the Bid/Issue Opening Date. For
further details regarding availability of Bid cum Application Forms, Bidders may refer to the RHP/Prospectus.
Fixed Price Issue: Applicants should only use the specified cum Application Form either bearing the stamp of
Collection Bank(s) or SCSBs as available or downloaded from the websites of the Stock Exchanges.
Application Forms are available with the Branches of Collection Banks or Designated Branches of the SCSBs
and at the registered office of the Issuer. For further details regarding availability of Application Forms,
Applicants may refer to the Prospectus.
Bidders/Applicants should ensure that they apply in the appropriate category. The prescribed colour of the Bid
436
cum Application Form for various categories of Bidders/Applicants is as follows:
Securities Issued in an IPO can only be in dematerialized form in compliance with Section 29 of the Companies
Act, 2013. Bidders/Applicants will not have the option of getting the allotment of specified securities in physical
form. However, they may get the specified securities rematerialised subsequent to allotment.
4.1 INSTRUCTIONS FOR FILING THE BID CUM APPLICATION FORM/ APPLICATION
FORM
Bidders/Applicants may note that forms not filled completely or correctly as per instructions provided
in this GID, the RHP and the Bid cum Application Form/Application Form are liable to be rejected.
Instructions to fill each field of the Bid cum Application Form can be found on the reverse side of the
Bid cum Application Form. Specific instructions for filling various fields of the Resident Bid cum
Application Form and Non-Resident Bid cum Application Form and samples are provided below.
The samples of the Bid cum Application Form for resident Bidders and the Bid cum Application Form
for non-resident Bidders are reproduced below:
437
438
4.1.1 FIELD NUMBER 1: NAME AND CONTACT DETAILS OF THE SOLE/FIRST
BIDDER/APPLICANT
(a) Bidders/Applicants should ensure that the name provided in this field is exactly the same as
the name in which the Depository Account is held.
439
(b) Mandatory Fields: Bidders/Applicants should note that the name and address fields are
compulsory and e-mail and/or telephone number/mobile number fields are optional.
Bidders/Applicants should note that the contact details mentioned in the Bid-cum Application
Form/Application Form may be used to dispatch communications(including refund orders and
letters notifying the unblocking of the bank accounts of ASBA Bidders/Applicants) in case the
communication sent to the address available with the Depositories are returned undelivered or
are not available. The contact details provided in the Bid cum Application Form may be used
by the Issuer, the members of the Syndicate, the Registered Broker and the Registrar to the
Issue only for correspondence(s) related to an Issue and for no other purposes.
(c) Joint Bids/Applications: In the case of Joint Bids/Applications, the Bids /Applications should
be made in the name of the Bidder/Applicant whose name appears first in the Depository
account. The name so entered should be the same as it appears in the Depository records. The
signature of only such first Bidder/Applicant would be required in the Bid cum Application
Form/Application Form and such first Bidder/Applicant would be deemed to have signed on
behalf of the joint holders All payments may be made out in favor of the Bidder/Applicant
whose name appears in the Bid cum Application Form/Application Form or the Revision
Form and all communications may be addressed to such Bidder/Applicant and may be
dispatched to his or her address as per the Demographic Details received from the
Depositories.
(c) otherwise induces directly or indirectly a company to allot, or register any transfer
of, securities to him, or to any other person in a fictitious name,
The liability prescribed under Section 447 of the Companies Act, 2013 includes imprisonment
for a term which shall not be less than six months extending up to 10 years (provided that
where the fraud involves public interest, such term shall not be less than three years) and fine
of an amount not less than the amount involved in the fraud, extending up to three times of
such amount.
(a) PAN (of the sole/ first Bidder/Applicant) provided in the Bid cum Application
Form/Application Form should be exactly the same as the PAN of the person(s) in whose
QDPHWKHUHOHYDQWEHQHILFLDU\DFFRXQWLVKHOGDVSHUWKH'HSRVLWRULHV¶UHFRUGV
(b) PAN is the sole identification number for participants transacting in the securities market
irrespective of the amount of transaction except for Bids/Applications on behalf of the Central
440
or State Government, Bids/Applications by officials appointed by the courts and
%LGV$SSOLFDWLRQV E\ %LGGHUV$SSOLFDQWV UHVLGLQJ LQ 6LNNLP ³3$1 ([HPSWHG
%LGGHUV$SSOLFDQWV´ &RQVHTXHQWO\ DOO %LGGHUV$SSOLFDQWV RWKHU WKDQ WKH 3$1 ([HPSWHG
Bidders/Applicants, are required to disclose their PAN in the Bid cum Application
Form/Application Form, irrespective of the Bid/Application Amount. A Bid cum Application
Form/Application Form without PAN, except in case of Exempted Bidders/Applicants, is
liable to be rejected. Bids/Applications by the Bidders/Applicants whose PAN is not available
as per the Demographic Details available in their Depository records, are liable to be rejected.
(c) The exemption for the PAN Exempted Bidders/Applicants is subject to (a) the Demographic
Details received from the respective Depositories confirming the exemption granted to the
beneficiary owner by a suitable description in the PAN field and the beneficiary account
UHPDLQLQJLQ³DFWLYHVWDWXV´DQGELQWKHFDVHRIUHVLGHQWVRI6LNNLPWKHDGGUHVVDVSHUWKH
Demographic Details evidencing the same.
(d) Bid cum Application Forms/Application Forms which provide the General Index Register
Number instead of PAN may be rejected.
(e) %LGV$SSOLFDWLRQV E\ %LGGHUV ZKRVH GHPDW DFFRXQWV KDYH EHHQ µVXVSHQGHG IRU FUHGLW¶ DUH
liable to be rejected pursuant to the circular issued by SEBI on July 29, 2010, bearing number
&,505''3 6XFK DFFRXQWV DUH FODVVLILHG DV ³,QDFWLYH GHPDW DFFRXQWV´ DQG
demographic details are not provided by depositories.
(a) Bidders/Applicants should ensure that DP ID and the Client ID are correctly filled in the Bid
cum Application Form/Application Form. The DP ID and Client ID provided in the Bid cum
Application Form/Application Form should match with the DP ID and Client ID available in
the Depository database, otherwise, the Bid cum Application Form/Application Form is
liable to be rejected.
(b) Bidders/Applicants should ensure that the beneficiary account provided in the Bid cum
Application Form/Application Form is active.
(c) Bidders/Applicants should note that on the basis of DP ID and Client ID as provided in the
Bid cum Application Form/Application Form, the Bidder/Applicant may be deemed to have
authorized the Depositories to provide to the Registrar to the Issue, any requested
Demographic Details of the Bidder/Applicant as available on the records of the depositories.
These Demographic Details may be used, among other things, for giving refunds and
allocation advice (including through physical refund warrants, direct credit, NECS, NEFT and
RTGS), or unblocking of ASBA Account or for other correspondence(s) related to an Issue.
Please note that refunds shall be credited only to the bank account from which the Bid
Amount was remitted to the Escrow Bank.
(d) Bidders/Applicants are, advised to update any changes to their Demographic Details as
available in the records of the Depository Participant to ensure accuracy of records. Any delay
UHVXOWLQJIURPIDLOXUHWRXSGDWHWKH'HPRJUDSKLF'HWDLOVZRXOGEHDWWKH%LGGHUV$SSOLFDQWV¶
sole risk.
(a) Price or Floor Price or Price Band, minimum Bid Lot and Discount (if applicable) may be
disclosed in the Prospectus/RHP by the Issuer. The Issuer is required to announce the Floor
Price or Price Band, minimum Bid Lot and Discount (if applicable) by way of an
advertisement in at least one English, one Hindi and one regional newspaper, with wide
circulation, at least five Working Days before Bid/Issue Opening Date in case of an IPO, and
at least one Working Day before Bid/Issue Opening Date in case of an FPO.
441
(b) The Bidders may Bid at or above Floor Price or within the Price Band for IPOs /FPOs
undertaken through the Book Building Process. In the case of Alternate Book Building
Process for an FPO, the Bidders may Bid at Floor Price or any price above the Floor Price
(For further details bidders may refer to (Section 5.6 (e))
(c) Cut-Off Price: Retail Individual Investors or Employees or Retail Individual Shareholders
can Bid at the Cut-off Price indicating their agreement to Bid for and purchase the Equity
Shares at the Issue Price as determined at the end of the Book Building Process. Bidding at the
Cut-off Price is prohibited for QIBs and NIIs and such Bids from QIBs and NIIs may be
rejected.
(d) Minimum Application Value and Bid Lot: The Issuer in consultation with the BRLMs may
decide the minimum number of Equity Shares for each Bid to ensure that the minimum
application value is within the range of Rs. 10,000 to Rs.15,000. The minimum Bid Lot is
accordingly determined by an Issuer on basis of such minimum application value.
(e) Allotment: The allotment of specified securities to each RII shall not be less than the
minimum Bid Lot, subject to availability of shares in the RII category, and the remaining
available shares, if any, shall be allotted on a proportionate basis. For details of the Bid Lot,
bidders may to the RHP/Prospectus or the advertisement regarding the Price Band published
by the Issuer.
(a) The Bidder may Bid for the desired number of Equity Shares at a specific price. Bids by Retail
Individual Investors, Employees and Retail Individual Shareholders must be for such number
of shares so as to ensure that the Bid Amount less Discount (as applicable), payable by the
Bidder does not exceed Rs. 200,000.
In case the Bid Amount exceeds Rs. 200,000 due to revision of the Bid or any other reason,
the Bid may be considered for allocation under the Non-Institutional Category, with it not
being eligible for Discount then such Bid may be rejected if it is at the Cut-off Price.
(b) For NRIs, a Bid Amount of up to Rs. 200,000 may be considered under the Retail Category
for the purposes of allocation and a Bid Amount exceeding ൕ 200,000 may be considered
under the Non-Institutional Category for the purposes of allocation.
(c) Bids by QIBs and NIIs must be for such minimum number of shares such that the Bid Amount
exceeds Rs. 200,000 and in multiples of such number of Equity Shares thereafter, as may be
disclosed in the Bid cum Application Form and the RHP/Prospectus, or as advertised by the
Issuer, as the case may be. Non-,QVWLWXWLRQDO%LGGHUVDQG4,%VDUHQRWDOORZHGWR%LGDWµ&XW-
RII3ULFH¶
(d) RII may revise their bids till closure of the bidding period or withdraw their bids until
ILQDOL]DWLRQ RI DOORWPHQW 4,%V DQG 1,,¶V FDQQRW ZLWKGUDZ RU ORZHU WKHLU %LGV (in terms of
quantity of Equity Shares or the Bid Amount) at any stage after bidding and are required to
pay the Bid Amount upon submission of the Bid.
(e) In case the Bid Amount reduces to Rs. 200,000 or less due to a revision of the Price Band,
Bids by the Non-Institutional Bidders who are eligible for allocation in the Retail Category
would be considered for allocation under the Retail Category.
(f) For Anchor Investors, if applicable, the Bid Amount shall be least Rs.10 crores. One-third of
the Anchor Investor Portion shall be reserved for domestic Mutual Funds, subject to valid
Bids being received from domestic Mutual Funds at or above the price at which allocation is
being done to other Anchor Investors. Bids by various schemes of a Mutual Fund shall be
aggregated to determine the Bid Amount. A Bid cannot be submitted for more than 60% of the
442
QIB Portion under the Anchor Investor Portion. Anchor Investors cannot withdraw their Bids
or lower the size of their Bids (in terms of quantity of Equity Shares or the Bid Amount) at
any stage after the Anchor Investor Bid/ Issue Period and are required to pay the Bid Amount
at the time of submission of the Bid. In case the Anchor Investor Issue Price is lower than the
Issue Price, the balance amount shall be payable as per the pay-in-date mentioned in the
revised CAN. In case the Issue Price is lower than the Anchor Investor Issue Price, the amount
in excess of the Issue Price paid by the Anchor Investors shall not be refunded to them.
(g) A Bid cannot be submitted for more than the Issue size.
(h) The maximum Bid by any Bidder including QIB Bidder should not exceed the investment
limits prescribed for them under the applicable laws.
(i) The price and quantity options submitted by the Bidder in the Bid cum Application Form may
be treated as optional bids from the Bidder and may not be cumulated. After determination of
the Issue Price, the number of Equity Shares Bid for by a Bidder at or above the Issue Price
may be considered for allotment and the rest of the Bid(s), irrespective of the Bid Amount
may automatically become invalid. This is not applicable in case of FPOs undertaken through
Alternate Book Building Process (For details of bidders may refer to (Section 5.6 (e)).
(a) Bidder should submit only one Bid cum Application Form. Bidder shall have the option to
make a maximum of Bids at three different price levels in the Bid cum Application Form and
such options are not considered as multiple Bids.
Submission of a second Bid cum Application Form to either the same or to another member of
the Syndicate, SCSB or Registered Broker and duplicate copies of Bid cum Application Forms
bearing the same application number shall be treated as multiple Bids and are liable to be
rejected.
(b) Bidders are requested to note the following procedures may be followed by the Registrar to
the Issue to detect multiple Bids:
i. All Bids may be checked for common PAN as per the records of the Depository. For
Bidders other than Mutual Funds and FII sub-accounts, Bids bearing the same PAN
may be treated as multiple Bids by a Bidder and may be rejected.
ii. For Bids from Mutual Funds and FII sub-accounts, submitted under the same PAN,
as well as Bids on behalf of the PAN Exempted Bidders, the Bid cum Application
Forms may be checked for common DP ID and Client ID. Such Bids which have the
same DP ID and Client ID may be treated as multiple Bids and are liable to be
rejected.
ii. Separate Bids by Mutual Funds in respect of more than one scheme of the Mutual
Fund provided that the Bids clearly indicate the scheme for which the Bid has been
made.
iii. Bids by Mutual Funds, and sub-accounts of FIIs (or FIIs and its sub-accounts)
submitted with the same PAN but with different beneficiary account numbers, Client
IDs and DP IDs.
iv. Bids by Anchor Investors under the Anchor Investor Portion and the QIB Category.
443
4.1.5 FIELD NUMBER 5 : CATEGORY OF BIDDERS
(a) The categories of Bidders identified as per the SEBI ICDR Regulations, 2009 for the purpose
of Bidding, allocation and allotment in the Issue are RIIs, NIIs and QIBs.
(b) Up to 60% of the QIB Category can be allocated by the Issuer, on a discretionary basis subject
to the criteria of minimum and maximum number of anchor investors based on allocation size,
to the Anchor Investors, in accordance with SEBI ICDR Regulations, 2009, with one-third of
the Anchor Investor Portion reserved for domestic Mutual Funds subject to valid Bids being
received at or above the Issue Price. For details regarding allocation to Anchor Investors,
bidders may refer to the RHP/Prospectus.
(c) An Issuer can make reservation for certain categories of Bidders/Applicants as permitted
under the SEBI ICDR Regulations, 2009. For details of any reservations made in the Issue,
Bidders/Applicants may refer to the RHP/Prospectus.
(d) The SEBI ICDR Regulations, 2009, specify the allocation or allotment that may be made to
various categories of Bidders in an Issue depending upon compliance with the eligibility
conditions. Details pertaining to allocation are disclosed on reverse side of the Revision Form.
For Issue specific details in relation to allocation Bidder/Applicant may refer to the
RHP/Prospectus.
(a) Each Bidder/Applicant should check whether it is eligible to apply under applicable law and
ensure that any prospective allotment to it in the Issue is in compliance with the investment
restrictions under applicable law.
(b) Certain categories of Bidders/Applicants, such as NRIs, FIIs, FPIs, QFIs and FVCIs may not
be allowed to Bid/Apply in the Issue or hold Equity Shares exceeding certain limits specified
under applicable law. Bidders/Applicants are requested to refer to the RHP/Prospectus for
more details.
(c) Bidders/Applicants should check whether they are eligible to apply on non-repatriation basis
or repatriation basis and should accordingly provide the investor status. Details regarding
investor status are different in the Resident Bid cum Application Form and Non-Resident Bid
cum Application Form.
(d) Bidders/Applicants should ensure that their investor status is updated in the Depository
records.
(a) All Bidders are required to make payment of the full Bid Amount (net of any Discount, as
applicable) along-with the Bid cum Application Form. If the Discount is applicable in the
Issue, the RIIs should indicate the full Bid Amount in the Bid cum Application Form and the
payment shall be made for Bid Amount net of Discount. Only in cases where the
RHP/Prospectus indicates that part payment may be made, such an option can be exercised by
the Bidder. In case of Bidders specifying more than one Bid Option in the Bid cum
Application Form, the total Bid Amount may be calculated for the highest of three options at
net price, i.e. Bid price less Discount offered, if any.
(b) Bidders who Bid at Cut-off price shall deposit the Bid Amount based on the Cap Price.
(c) QIBs and NIIs can participate in the Issue only through the ASBA mechanism.
(d) RIIs and/or Reserved Categories bidding in their respective reservation portion can Bid, either
through the ASBA mechanism or by paying the Bid Amount through a cheque or a demand
444
GUDIW³1RQ-$6%$0HFKDQLVP´
(e) Bid Amount cannot be paid in cash, through money order or through postal order.
(a) Non-ASBA Bidders may submit their Bids with a member of the Syndicate or any of the
Registered Brokers of the Stock Exchange. The details of Broker Centres along with names
and contact details of the Registered Brokers are provided on the websites of the Stock
Exchanges.
(b) For Bids made through a member of the Syndicate: The Bidder may, with the submission
of the Bid cum Application Form, draw a cheque or demand draft for the Bid Amount in
favour of the Escrow Account as specified under the RHP/Prospectus and the Bid cum
Application Form and submit the same to the members of the Syndicate at Specified
Locations.
(c) For Bids made through a Registered Broker: The Bidder may, with the submission of the
Bid cum Application Form, draw a cheque or demand draft for the Bid Amount in favour of
the Escrow Account as specified under the RHP/Prospectus and the Bid cum Application
Form and submit the same to the Registered Broker.
(d) If the cheque or demand draft accompanying the Bid cum Application Form is not made
favoring the Escrow Account, the Bid is liable to be rejected.
(e) Payments should be made by cheque, or demand draft drawn on any bank (including a co-
operative bank), which is situated at, and is a member of or sub-PHPEHU RI WKH EDQNHUV¶
clearing house located at the centre where the Bid cum Application Form is submitted.
Cheques/bank drafts drawn on banks not participating in the clearing process may not be
accepted and applications accompanied by such cheques or bank drafts are liable to be
rejected.
(f) The Escrow Collection Banks shall maintain the monies in the Escrow Account for and on
behalf of the Bidders until the Designated Date.
(g) Bidders are advised to provide the number of the Bid cum Application Form and PAN on the
reverse of the cheque or bank draft to avoid any possible misuse of instruments submitted.
(a) ASBA Bidders may submit the Bid cum Application Form either
ii. in electronic mode through the internet banking facility offered by an SCSB
authorizing blocking of funds that are available in the ASBA account specified in the
Bid cum Application Form, or
(b) ASBA Bidders may specify the Bank Account number in the Bid cum Application Form. The
Bid cum Application Form submitted by an ASBA Bidder and which is accompanied by cash,
demand draft, money order, postal order or any mode of payment other than blocked amounts
in the ASBA Account maintained with an SCSB, may not be accepted.
445
(c) Bidders should ensure that the Bid cum Application Form is also signed by the ASBA
Account holder(s) if the Bidder is not the ASBA Account holder;
(d) Bidders shall note that for the purpose of blocking funds under ASBA facility clearly
demarcated funds shall be available in the account.
(e) From one ASBA Account, a maximum of five Bids cum Application Forms can be submitted.
(f) ASBA Bidders bidding through a member of the Syndicate should ensure that the Bid cum
Application Form is submitted to a member of the Syndicate only at the Specified locations.
ASBA Bidders should also note that Bid cum Application Forms submitted to a member of
the Syndicate at the Specified locations may not be accepted by the Member of the Syndicate
if the SCSB where the ASBA Account, as specified in the Bid cum Application Form, is
maintained has not named at least one branch at that location for the members of the Syndicate
to deposit Bid cum Application Forms (a list of such branches is available on the website of
SEBI at http://www.sebi.gov.in/sebiweb/home/list/5/33/0/0/Recognised-Intermediaries).
(g) ASBA Bidders bidding through a Registered Broker should note that Bid cum Application
Forms submitted to the Registered Brokers may not be accepted by the Registered Broker, if
the SCSB where the ASBA Account, as specified in the Bid cum Application Form, is
maintained has not named at least one branch at that location for the Registered Brokers to
deposit Bid cum Application Forms.
(h) ASBA Bidders bidding directly through the SCSBs should ensure that the Bid cum
Application Form is submitted to a Designated Branch of a SCSB where the ASBA Account
is maintained.
(i) Upon receipt of the Bid cum Application Form, the Designated Branch of the SCSB may
verify if sufficient funds equal to the Bid Amount are available in the ASBA Account, as
mentioned in the Bid cum Application Form.
(j) If sufficient funds are available in the ASBA Account, the SCSB may block an amount
equivalent to the Bid Amount mentioned in the Bid cum Application Form and for application
directly submitted to SCSB by investor, may enter each Bid option into the electronic bidding
system as a separate Bid.
(k) If sufficient funds are not available in the ASBA Account, the Designated Branch of the SCSB
may not upload such Bids on the Stock Exchange platform and such bids are liable to be
rejected.
(l) Upon submission of a completed Bid cum Application Form each ASBA Bidder may be
deemed to have agreed to block the entire Bid Amount and authorized the Designated Branch
of the SCSB to block the Bid Amount specified in the Bid cum Application Form in the
ASBA Account maintained with the SCSBs.
(m) The Bid Amount may remain blocked in the aforesaid ASBA Account until finalisation of the
Basis of allotment and consequent transfer of the Bid Amount against the Allotted Equity
Shares to the Public Issue Account, or until withdrawal or failure of the Issue, or until
withdrawal or rejection of the Bid, as the case may be.
(n) SCSBs bidding in the Issue must apply through an Account maintained with any other SCSB;
else their Bids are liable to be rejected.
(a) Once the Basis of Allotment is approved by the Designated Stock Exchange, the Registrar to
the Issue may provide the following details to the controlling branches of each SCSB, along
with instructions to unblock the relevant bank accounts and for successful applications transfer
446
the requisite money to the Public Issue Account designated for this purpose, within the
specified timelines: (i) the number of Equity Shares to be Allotted against each Bid, (ii) the
amount to be transferred from the relevant bank account to the Public Issue Account, for each
Bid, (iii) the date by which funds referred to in (ii) above may be transferred to the Public
Issue Account, and (iv) details of rejected ASBA Bids, if any, along with reasons for rejection
and details of withdrawn or unsuccessful Bids, if any, to enable the SCSBs to unblock the
respective bank accounts.
(b) On the basis of instructions from the Registrar to the Issue, the SCSBs may transfer the
requisite amount against each successful ASBA Bidder to the Public Issue Account and may
unblock the excess amount, if any, in the ASBA Account.
(c) In the event of withdrawal or rejection of the Bid cum Application Form and for unsuccessful
Bids, the Registrar to the Issue may give instructions to the SCSB to unblock the Bid Amount
in the relevant ASBA Account within 12 Working Days of the Bid/Issue Closing Date.
The Non-Resident Indians who intend to make payment through Non-Resident Ordinary (NRO)
accounts shall use the form meant for Resident Indians (non-repatriation basis). In the case of Bids by
NRIs applying on a repatriation basis, payment shall not be accepted out of NRO Account.
(b) Bidders applying under RII category, Retail Individual Shareholder and employees are only
eligible for discount. For Discounts offered in the Issue, Bidders may refer to the
RHP/Prospectus.
(c) The Bidders entitled to the applicable Discount in the Issue may make payment for an amount
i.e. the Bid Amount less Discount (if applicable).
Bidder may note that in case the net payment (post Discount) is more than two lakh Rupees, the
bidding system automatically considers such applications for allocation under Non-Institutional
Category. These applications are neither eligible for Discount nor fall under RII category.
(a) Only the First Bidder/Applicant is required to sign the Bid cum Application Form/Application
Form. Bidders/Applicants should ensure that signatures are in one of the languages specified
in the Eighth Schedule to the Constitution of India.
(b) If the ASBA Account is held by a person or persons other than the ASBA Bidder/Applicant.,
then the Signature of the ASBA Account holder(s) is also required.
(c) In relation to the ASBA Bids/Applications, signature has to be correctly affixed in the
authorization/undertaking box in the Bid cum Application Form/Application Form, or an
authorisation has to be provided to the SCSB via the electronic mode, for blocking funds in
the ASBA Account equivalent to the Bid Amount mentioned in the Bid cum Application
Form/Application Form.
(d) Bidders/Applicants must note that Bid cum Application Form/Application Form without
signature of Bidder/Applicant and /or ASBA Account holder is liable to be rejected.
(a) Bidders should ensure that they receive the acknowledgment duly signed and stamped by a
447
member of the Syndicate, Registered Broker or SCSB, as applicable, for submission of the
Bid cum Application Form.
(b) Applicants should ensure that they receive the acknowledgment duly signed and stamped by
an Escrow Collection Bank or SCSB, as applicable, for submission of the Application Form.
(c) All communications in connection with Bids/Applications made in the Issue should be
addressed as under:
ii. In case of ASBA Bids submitted to the Designated Branches of the SCSBs, the
Bidders/Applicants should contact the relevant Designated Branch of the SCSB.
(d) The following details (as applicable) should be quoted while making any queries ±
i. full name of the sole or First Bidder/Applicant, Bid cum Application Form number,
$SSOLFDQWV¶%LGGHUV¶'3,'&OLHQW,'3$1QXPEHURI(TXLW\6KDUHVDSSOLHGIRU
amount paid on application.
ii. name and address of the member of the Syndicate, Registered Broker or the
Designated Branch, as the case may be, where the Bid was submitted or
iii. In case of Non-ASBA bids cheque or draft number and the name of the issuing bank
thereof
iv. In case of ASBA Bids, ASBA Account number in which the amount equivalent to
the Bid Amount was blocked.
For further details, Bidder/Applicant may refer to the RHP/Prospectus and the Bid cum Application
Form.
(a) During the Bid/Issue Period, any Bidder/Applicant (other than QIBs and NIIs, who can only
revise their bid upwards) who has registered his or her interest in the Equity Shares at a
particular price level is free to revise his or her Bid within the Price Band using the Revision
Form, which is a part of the Bid cum Application Form.
(b) RII may revise their bids till closure of the bidding period or withdraw their bids until
finalization of allotment.
(c) Revisions can be made in both the desired number of Equity Shares and the Bid Amount by
using the Revision Form.
(d) The Bidder/Applicant can make this revision any number of times during the Bid/ Issue
Period. However, for any revision(s) in the Bid, the Bidders/Applicants will have to use the
448
services of the same member of the Syndicate, the Registered Broker or the SCSB through
which such Bidder/Applicant had placed the original Bid. Bidders/Applicants are advised to
retain copies of the blank Revision Form and the Bid(s) must be made only in such Revision
Form or copies thereof.
449
Instructions to fill each field of the Revision Form can be found on the reverse side of the Revision
Form. Other than instructions already highlighted at paragraph 4.1 above, point wise instructions
regarding filling up various fields of the Revision Form are provided below:
Bidders/Applicants should refer to instructions contained in paragraphs 4.1.1, 4.1.2 and 4.1.3.
(a) Apart from mentioning the revised options in the Revision Form, the Bidder/Applicant must
also mention the details of all the bid options given in his or her Bid cum Application Form or
earlier Revision Form. For example, if a Bidder/Applicant has Bid for three options in the Bid
cum Application Form and such Bidder/Applicant is changing only one of the options in the
Revision Form, the Bidder/Applicant must still fill the details of the other two options that are
not being revised, in the Revision Form. The members of the Syndicate, the Registered
Brokers and the Designated Branches of the SCSBs may not accept incomplete or inaccurate
Revision Forms.
(b) In case of revision, Bid options should be provided by Bidders/Applicants in the same order as
provided in the Bid cum Application Form.
(c) In case of revision of Bids by RIIs, Employees and Retail Individual Shareholders, such
Bidders/Applicants should ensure that the Bid Amount, subsequent to revision, does not
exceed Rs. 200,000. In case the Bid Amount exceeds Rs. 200,000 due to revision of the Bid or
for any other reason, the Bid may be considered, subject to eligibility, for allocation under the
Non-Institutional Category, not being eligible for Discount (if applicable) and such Bid may
be rejected if it is at the Cut-off Price. The Cut-off Price option is given only to the RIIs,
Employees and Retail Individual Shareholders indicating their agreement to Bid for and
purchase the Equity Shares at the Issue Price as determined at the end of the Book Building
Process.
(d) In case the total amount (i.e., original Bid Amount plus additional payment) exceeds Rs.
200,000, the Bid will be considered for allocation under the Non-Institutional Portion in terms
of the RHP/Prospectus. If, however, the RII does not either revise the Bid or make additional
payment and the Issue Price is higher than the cap of the Price Band prior to revision, the
number of Equity Shares Bid for shall be adjusted downwards for the purpose of allocation,
such that no additional payment would be required from the RII and the RII is deemed to have
approved such revised Bid at Cut-off Price.
(e) In case of a downward revision in the Price Band, RIIs and Bids by Employees under the
Reservation Portion, who have bid at the Cut-off Price could either revise their Bid or the
excess amount paid at the time of bidding may be unblocked in case of ASBA Bidders or
refunded from the Escrow Account in case of non-ASBA Bidder.
(a) With respect to the Bids, other than Bids submitted by ASBA Bidders/Applicants, any
revision of the Bid should be accompanied by payment in the form of cheque or demand draft
for the amount, if any, to be paid on account of the upward revision of the Bid.
(b) All Bidders/Applicants are required to make payment of the full Bid Amount (less Discount
(if applicable) along with the Bid Revision Form. In case of Bidders/Applicants specifying
more than one Bid Option in the Bid cum Application Form, the total Bid Amount may be
calculated for the highest of three options at net price, i.e. Bid price less discount offered, if
450
any.
(d) In case of Bids, other than ASBA Bids, Bidder/Applicant, may make additional payment
based on the cap of the revised Price Band (such that the total amount i.e., original Bid
Amount plus additional payment does not exceed Rs. 200,000 if the Bidder/Applicant wants
to continue to Bid at the Cut-off Price), with the members of the Syndicate / Registered
Broker to whom the original Bid was submitted.
(e) In case the total amount (i.e., original Bid Amount less discount (if applicable) plus additional
payment) exceeds Rs. 200,000, the Bid may be considered for allocation under the Non-
Institutional Category in terms of the RHP/Prospectus. If, however, the Bidder/Applicant does
not either revise the Bid or make additional payment and the Issue Price is higher than the cap
of the Price Band prior to revision, the number of Equity Shares Bid for may be adjusted
downwards for the purpose of allotment, such that no additional payment is required from the
Bidder/Applicant and the Bidder/Applicant is deemed to have approved such revised Bid at
the Cut-off Price.
(f) In case of a downward revision in the Price Band, RIIs, Employees and Retail Individual
Shareholders, who have bid at the Cut-off Price, could either revise their Bid or the excess
amount paid at the time of bidding may be unblocked in case of ASBA Bidders/Applicants or
refunded from the Escrow Account in case of non-ASBA Bidder/Applicant.
Bidders/Applicants may refer to instructions contained at paragraphs 4.1.8 and 4.1.9 for this purpose.
4.3 INSTRUCTIONS FOR FILING APPLICATION FORM IN ISSUES MADE OTHER THAN
THROUGH THE BOOK BUILDING PROCESS (FIXED PRICE ISSUE)
Applicants should refer to instructions contained in paragraphs 4.1.1, 4.1.2 and 4.1.3.
(a) The Issuer may mention Price or Price band in the draft Prospectus. However a prospectus
registered with RoC contains one price or coupon rate (as applicable).
(b) Minimum Application Value and Bid Lot: The Issuer in consultation with the Lead
Manager to the Issue (LM) may decide the minimum number of Equity Shares for each Bid to
ensure that the minimum application value is within the range of Rs. 10,000 to Rs.15,000. The
minimum Lot size is accordingly determined by an Issuer on basis of such minimum
application value.
(c) Applications by RIIs, Employees and Retail Individual Shareholders, must be for such number
of shares so as to ensure that the application amount payable does not exceed Rs. 200,000.
(d) Applications by other investors must be for such minimum number of shares such that the
application amount exceeds Rs. 200,000 and in multiples of such number of Equity Shares
451
thereafter, as may be disclosed in the application form and the Prospectus, or as advertised by
the Issuer, as the case may be.
(e) An application cannot be submitted for more than the Issue size.
(f) The maximum application by any Applicant should not exceed the investment limits
prescribed for them under the applicable laws.
(g) Multiple Applications: An Applicant should submit only one Application Form. Submission
of a second Application Form to either the same or to Collection Bank(s) or SCSB and
duplicate copies of Application Forms bearing the same application number shall be treated as
multiple applications and are liable to be rejected.
(h) Applicants are requested to note the following procedures may be followed by the Registrar to
the Issue to detect multiple applications:
i. All applications may be checked for common PAN as per the records of the
Depository. For Applicants other than Mutual Funds and FII sub-accounts, Bids
bearing the same PAN may be treated as multiple applications by a Bidder/Applicant
and may be rejected.
ii. For applications from Mutual Funds and FII sub-accounts, submitted under the
same PAN, as well as Bids on behalf of the PAN Exempted Applicants, the
Application Forms may be checked for common DP ID and Client ID. In any such
applications which have the same DP ID and Client ID, these may be treated as
multiple applications and may be rejected.
ii. Separate applications by Mutual Funds in respect of more than one scheme of the
Mutual Fund provided that the Applications clearly indicate the scheme for which the
Bid has been made.
iii. Applications by Mutual Funds, and sub-accounts of FIIs (or FIIs and its sub-
accounts) submitted with the same PAN but with different beneficiary account
numbers, Client IDs and DP IDs.
(a) The categories of applicants identified as per the SEBI ICDR Regulations, 2009 for the
purpose of Bidding, allocation and allotment in the Issue are RIIs, individual applicants other
WKDQ 5,,¶V DQG RWKHU LQYHVWRUV LQFOXGLQJ FRUSRUDWH ERGLHV RU LQVWLWXWLRQV LUUHVSHFWLYH RI WKH
number of specified securities applied for).
(b) An Issuer can make reservation for certain categories of Applicants permitted under the SEBI
ICDR Regulations, 2009. For details of any reservations made in the Issue, applicants may
refer to the Prospectus.
(c) The SEBI ICDR Regulations, 2009 specify the allocation or allotment that may be made to
various categories of applicants in an Issue depending upon compliance with the eligibility
conditions. Details pertaining to allocation are disclosed on reverse side of the Revision Form.
For Issue specific details in relation to allocation applicant may refer to the Prospectus.
452
Applicants should refer to instructions contained in paragraphs 4.1.6.
(a) All Applicants are required to make payment of the full Amount (net of any Discount, as
applicable) along-with the Application Form. If the Discount is applicable in the Issue, the
RIIs should indicate the full Amount in the Application Form and the payment shall be made
for an Amount net of Discount. Only in cases where the Prospectus indicates that part
payment may be made, such an option can be exercised by the Applicant.
(b) RIIs and/or Reserved Categories bidding in their respective reservation portion can Bid, either
through the ASBA mechanism or by paying the Bid Amount through a cheque or a demand
GUDIW³1RQ-AS%$0HFKDQLVP´
(c) Application Amount cannot be paid in cash, through money order or through postal order or
through stock invest.
(a) Non-ASBA Applicants may submit their Application Form with the Collection Bank(s).
(b) For Applications made through a Collection Bank(s): The Applicant may, with the submission
of the Application Form, draw a cheque or demand draft for the Bid Amount in favor of the
Escrow Account as specified under the Prospectus and the Application Form and submit the
same to the escrow Collection Bank(s).
(c) If the cheque or demand draft accompanying the Application Form is not made favoring the
Escrow Account, the form is liable to be rejected.
(d) Payments should be made by cheque, or demand draft drawn on any bank (including a co-
operative bank), which is situated at, and is a member of or sub-PHPEHU RI WKH EDQNHUV¶
clearing house located at the centre where the Application Form is submitted. Cheques/bank
drafts drawn on banks not participating in the clearing process may not be accepted and
applications accompanied by such cheques or bank drafts are liable to be rejected.
(e) The Escrow Collection Banks shall maintain the monies in the Escrow Account for and on
behalf of the Applicants until the Designated Date.
(f) Applicants are advised to provide the number of the Application Form and PAN on the
reverse of the cheque or bank draft to avoid any possible misuse of instruments submitted.
(a) ASBA Applicants may submit the Application Form in physical mode to the Designated
Branch of an SCSB where the Applicants have ASBA Account.
(b) ASBA Applicants may specify the Bank Account number in the Application Form. The
Application Form submitted by an ASBA Applicant and which is accompanied by cash,
demand draft, money order, postal order or any mode of payment other than blocked amounts
in the ASBA Account maintained with an SCSB, may not be accepted.
(c) Applicants should ensure that the Application Form is also signed by the ASBA Account
holder(s) if the Applicant is not the ASBA Account holder;
(d) Applicants shall note that for the purpose of blocking funds under ASBA facility clearly
demarcated funds shall be available in the account.
(e) From one ASBA Account, a maximum of five Bids cum Application Forms can be submitted.
453
(f) ASBA Applicants bidding directly through the SCSBs should ensure that the Application
Form is submitted to a Designated Branch of a SCSB where the ASBA Account is maintained.
(g) Upon receipt of the Application Form, the Designated Branch of the SCSB may verify if
sufficient funds equal to the Application Amount are available in the ASBA Account, as
mentioned in the Application Form.
(h) If sufficient funds are available in the ASBA Account, the SCSB may block an amount
equivalent to the Application Amount mentioned in the Application Form and may upload the
details on the Stock Exchange Platform.
(i) If sufficient funds are not available in the ASBA Account, the Designated Branch of the SCSB
may not upload such Applications on the Stock Exchange platform and such Applications are
liable to be rejected.
(j) Upon submission of a completed Application Form each ASBA Applicant may be deemed to
have agreed to block the entire Application Amount and authorized the Designated Branch of
the SCSB to block the Application Amount specified in the Application Form in the ASBA
Account maintained with the SCSBs.
(k) The Application Amount may remain blocked in the aforesaid ASBA Account until
finalisation of the Basis of allotment and consequent transfer of the Application Amount
against the Allotted Equity Shares to the Public Issue Account, or until withdrawal or failure
of the Issue, or until withdrawal or rejection of the Application, as the case may be.
(l) SCSBs applying in the Issue must apply through an ASBA Account maintained with any other
SCSB; else their Applications are liable to be rejected.
(a) Once the Basis of Allotment is approved by the Designated Stock Exchange, the Registrar to
the Issue may provide the following details to the controlling branches of each SCSB, along
with instructions to unblock the relevant bank accounts and for successful applications transfer
the requisite money to the Public Issue Account designated for this purpose, within the
specified timelines: (i) the number of Equity Shares to be Allotted against each Application,
(ii) the amount to be transferred from the relevant bank account to the Public Issue Account,
for each Application, (iii) the date by which funds referred to in (ii) above may be transferred
to the Public Issue Account, and (iv) details of rejected ASBA Applications, if any, along with
reasons for rejection and details of withdrawn or unsuccessful Applications, if any, to enable
the SCSBs to unblock the respective bank accounts.
(b) On the basis of instructions from the Registrar to the Issue, the SCSBs may transfer the
requisite amount against each successful ASBA Application to the Public Issue Account and
may unblock the excess amount, if any, in the ASBA Account.
(c) In the event of withdrawal or rejection of the Application Form and for unsuccessful
Applications, the Registrar to the Issue may give instructions to the SCSB to unblock the
Application Amount in the relevant ASBA Account within 12 Working Days of the Issue
Closing Date.
(b) RIIs, Employees and Retail Individual Shareholders are only eligible for discount. For
Discounts offered in the Issue, applicants may refer to the Prospectus.
(c) The Applicants entitled to the applicable Discount in the Issue may make payment for an
454
amount i.e. the Application Amount less Discount (if applicable).
4.4.1 Bidders/Applicants may submit completed Bid-cum-application form / Revision Form in the
following manner:-
(a) Bidders/Applicants should not submit the bid cum application forms/ Revision Form directly
to the escrow collection banks. Bid cum Application Form/ Revision Form submitted to the
escrow collection banks are liable for rejection.
(b) Bidders/Applicants should submit the Revision Form to the same member of the Syndicate,
the Registered Broker or the SCSB through which such Bidder/Applicant had placed the
original Bid.
(c) Upon submission of the Bid-cum-Application Form, the Bidder/Applicant will be deemed to
have authorized the Issuer to make the necessary changes in the RHP and the Bid cum
Application Form as would be required for filing Prospectus with the Registrar of Companies
(RoC) and as would be required by the RoC after such filing, without prior or subsequent
notice of such changes to the relevant Bidder/Applicant.
(d) Upon determination of the Issue Price and filing of the Prospectus with the RoC, the Bid-cum-
Application Form will be considered as the application form.
Book Building, in the context of the Issue, refers to the process of collection of Bids within the Price Band or
above the Floor Price and determining the Issue Price based on the Bids received as detailed in Schedule XI of
SEBI ICDR Regulations, 2009. The Issue Price is finalised after the Bid/Issue Closing Date. Valid Bids received
at or above the Issue Price are considered for allocation in the Issue, subject to applicable regulations and other
terms and conditions.
(a) During the Bid/Issue Period, ASBA Bidders/Applicants may approach the members of the
Syndicate at the Specified Cities or any of the Registered Brokers or the Designated Branches
to register their Bids. Non-ASBA Bidders/Applicants who are interested in subscribing for the
Equity Shares should approach the members of the Syndicate or any of the Registered
Brokers, to register their Bid.
(b) Non-ASBA Bidders/Applicants (RIIs, Employees and Retail Individual Shareholders) bidding
at Cut-off Price may submit the Bid cum Application Form along with a cheque/demand draft
455
for the Bid Amount less discount (if applicable) based on the Cap Price with the members of
the Syndicate/ any of the Registered Brokers to register their Bid.
(c) In case of ASBA Bidders/Applicants (excluding NIIs and QIBs) bidding at Cut-off Price, the
ASBA Bidders/Applicants may instruct the SCSBs to block Bid Amount based on the Cap
Price less discount (if applicable). ASBA Bidders/Applicants may approach the members of
the Syndicate or any of the Registered Brokers or the Designated Branches to register their
Bids.
(d) For Details of the timing on acceptance and upload of Bids in the Stock Exchanges Platform
Bidders/Applicants are requested to refer to the RHP.
(a) The Syndicate, the Registered Brokers and the SCSBs may register the Bids using the on-line
facilities of the Stock Exchanges. The Syndicate, the Registered Brokers and the Designated
Branches of the SCSBs can also set up facilities for off-line electronic registration of Bids,
subject to the condition that they may subsequently upload the off-line data file into the on-
line facilities for Book Building on a regular basis before the closure of the issue.
(b) On the Bid/Issue Closing Date, the Syndicate, the Registered Broker and the Designated
Branches of the SCSBs may upload the Bids till such time as may be permitted by the Stock
Exchanges.
(c) Only Bids that are uploaded on the Stock Exchanges Platform are considered for allocation/
Allotment. The members of the Syndicate, the Registered Brokers and the SCSBs are given up
to one day after the Bid/Issue Closing Date to modify select fields uploaded in the Stock
Exchange Platform during the Bid/Issue Period after which the Stock Exchange(s) send the
bid information to the Registrar for validation of the electronic bid details with the
'HSRVLWRU\¶VUHFRUGV
(a) Bids received from various Bidders/Applicants through the Syndicate, Registered Brokers and
WKH6&6%VPD\EHHOHFWURQLFDOO\XSORDGHGRQWKH%LGGLQJ3ODWIRUPRIWKH6WRFN([FKDQJHV¶
on a regular basis. The book gets built up at various price levels. This information may be
available with the BRLMs at the end of the Bid/Issue Period.
(b) Based on the aggregate demand and price for Bids registered on the Stock Exchanges
Platform, a graphical representation of consolidated demand and price as available on the
websites of the Stock Exchanges may be made available at the bidding centres during the
Bid/Issue Period.
(a) RIIs can withdraw their Bids until finalization of Basis of Allotment. In case a RII applying
through the ASBA process wishes to withdraw the Bid during the Bid/Issue Period, the same
can be done by submitting a request for the same to the concerned SCSB or the Syndicate
Member or the Registered Broker, as applicable, who shall do the requisite, including
unblocking of the funds by the SCSB in the ASBA Account.
(b) In case a RII wishes to withdraw the Bid after the Bid/Issue Period, the same can be done by
submitting a withdrawal request to the Registrar to the Issue until finalization of Basis of
Allotment. The Registrar to the Issue shall give instruction to the SCSB for unblocking the
ASBA Account on the Designated Date. QIBs and NIIs can neither withdraw nor lower the
size of their Bids at any stage.
i. the Bids accepted by the members of the Syndicate, the Registered Broker and
the SCSBs,
ii. the Bids uploaded by the members of the Syndicate, the Registered Broker and
the SCSBs,
iii. the Bid cum application forms accepted but not uploaded by the members of the
Syndicate, the Registered Broker and the SCSBs, or
iv. With respect to Bids by ASBA Bidders/Applicants, Bids accepted and uploaded
by SCSBs without blocking funds in the ASBA Accounts. It may be presumed that
for Bids uploaded by the SCSBs, the Bid Amount has been blocked in the relevant
Account.
(b) The BRLMs and their affiliate Syndicate Members, as the case may be, may reject Bids if all
the information required is not provided and the Bid cum Application Form is incomplete in
any respect.
(c) The SCSBs shall have no right to reject Bids, except in case of unavailability of adequate
funds in the ASBA account or on technical grounds.
(d) In case of QIB Bidders, only the (i) SCSBs (for Bids other than the Bids by Anchor Investors);
and (ii) BRLMs and their affiliate Syndicate Members (only in the specified locations) have
the right to reject bids. However, such rejection shall be made at the time of receiving the Bid
and only after assigning a reason for such rejection in writing.
(e) All bids by QIBs, NIIs & RIIs Bids can be rejected on technical grounds listed herein.
Bid cum Application Forms/Application Form can be rejected on the below mentioned technical
grounds either at the time of their submission to the (i) authorised agents of the BRLMs, (ii) Registered
Brokers, or (iii) SCSBs, or (iv) Collection Bank(s), or at the time of finalisation of the Basis of
Allotment. Bidders/Applicants are advised to note that the Bids/Applications are liable to be rejected,
inter-alia, on the following grounds, which have been detailed at various placed in this GID:-
(a) Bid/Application by persons not competent to contract under the Indian Contract Act, 1872, as
amended, (other than minors having valid Depository Account as per Demographic Details
provided by Depositories);
(c) In case of partnership firms, Bid/Application for Equity Shares made in the name of the firm.
However, a limited liability partnership can apply in its own name;
(d) In case of Bids/Applications under power of attorney or by limited companies, corporate, trust
etc., relevant documents are not being submitted along with the Bid cum application
form/Application Form;
(e) Bids/Applications by persons prohibited from buying, selling or dealing in the shares directly
or indirectly by SEBI or any other regulatory authority;
(f) Bids/Applications by any person outside India if not in compliance with applicable foreign
and Indian laws;
457
(g) DP ID and Client ID not mentioned in the Bid cum Application Form/Application Form;
(h) PAN not mentioned in the Bid cum Application Form/Application Form except for
Bids/Applications by or on behalf of the Central or State Government and officials appointed
by the court and by the investors residing in the State of Sikkim, provided such claims have
been verified by the Depository Participant;
(i) In case no corresponding record is available with the Depositories that matches the DP ID, the
Client ID and the PAN;
(j) Bids/Applications for lower number of Equity Shares than the minimum specified for that
category of investors;
(k) Bids/Applications at a price less than the Floor Price & Bids/Applications at a price more than
the Cap Price;
(m) Amount paid does not tally with the amount payable for the highest value of Equity Shares
Bid for. With respect to Bids/Applications by ASBA Bidders, the amounts mentioned in the
Bid cum Application Form/Application Form does not tally with the amount payable for the
value of the Equity Shares Bid/Applied for;
(n) Bids/Applications for amounts greater than the maximum permissible amounts prescribed by
the regulations;
(o) In relation to ASBA Bids/Applications, submission of more than five Bid cum Application
Forms/Application Form as per ASBA Account;
(p) Bids/Applications for a Bid/Application Amount of more than Rs. 200,000 by RIIs by
applying through non-ASBA process;
(q) Bids/Applications for number of Equity Shares which are not in multiples Equity Shares
which are not in multiples as specified in the RHP;
(s) Bid cum Application Forms/Application Forms are not delivered by the Bidders/Applicants
within the time prescribed as per the Bid cum Application Forms/Application Form, Bid/Issue
Opening Date advertisement and as per the instructions in the RHP and the Bid cum
Application Forms;
(t) With respect to ASBA Bids/Applications, inadequate funds in the bank account to block the
Bid/Application Amount specified in the Bid cum Application Form/ Application Form at the
time of blocking such Bid/Application Amount in the bank account;
(u) Bids/Applications where sufficient funds are not available in Escrow Accounts as per final
certificate from the Escrow Collection Banks;
(v) With respect to ASBA Bids/Applications, where no confirmation is received from SCSB for
blocking of funds;
(w) Bids/Applications by QIBs (other than Anchor Investors) and Non Institutional Bidders not
submitted through ASBA process or Bids/Applications by QIBs (other than Anchor Investors)
and Non Institutional Bidders accompanied with cheque(s) or demand draft(s);
(x) ASBA Bids/Applications submitted to a BRLM at locations other than the Specified Cities
and Bid cum Application Forms/Application Forms, under the ASBA process, submitted to
458
the Escrow Collecting Banks (assuming that such bank is not a SCSB where the ASBA
Account is maintained), to the issuer or the Registrar to the Issue;
(z) Bids/Applications by SCSBs wherein a separate account in its own name held with any other
SCSB is not mentioned as the ASBA Account in the Bid cum Application Form/Application
Form.
(a) The SEBI ICDR Regulations, 2009 specify the allocation or Allotment that may be made to
various categories of Bidders/Applicants in an Issue depending on compliance with the
eligibility conditions. Certain details pertaining to the percentage of Issue size available for
allocation to each category is disclosed overleaf of the Bid cum Application Form and in the
RHP / Prospectus. For details in relation to allocation, the Bidder/Applicant may refer to the
RHP / Prospectus.
(b) Under-subscription in Retail category is allowed to be met with spill-over from any other
category or combination of categories at the discretion of the Issuer and in consultation with
the BRLMs and the Designated Stock Exchange and in accordance with the SEBI ICDR
Regulations, 2009. Unsubscribed portion in QIB category is not available for subscription to
other categories.
(c) In case of under subscription in the Net Issue, spill-over to the extent of such under-
subscription may be permitted from the Reserved Portion to the Net Issue. For allocation in
the event of an under-subscription applicable to the Issuer, Bidders/Applicants may refer to
the RHP.
Bidders should note that this example is solely for illustrative purposes and is not specific to
the Issue; it also excludes bidding by Anchor Investors.
Bidders can bid at any price within the Price Band. For instance, assume a Price Band of Rs.
20 to Rs. 24 per share, Issue size of 3,000 Equity Shares and receipt of five Bids from Bidders,
details of which are shown in the table below. The illustrative book given below shows the
demand for the Equity Shares of the Issuer at various prices and is collated from Bids received
from various investors.
The price discovery is a function of demand at various prices. The highest price at which the
Issuer is able to Issue the desired number of Equity Shares is the price at which the book cuts
off, i.e., Rs. 22.00 in the above example. The Issuer, in consultation with the BRLMs, may
finalise the Issue Price at or below such Cut-Off Price, i.e., at or below Rs. 22.00. All Bids at
or above this Issue Price and cut-off Bids are valid Bids and are considered for allocation in
the respective categories.
In case of FPOs, Issuers may opt for an alternate method of Book Building in which only the
459
)ORRU3ULFHLVVSHFLILHGIRUWKHSXUSRVHVRIELGGLQJ³$OWHUQDWH%RRN%XLOGLQJ3URFHVV´
The Issuer may specify the Floor Price in the RHP or advertise the Floor Price at least one
Working Day prior to the Bid/Issue Opening Date. QIBs may Bid at a price higher than the
Floor Price and the Allotment to the QIBs is made on a price priority basis. The Bidder with
the highest Bid Amount is allotted the number of Equity Shares Bid for and then the second
highest Bidder is Allotted Equity Shares and this process continues until all the Equity Shares
have been allotted. RIIs, NIIs and Employees are Allotted Equity Shares at the Floor Price and
allotment to these categories of Bidders is made proportionately. If the number of Equity
Shares Bid for at a price is more than available quantity then the allotment may be done on a
proportionate basis. Further, the Issuer may place a cap either in terms of number of specified
securities or percentage of issued capital of the Issuer that may be allotted to a single Bidder,
decide whether a Bidder be allowed to revise the bid upwards or downwards in terms of price
and/or quantity and also decide whether a Bidder be allowed single or multiple bids.
Applicants may note that there is no Bid cum Application Form in a Fixed Price Issue. As the Issue Price is
mentioned in the Fixed Price Issue therefore on filing of the Prospectus with the RoC, the Application so
submitted is considered as the application form.
Applicants may only use the specified Application Form for the purpose of making an Application in terms of
the Prospectus which may be submitted through Syndicate Members/SCSB and/or Bankers to the Issue or
Registered Broker.
ASBA Applicants may submit an Application Form either in physical form to the Syndicate Members or
Registered Brokers or the Designated Branches of the SCSBs or in the electronic form to the SCSB or the
Designated Branches of the SCSBs authorising blocking of funds that are available in the bank account
VSHFLILHGLQWKH$SSOLFDWLRQ)RUPRQO\³$6%$$FFRXQW´7KH$SSOLFDWLRQ)RUPis also made available on the
websites of the Stock Exchanges at least one day prior to the Bid/Issue Opening Date.
In a fixed price Issue, allocation in the net offer to the public category is made as follows: minimum fifty per
cent to Retail Individual Investors; and remaining to (i) individual investors other than Retail Individual
Investors; and (ii) other Applicants including corporate bodies or institutions, irrespective of the number of
specified securities applied for. The unsubscribed portion in either of the categories specified above may be
allocated to the Applicants in the other category.
For details of instructions in relation to the Application Form, Bidders/Applicants may refer to the relevant
section of the GID.
The allotment of Equity Shares to Bidders/Applicants other than Retail Individual Investors and Anchor
Investors may be on proportionate basis. For Basis of Allotment to Anchor Investors, Bidders/Applicants may
refer to RHP/Prospectus. No Retail Individual Investor is will be allotted less than the minimum Bid Lot subject
to availability of shares in Retail Individual Investor Category and the remaining available shares, if any will be
allotted on a proportionate basis. The Issuer is required to receive a minimum subscription of 90% of the Issue
(excluding any Offer for Sale of specified securities). However, in case the Issue is in the nature of Offer for
Sale only, then minimum subscription may not be applicable.
Bids received from the RIIs at or above the Issue Price may be grouped together to determine the total
demand under this category. If the aggregate demand in this category is less than or equal to the Retail
Category at or above the Issue Price, full Allotment may be made to the RIIs to the extent of the valid
Bids. If the aggregate demand in this category is greater than the allocation to in the Retail Category at
or above the Issue Price, then the maximum number of RIIs who can be Allotted the minimum Bid Lot
460
will be computed by dividing the total number of Equity Shares available for Allotment to RIIs by the
PLQLPXP %LG /RW ³0D[LPXP 5,, $OORWWHHV´ 7KH $OORWPHQW WR WKH 5,,V ZLOO WKHQ EH PDGH LQ WKH
following manner:
(a) In the event the number of RIIs who have submitted valid Bids in the Issue is equal to or less
than Maximum RII Allottees, (i) all such RIIs shall be Allotted the minimum Bid Lot; and (ii)
the balance available Equity Shares, if any, remaining in the Retail Category shall be Allotted
on a proportionate basis to the RIIs who have received Allotment as per (i) above for the
balance demand of the Equity Shares Bid by them (i.e. who have Bid for more than the
minimum Bid Lot).
(b) In the event the number of RIIs who have submitted valid Bids in the Issue is more than
Maximum RII Allottees, the RIIs (in that category) who will then be allotted minimum Bid
Lot shall be determined on the basis of draw of lots.
Bids received from NIIs at or above the Issue Price may be grouped together to determine the total
demand under this category. The allotment to all successful NIIs may be made at or above the Issue
Price. If the aggregate demand in this category is less than or equal to the Non-Institutional Category at
or above the Issue Price, full allotment may be made to NIIs to the extent of their demand. In case the
aggregate demand in this category is greater than the Non-Institutional Category at or above the Issue
Price, allotment may be made on a proportionate basis up to a minimum of the Non-Institutional
Category.
For the Basis of Allotment to Anchor Investors, Bidders/Applicants may refer to the SEBI ICDR
Regulations, 2009 or RHP / Prospectus. Bids received from QIBs bidding in the QIB Category (net of
Anchor Portion) at or above the Issue Price may be grouped together to determine the total demand
under this category. The QIB Category may be available for allotment to QIBs who have Bid at a price
that is equal to or greater than the Issue Price. Allotment may be undertaken in the following manner:
(a) In the first instance allocation to Mutual Funds for up to 5% of the QIB Category may be
determined as follows: (i) In the event that Bids by Mutual Fund exceeds 5% of the QIB
Category, allocation to Mutual Funds may be done on a proportionate basis for up to 5% of
the QIB Category; (ii) In the event that the aggregate demand from Mutual Funds is less than
5% of the QIB Category then all Mutual Funds may get full allotment to the extent of valid
Bids received above the Issue Price; and (iii) Equity Shares remaining unsubscribed, if any
and not allocated to Mutual Funds may be available for allotment to all QIBs as set out at
paragraph 7.4(b) below;
(b) In the second instance, allotment to all QIBs may be determined as follows: (i) In the event of
oversubscription in the QIB Category, all QIBs who have submitted Bids above the Issue
Price may be Allotted Equity Shares on a proportionate basis for up to 95% of the QIB
Category; (ii) Mutual Funds, who have received allocation as per (a) above, for less than the
number of Equity Shares Bid for by them, are eligible to receive Equity Shares on a
proportionate basis along with other QIBs; and (iii) Under-subscription below 5% of the QIB
Category, if any, from Mutual Funds, may be included for allocation to the remaining QIBs on
a proportionate basis.
(a) Allocation of Equity Shares to Anchor Investors at the Anchor Investor Issue Price will be at
the discretion of the issuer subject to compliance with the following requirements:
i.not more than 60% of the QIB Portion will be allocated to Anchor Investors;
461
ii.one-third of the Anchor Investor Portion shall be reserved for domestic Mutual Funds, subject
to valid Bids being received from domestic Mutual Funds at or above the price at
which allocation is being done to other Anchor Investors; and
(b) A physical book is prepared by the Registrar on the basis of the Bid cum Application Forms
received from Anchor Investors. Based on the physical book and at the discretion of the issuer
in consultation with the BRLMs, selected Anchor Investors will be sent a CAN and if
required, a revised CAN.
(c) In the event that the Issue Price is higher than the Anchor Investor Issue Price: Anchor
Investors will be sent a revised CAN within one day of the Pricing Date indicating the number
of Equity Shares allocated to such Anchor Investor and the pay-in date for payment of the
balance amount. Anchor Investors are then required to pay any additional amounts, being the
difference between the Issue Price and the Anchor Investor Issue Price, as indicated in the
revised CAN within the pay-in date referred to in the revised CAN. Thereafter, the Allotment
Advice will be issued to such Anchor Investors.
(d) In the event the Issue Price is lower than the Anchor Investor Issue Price: Anchor
Investors who have been Allotted Equity Shares will directly receive Allotment Advice.
7.5 BASIS OF ALLOTMENT FOR QIBs (OTHER THAN ANCHOR INVESTORS), NIIs AND
RESERVED CATEGORY IN CASE OF OVER-SUBSCRIBED ISSUE
In the event of the Issue being over-subscribed, the Issuer may finalise the Basis of Allotment in
consultation with the Designated Stock Exchange in accordance with the SEBI ICDR Regulations,
2009.
The allocation may be made in marketable lots, on a proportionate basis as explained below:
(a) Bidders may be categorized according to the number of Equity Shares applied for;
(b) The total number of Equity Shares to be Allotted to each category as a whole may be arrived
at on a proportionate basis, which is the total number of Equity Shares applied for in that
category (number of Bidders in the category multiplied by the number of Equity Shares
applied for) multiplied by the inverse of the over-subscription ratio;
(c) The number of Equity Shares to be Allotted to the successful Bidders may be arrived at on a
proportionate basis, which is total number of Equity Shares applied for by each Bidder in that
category multiplied by the inverse of the over-subscription ratio;
(d) In all Bids where the proportionate allotment is less than the minimum bid lot decided per
Bidder, the allotment may be made as follows: the successful Bidders out of the total Bidders
for a category may be determined by a draw of lots in a manner such that the total number of
Equity Shares Allotted in that category is equal to the number of Equity Shares calculated in
462
accordance with (b) above; and each successful Bidder may be Allotted a minimum of such
Equity Shares equal to the minimum Bid Lot finalised by the Issuer;
(e) If the proportionate allotment to a Bidder is a number that is more than the minimum Bid lot
but is not a multiple of one (which is the marketable lot), the decimal may be rounded off to
the higher whole number if that decimal is 0.5 or higher. If that number is lower than 0.5 it
may be rounded off to the lower whole number. Allotment to all bidders in such categories
may be arrived at after such rounding off; and
(f) If the Equity Shares allocated on a proportionate basis to any category are more than the
Equity Shares Allotted to the Bidders in that category, the remaining Equity Shares available
for allotment may be first adjusted against any other category, where the Allotted Equity
Shares are not sufficient for proportionate allotment to the successful Bidders in that category.
The balance Equity Shares, if any, remaining after such adjustment may be added to the
category comprising Bidders applying for minimum number of Equity Shares.
(a) Designated Date: On the Designated Date, the Escrow Collection Banks shall transfer the
funds represented by allocation of Equity Shares (other than ASBA funds with the SCSBs)
from the Escrow Account, as per the terms of the Escrow Agreement, into the Public Issue
Account with the Bankers to the Issue. The balance amount after transfer to the Public Issue
Account shall be transferred to the Refund Account. Payments of refund to the Bidders shall
also be made from the Refund Account as per the terms of the Escrow Agreement and the
RHP.
(b) Issuance of Allotment Advice: Upon approval of the Basis of Allotment by the Designated
Stock Exchange, the Registrar shall upload the same on its website. On the basis of the
approved Basis of Allotment, the Issuer shall pass necessary corporate action to facilitate the
Allotment and credit of Equity Shares. Bidders/Applicants are advised to instruct their
Depository Participant to accept the Equity Shares that may be allotted to them
pursuant to the Issue.
Pursuant to confirmation of such corporate actions, the Registrar will dispatch Allotment
Advice to the Bidders/Applicants who have been Allotted Equity Shares in the Issue.
(c) The dispatch of Allotment Advice shall be deemed a valid, binding and irrevocable contract.
(d) Issuer will ensure that: (i) the Allotment of Equity Shares; and (ii) credit of shares to the
successful Bidders/Applicants Depository Account will be completed within 12 Working
Days of the Bid/ Issue Closing Date. The Issuer also ensures the credit of shares to the
VXFFHVVIXO $SSOLFDQW¶s depository account is completed within two Working Days from the
date of Allotment, after the funds are transferred from the Escrow Account to the Public Issue
Account on the Designated Date.
The Issuer may ensure that all steps for the completion of the necessary formalities for listing and
commencement of trading at all the Stock Exchanges are taken within 12 Working Days of the
Bid/Issue Closing Date. The Registrar to the Issue may give instructions for credit to Equity Shares the
beneficiary account with DPs, and dispatch the Allotment Advice within 12 Working Days of the
Bid/Issue Closing Date.
If the Issuer fails to make application to the Stock Exchange(s) and obtain permission for listing of the
Equity Shares, in accordance with the provisions of Section 40 of the Companies Act, 2013, the Issuer
may be punishable with a fine which shall not be less than Rs. 5 lakhs but which may extend to Rs. 50
lakhs and every officer of the Issuer who is in default shall be punishable with imprisonment for a term
which may extend to one year or with fine which shall not be less than Rs. 50,000 but which may
extend to Rs. 3 lakhs, or with both.
If the permissions to deal in and for an official quotation of the Equity Shares are not granted by any of
the Stock Exchange(s), the Issuer may forthwith repay, without interest, all moneys received from the
Bidders/Applicants in pursuance of the RHP/Prospectus.
If such money is not repaid within the prescribed time after the Issuer becomes liable to repay it, then
the Issuer and every director of the Issuer who is an officer in default may, on and from such expiry of
such period, be liable to repay the money, with interest at such rate, as disclosed in the
RHP/Prospectus.
If the Issuer does not receive a minimum subscription of 90% of the Net Issue (excluding any offer for
sale of specified securities), including devolvement to the Underwriters, within 60 days from the
Bid/Issue Closing Date, the Issuer may forthwith, without interest refund the entire subscription
amount received. In case the Issue is in the nature of Offer for Sale only, then minimum subscription
may not be applicable.
If there is a delay beyond the prescribed time, then the Issuer and every director of the Issuer who is an
officer in default may be liable to repay the money, with interest at the rate of 15% per annum.
The Issuer may ensure that the number of prospective Allottees to whom Equity Shares may be allotted
may not be less than 1,000 failing which the entire application monies may be refunded forthwith.
In case an Issuer not eligible under Regulation 26(1) of the SEBI ICDR Regulations, 2009 comes for
an Issue under Regulation 26(2) of SEBI (ICDR) Regulations, 2009 but fails to allot at least 75% of the
Net Issue to QIBs, in such case full subscription money is to be refunded.
(a) In case of ASBA Bids/Applications: Within 12 Working Days of the Bid/Issue Closing Date,
the Registrar to the Issue may give instructions to SCSBs for unblocking the amount in ASBA
Account on unsuccessful Bid/Application and also for any excess amount blocked on
Bidding/Application.
(b) In case of Non-ASBA Bid/Applications: Within 12 Working Days of the Bid/Issue Closing
Date, the Registrar to the Issue may dispatch the refund orders for all amounts payable to
unsuccessful Bidders/Applicants and also for any excess amount paid on Bidding/Application,
after adjusting for allocation/ allotment to Bidders/Applicants.
(c) In case of non-ASBA Bidders/Applicants, the Registrar to the Issue may obtain from the
GHSRVLWRULHV WKH %LGGHUV$SSOLFDQWV¶ EDQN DFFRXQW GHWDLOV LQFOXGLQJ WKH 0,&5 FRGH RQ WKH
basis of the DP ID, Client ID and PAN provided by the Bidders/Applicants in their Bid cum
464
Application Forms for refunds. Accordingly, Bidders/Applicants are advised to immediately
update their details as appearing on the records of their DPs. Failure to do so may result in
delays in dispatch of refund orders or refunds through electronic transfer of funds, as
DSSOLFDEOH DQG DQ\ VXFK GHOD\ PD\ EH DW WKH %LGGHUV$SSOLFDQWV¶ VROH ULVN DQG QHLWKHU WKH
Issuer, the Registrar to the Issue, the Escrow Collection Banks, or the Syndicate, may be liable
to compensate the Bidders/Applicants for any losses caused to them due to any such delay, or
liable to pay any interest for such delay. Please note that refunds shall be credited only to the
bank account from which the Bid Amount was remitted to the Escrow Bank.
(d) In the case of Bids from Eligible NRIs, FIIs and FPIs, refunds, if any, may generally be
payable in Indian Rupees only and net of bank charges and/or commission. If so desired, such
payments in Indian Rupees may be converted into U.S. Dollars or any other freely convertible
currency as may be permitted by the RBI at the rate of exchange prevailing at the time of
remittance and may be dispatched by registered post. The Issuer may not be responsible for
loss, if any, incurred by the Bidder/Applicant on account of conversion of foreign currency.
8.3.1 Mode of making refunds for Bidders/Applicants other than ASBA Bidders/Applicants
The payment of refund, if any, may be done through various modes as mentioned below:
(a) NECS²Payment of refund may be done through NECS for Bidders/Applicants having an
account at any of the centers specified by the RBI. This mode of payment of refunds may be
subject to availability of complete bank account details including the nine-digit MICR code of
the Bidder/Applicant as obtained from the Depository;
(b) NEFT²Payment of refund may be undertaken through NEFT wherever the branch of the
%LGGHUV$SSOLFDQWV¶EDQNLV1()7HQDEOHGDQGKDVEHHQDVVLJQHGWKH,QGLDQ)LQDQFLDO6\VWHP
&RGH³IFSC´ZKLFKFDQEHOLQNHGWRWKH0,&5RIWKDWSDUWLFXODUEUDQFK7KH,)6&&RGH
may be obtained from the website of RBI as at a date prior to the date of payment of refund,
duly mapped with MICR numbers. Wherever the Bidders/Applicants have registered their
nine-digit MICR number and their bank account number while opening and operating the
demat account, the same may be duly mapped with the IFSC Code of that particular bank
branch and the payment of refund may be made to the Bidders/Applicants through this
method. In the event NEFT is not operationally feasible, the payment of refunds may be made
through any one of the other modes as discussed in this section;
(c) Direct Credit²Bidders/Applicants having their bank account with the Refund Banker may
be eligible to receive refunds, if any, through direct credit to such bank account;
(d) RTGS²Bidders/Applicants having a bank account at any of the centers notified by SEBI
where clearing houses are managed by the RBI, may have the option to receive refunds, if
any, through RTGS; and
(e) For all the other Bidders/Applicants, including Bidders/Applicants who have not updated their
bank particulars along with the nine-digit MICR code, the refund orders may be dispatched
through speed post or registered post for refund orders. Such refunds may be made by
cheques, pay orders or demand drafts drawn on the Refund Bank and payable at par at places
where Bids are received.
Please note that refunds through the abovementioned modes shall be credited only to the bank account
from which the Bid Amount was remitted to the Escrow Bank.
For details of levy of charges, if any, for any of the above methods, Bank charges, if any, for cashing
such cheques, pay orders or demand drafts at other centers etc. Bidders/Applicants may refer to
RHP/Prospectus.
465
In case of ASBA Bidders/Applicants, the Registrar to the Issue may instruct the controlling branch of
the SCSB to unblock the funds in the relevant ASBA Account for any withdrawn, rejected or
unsuccessful ASBA Bids or in the event of withdrawal or failure of the Issue.
The Issuer may pay interest at the rate of 15% per annum if refund orders are not dispatched or if, in a
case where the refund or portion thereof is made in electronic manner, the refund instructions have not
been given to the clearing system in the disclosed manner and/or demat credits are not made to
Bidders/Applicants or instructions for unblocking of funds in the ASBA Account are not dispatched
within the 12 Working days of the Bid/Issue Closing Date.
The Issuer may pay interest at 15% per annum for any delay beyond 15 days from the Bid/ Issue
Closing Date, if Allotment is not made.
Unless the context otherwise indicates or implies, certain definitions and abbreviations used in this document
may have the meaning as provided below. References to any legislation, act or regulation may be to such
legislation, act or regulation as amended from time to time.
Term Description
Allotment/ Allot/ The allotment of Equity Shares pursuant to the Issue to successful Bidders/Applicants
Allotted
Allottee An Bidder/Applicant to whom the Equity Shares are Allotted
Allotment Advice Note or advice or intimation of Allotment sent to the Bidders/Applicants who have been allotted
Equity Shares after the Basis of Allotment has been approved by the designated Stock Exchanges
Anchor Investor A Qualified Institutional Buyer, applying under the Anchor Investor Portion in accordance with
the requirements specified in SEBI ICDR Regulations, 2009.
Anchor Investor Portion Up to 60% of the QIB Category which may be allocated by the Issuer in consultation with the
BRLMs, to Anchor Investors on a discretionary basis. One-third of the Anchor Investor Portion is
reserved for domestic Mutual Funds, subject to valid Bids being received from domestic Mutual
Funds at or above the price at which allocation is being done to Anchor Investors
Application Form The form in terms of which the Applicant should make an application for Allotment in case of
issues other than Book Built Issues, includes Fixed Price Issue
Application Supported An application, whether physical or electronic, used by Bidders/Applicants to make a Bid
by Blocked Amount/ authorising an SCSB to block the Bid Amount in the specified bank account maintained with
(ASBA)/ASBA such SCSB
ASBA Account Account maintained with an SCSB which may be blocked by such SCSB to the extent of the Bid
Amount of the ASBA Bidder/Applicant
ASBA Bid A Bid made by an ASBA Bidder
ASBA Prospective Bidders/Applicants in the Issue who Bid/apply through ASBA
Bidder/Applicant
Banker(s) to the Issue/ The banks which are clearing members and registered with SEBI as Banker to the Issue with
Escrow Collection whom the Escrow Account(s) may be opened, and as disclosed in the RHP/Prospectus and Bid
Bank(s)/ Collecting cum Application Form of the Issuer
Banker
Basis of Allotment The basis on which the Equity Shares may be Allotted to successful Bidders/Applicants under the
Issue
Bid An indication to make an offer during the Bid/Issue Period by a prospective Bidder pursuant to
submission of Bid cum Application Form or during the Anchor Investor Bid/Issue Period by the
Anchor Investors, to subscribe for or purchase the Equity Shares of the Issuer at a price within
the Price Band, including all revisions and modifications thereto. In case of issues undertaken
through the fixed price process, all references to a Bid should be construed to mean an
Application
Bid /Issue Closing Date The date after which the Syndicate, Registered Brokers and the SCSBs may not accept any Bids
for the Issue, which may be notified in an English national daily, a Hindi national daily and a
regional language newspaper at the place where the registered office of the Issuer is situated,
each with wide circulation. Applicants/bidders may refer to the RHP/Prospectus for the Bid/
Issue Closing Date
466
Term Description
Bid/Issue Opening Date The date on which the Syndicate and the SCSBs may start accepting Bids for the Issue, which
may be the date notified in an English national daily, a Hindi national daily and a regional
language newspaper at the place where the registered office of the Issuer is situated, each with
wide circulation. Applicants/bidders may refer to the RHP/Prospectus for the Bid/ Issue Opening
Date
Bid/Issue Period Except in the case of Anchor Investors (if applicable), the period between the Bid/Issue Opening
Date and the Bid/Issue Closing Date inclusive of both days and during which prospective
Bidders/Applicants (other than Anchor Investors) can submit their Bids, inclusive of any
revisions thereof. The Issuer may consider closing the Bid/ Issue Period for QIBs one working
day prior to the Bid/Issue Closing Date in accordance with the SEBI ICDR Regulations, 2009.
Applicants/bidders may refer to the RHP/Prospectus for the Bid/ Issue Period
Bid Amount The highest value of the optional Bids indicated in the Bid cum Application Form and payable by
the Bidder/Applicant upon submission of the Bid (except for Anchor Investors), less discounts (if
applicable). In case of issues undertaken through the fixed price process, all references to the Bid
Amount should be construed to mean the Application Amount
Bid cum Application The form in terms of which the Bidder/Applicant should make an offer to subscribe for or
Form purchase the Equity Shares and which may be considered as the application for Allotment for the
purposes of the Prospectus, whether applying through the ASBA or otherwise. In case of issues
undertaken through the fixed price process, all references to the Bid cum Application Form
should be construed to mean the Application Form
Bidder/Applicant Any prospective investor (including an ASBA Bidder/Applicant) who makes a Bid pursuant to
the terms of the RHP/Prospectus and the Bid cum Application Form. In case of issues undertaken
through the fixed price process, all references to a Bidder/Applicant should be construed to mean
an Bidder/Applicant
Book Built Process/ The book building process as provided under SEBI ICDR Regulations, 2009, in terms of which
Book Building Process/ the Issue is being made
Book Building Method
Broker Centres Broker centres notified by the Stock Exchanges, where Bidders/Applicants can submit the Bid
cum Application Forms/Application Form to a Registered Broker. The details of such broker
centres, along with the names and contact details of the Registered Brokers are available on the
websites of the Stock Exchanges.
BRLM(s)/ Book The Book Running Lead Manager to the Issue as disclosed in the RHP/Prospectus and the Bid
Running Lead cum Application Form of the Issuer. In case of issues undertaken through the fixed price process,
Manager(s)/Lead all references to the Book Running Lead Manager should be construed to mean the Lead
Manager/ LM Manager or LM
Business Day Monday to Friday (except public holidays)
CAN/Confirmation of The note or advice or intimation sent to each successful Bidder/Applicant indicating the Equity
Allotment Note Shares which may be Allotted, after approval of Basis of Allotment by the Designated Stock
Exchange
Cap Price The higher end of the Price Band, above which the Issue Price and the Anchor Investor Issue
Price may not be finalised and above which no Bids may be accepted
Client ID Client Identification Number maintained with one of the Depositories in relation to demat
account
Cut-off Price Issue Price, finalised by the Issuer in consultation with the Book Running Lead Manager(s),
which can be any price within the Price Band. Only RIIs, Retail Individual Shareholders and
employees are entitled to Bid at the Cut-off Price. No other category of Bidders/Applicants are
entitled to Bid at the Cut-off Price
DP Depository Participant
DP ID 'HSRVLWRU\3DUWLFLSDQW¶V,GHQWLILFDWLRQ1XPEHU
Depositories National Securities Depository Limited and Central Depository Services (India) Limited
Demographic Details 'HWDLOV RI WKH %LGGHUV$SSOLFDQWV LQFOXGLQJ WKH %LGGHU$SSOLFDQW¶V DGGUHVV QDPH RI the
$SSOLFDQW¶VIDWKHUKXVEDQGLQYHVWRUVWDWXVRFFXSDWLRQDQGEDQNDFFRXQWGHWDLOV
Designated Branches Such branches of the SCSBs which may collect the Bid cum Application Forms used by the
ASBA Bidders/Applicants applying through the ASBA and a list of which is available on
http://www.sebi.gov.in/cms/sebi_data/attachdocs/1316087201341.html
467
Term Description
Designated Date The date on which funds are transferred by the Escrow Collection Bank(s) from the Escrow
Account or the amounts blocked by the SCSBs are transferred from the ASBA Accounts, as the
case may be, to the Public Issue Account or the Refund Account, as appropriate, after the
Prospectus is filed with the RoC, following which the board of directors may Allot Equity Shares
to successful Bidders/Applicants in the fresh Issue may give delivery instructions for the transfer
of the Equity Shares constituting the Offer for Sale
Designated Stock The designated stock exchange as disclosed in the RHP/Prospectus of the Issuer
Exchange
Discount Discount to the Issue Price that may be provided to Bidders/Applicants in accordance with the
SEBI ICDR Regulations, 2009.
Draft Prospectus The draft prospectus filed with SEBI in case of Fixed Price Issues and which may mention a price
or a Price Band
Employees Employees of an Issuer as defined under SEBI ICDR Regulations, 2009 and including, in case of
a new company, persons in the permanent and full time employment of the promoting companies
excluding the promoters and immediate relatives of the promoter. For further details
Bidder/Applicant may refer to the RHP/Prospectus
Equity Shares Equity shares of the Issuer
Escrow Account Account opened with the Escrow Collection Bank(s) and in whose favour the Bidders/Applicants
(excluding the ASBA Bidders/Applicants) may Issue cheques or drafts in respect of the Bid
Amount when submitting a Bid
Escrow Agreement Agreement to be entered into among the Issuer, the Registrar to the Issue, the Book Running
Lead Manager(s), the Syndicate Member(s), the Escrow Collection Bank(s) and the Refund
Bank(s) for collection of the Bid Amounts and where applicable, remitting refunds of the
amounts collected to the Bidders/Applicants (excluding the ASBA Bidders/Applicants) on the
terms and conditions thereof
Escrow Collection Refer to definition of Banker(s) to the Issue
Bank(s)
FCNR Account Foreign Currency Non-Resident Account
First Bidder/Applicant The Bidder/Applicant whose name appears first in the Bid cum Application Form or Revision
Form
FII(s) Foreign Institutional Investors as defined under the SEBI (Foreign Institutional Investors)
Regulations, 1995 and registered with SEBI under applicable laws in India
Fixed Price Issue/Fixed The Fixed Price process as provided under SEBI ICDR Regulations, 2009, in terms of which the
Price Process/Fixed Issue is being made
Price Method
Floor Price The lower end of the Price Band, at or above which the Issue Price and the Anchor Investor Issue
Price may be finalised and below which no Bids may be accepted, subject to any revision thereto
FPIs Foreign Portfolio Investors as defined under the Securities and Exchange Board of India (Foreign
Portfolio Investors) Regulations, 2014
FPO Further public offering
Foreign Venture Capital Foreign Venture Capital Investors as defined and registered with SEBI under the SEBI (Foreign
Investors or FVCIs Venture Capital Investors) Regulations, 2000
IPO Initial public offering
Issue Public Issue of Equity Shares of the Issuer including the Offer for Sale if applicable
Issuer/ Company The Issuer proposing the initial public offering/further public offering as applicable
Issue Price The final price, less discount (if applicable) at which the Equity Shares may be Allotted in terms
of the Prospectus. The Issue Price may be decided by the Issuer in consultation with the Book
Running Lead Manager(s)
Maximum RII Allottees The maximum number of RIIs who can be allotted the minimum Bid Lot. This is computed by
dividing the total number of Equity Shares available for Allotment to RIIs by the minimum Bid
Lot.
MICR Magnetic Ink Character Recognition - nine-digit code as appearing on a cheque leaf
Mutual Fund A mutual fund registered with SEBI under the SEBI (Mutual Funds) Regulations, 1996
Mutual Funds Portion 5% of the QIB Category (excluding the Anchor Investor Portion) available for allocation to
Mutual Funds only, being such number of equity shares as disclosed in the RHP/Prospectus and
Bid cum Application Form
NECS National Electronic Clearing Service
NEFT National Electronic Fund Transfer
NRE Account Non-Resident External Account
468
Term Description
NRI NRIs from such jurisdictions outside India where it is not unlawful to make an offer or invitation
under the Issue and in relation to whom the RHP/Prospectus constitutes an invitation to subscribe
to or purchase the Equity Shares
NRO Account Non-Resident Ordinary Account
Net Issue The Issue less reservation portion
Non-Institutional All Bidders/Applicants, including sub accounts of FIIs registered with SEBI which are foreign
Investors or NIIs corporate or foreign individuals and FPIs which are Category III foreign portfolio investors, that
are not QIBs or RIBs and who have Bid for Equity Shares for an amount of more than Rs.
200,000 (but not including NRIs other than Eligible NRIs)
Non-Institutional The portion of the Issue being such number of Equity Shares available for allocation to NIIs on a
Category proportionate basis and as disclosed in the RHP/Prospectus and the Bid cum Application Form
Non-Resident A person resident outside India, as defined under FEMA and includes Eligible NRIs, FIIs, FPIs,
QFIs and FVCIs
OCB/Overseas A company, partnership, society or other corporate body owned directly or indirectly to the
Corporate Body extent of at least 60% by NRIs including overseas trusts, in which not less than 60% of beneficial
interest is irrevocably held by NRIs directly or indirectly and which was in existence on October
3, 2003 and immediately before such date had taken benefits under the general permission
granted to OCBs under FEMA
Offer for Sale Public offer of such number of Equity Shares as disclosed in the RHP/Prospectus through an
offer for sale by the Selling Shareholder
Other Investors Investors other than Retail Individual Investors in a Fixed Price Issue. These include individual
applicants other than retail individual investors and other investors including corporate bodies or
institutions irrespective of the number of specified securities applied for.
PAN Permanent Account Number allotted under the Income Tax Act, 1961
Price Band Price Band with a minimum price, being the Floor Price and the maximum price, being the Cap
Price and includes revisions thereof. The Price Band and the minimum Bid lot size for the Issue
may be decided by the Issuer in consultation with the Book Running Lead Manager(s) and
advertised, at least two working days in case of an IPO and one working day in case of FPO,
prior to the Bid/ Issue Opening Date, in English national daily, Hindi national daily and regional
language at the place where the registered office of the Issuer is situated, newspaper each with
wide circulation
Pricing Date The date on which the Issuer in consultation with the Book Running Lead Manager(s), finalise
the Issue Price
Prospectus The prospectus to be filed with the RoC in accordance with Section 60 of the Companies Act,
1956 after the Pricing Date, containing the Issue Price, the size of the Issue and certain other
information
Public Issue Account An account opened with the Banker to the Issue to receive monies from the Escrow Account and
from the ASBA Accounts on the Designated Date
Qualified Foreign Non-Resident investors, other than SEBI registered FIIs or sub-accounts or SEBI registered
Investors or QFIs )9&,V ZKR PHHW µNQRZ \RXU FOLHQW¶ UHTXLUHPHQWV SUHVFULEHG E\ 6(%, DQG DUH resident in a
country which is (i) a member of Financial Action Task Force or a member of a group which is a
member of Financial Action Task Force; and (ii) a signatory to the International Organisation of
6HFXULWLHV&RPPLVVLRQ¶V0XOWLODWHUDO0HPRUDQGXPRf Understanding or a signatory of a bilateral
memorandum of understanding with SEBI.
Provided that such non-resident investor shall not be resident in country which is listed in the
public statements issued by Financial Action Task Force from time to time on: (i) jurisdictions
having a strategic anti-money laundering/combating the financing of terrorism deficiencies to
which counter measures apply; (ii) jurisdictions that have not made sufficient progress in
addressing the deficiencies or have not committed to an action plan developed with the Financial
Action Task Force to address the deficiencies
QIB Category The portion of the Issue being such number of Equity Shares to be Allotted to QIBs on a
proportionate basis
Qualified Institutional As defined under SEBI ICDR Regulations, 2009
Buyers or QIBs
RTGS Real Time Gross Settlement
469
Term Description
Red Herring The red herring prospectus issued in accordance with Section 32 of the Companies Act, 2013,
Prospectus/ RHP which does not have complete particulars of the price at which the Equity Shares are offered and
the size of the Issue. The RHP may be filed with the RoC at least three days before the Bid/Issue
Opening Date and may become a Prospectus upon filing with the RoC after the Pricing Date. In
case of issues undertaken through the fixed price process, all references to the RHP should be
construed to mean the Prospectus
Refund Account(s) The account opened with Refund Bank(s), from which refunds (excluding refunds to ASBA
Bidders/Applicants), if any, of the whole or part of the Bid Amount may be made
Refund Bank(s) Refund bank(s) as disclosed in the RHP/Prospectus and Bid cum Application Form of the Issuer
Refunds through Refunds through NECS, Direct Credit, NEFT, RTGS or ASBA, as applicable
electronic transfer of
funds
Registered Broker Stock Brokers registered with the Stock Exchanges having nationwide terminals, other than the
members of the Syndicate
Registrar to the The Registrar to the Issue as disclosed in the RHP/Prospectus and Bid cum Application Form
Issue/RTI
Reserved Category/ Categories of persons eligible for making application/bidding under reservation portion
Categories
Reservation Portion The portion of the Issue reserved for category of eligible Bidders/Applicants as provided under
the SEBI ICDR Regulations, 2009
Retail Individual Investors who applies or bids for a value of not more than Rs. 200,000.
Investors / RIIs
Retail Individual Shareholders of a listed Issuer who applies or bids for a value of not more than Rs. 200,000.
Shareholders
Retail Category The portion of the Issue being such number of Equity Shares available for allocation to RIIs
which shall not be less than the minimum bid lot, subject to availability in RII category and the
remaining shares to be allotted on proportionate basis.
Revision Form The form used by the Bidders in an issue through Book Building process to modify the quantity
of Equity Shares and/or bid price indicates therein in any of their Bid cum Application Forms or
any previous Revision Form(s)
RoC The Registrar of Companies
SEBI The Securities and Exchange Board of India constituted under the Securities and Exchange Board
of India Act, 1992
SEBI ICDR The Securities and Exchange Board of India (Issue of Capital and Disclosure Requirements)
Regulations, 2009 Regulations, 2009
Self Certified Syndicate A bank registered with SEBI, which offers the facility of ASBA and a list of which is available
Bank(s) or SCSB(s) on http://www.sebi.gov.in/cms/sebi_data/attachdocs/1316087201341.html
Specified Locations Refer to definition of Broker Centers
Stock Exchanges/ SE The stock exchanges as disclosed in the RHP/Prospectus of the Issuer where the Equity Shares
Allotted pursuant to the Issue are proposed to be listed
Syndicate The Book Running Lead Manager(s) and the Syndicate Member
Syndicate Agreement The agreement to be entered into among the Issuer, and the Syndicate in relation to collection of
the Bids in this Issue (excluding Bids from ASBA Bidders/Applicants)
Syndicate The Syndicate Member(s) as disclosed in the RHP/Prospectus
Member(s)/SM
Underwriters The Book Running Lead Manager(s) and the Syndicate Member(s)
Underwriting The agreement amongst the Issuer, and the Underwriters to be entered into on or after the Pricing
Agreement Date
Working Day All days other than a Sunday or a public holiday on which commercial banks are open for
business, except with reference to announcement of Price Band and Bid/Issue Period, where
working day shall mean all days, excluding Saturdays, Sundays and public holidays, which are
working days for commercial banks in India
470
SECTION VIII ± MAIN PROVISIONS OF THE ARTICLES OF ASSOCIATION
1. These Articles consist of this Article 1 and Article 2 (Preliminary), Article 3 (Definitions and
,QWHUSUHWDWLRQDQGWZRFKDSWHUV&KDSWHUµ$¶DQG&KDSWHUµ%¶7KHSURYLVLRQVRIWKLV &KDSWHUµ$¶VKDOO
apply to all the matters to which they pertain, to the extent, and only in so far as they are
QRWLQFRQVLVWHQWZLWKWKHVSHFLDOSURYLVLRQVRI&KDSWHUµ%¶7KHSURYLVLRQVRI&KDSWHUµ%¶VKDOOJRYHUQ
the rights and obligations of the SPA, the Founders and the Company inter se, and as long as Chapter
µ%¶UHPDLQVDSDUWRIWKHVHUHJXODWLRQVLQWKHHYHQWRIDQ\FRQIOLFWRULQFRQVLVWHQF\WKHSURYLVLRQVRI
&KDSWHUµ%¶VKDOOSUHYDLORYHUWKHSURYLVLRQVRI&KDSWHUµ$¶WRWKH maximum extent permitted under the
Act and under applicable law.
CHAPTER A
6. Any application signed by or on behalf of the applicant for shares in the Company, followed by any
allotment of any shares therein, shall be an acceptance of shares within the meaning of these
Articles; and every person who thus or otherwise accepts any shares and whose name is on the
Register of Members shall, for the purpose of the Articles, be a member.
7. (1) If at any time the share capital is divided into different classes of shares, the rights attached to
any class (unless otherwise provided by the terms of issue of the shares of that class) may, subject
to the provisions of Section 48 of the Act and, whether or not the Company is being wound up, be
varied with the consent in writing of the holders of three fourths of the issued shares of that class or
with the sanction of a special resolution passed at a separate meeting of the holders of the shares of that
class.
(2) To every such separate meeting, the provisions of these Articles relating to general meetings
shall mutatis mutandis apply, but so that the necessary quorum shall be at least two persons holding at
least one-third of the issued shares of the class in question.
8. The rights conferred upon the holders of the shares of any class issued with preferred or other rights
shall not unless otherwise provided by the terms of issue of the shares of that class be deemed to be
varied by the creation or issue of further shares ranking paripassu therewith.
9. Subject to the provisions of Section 55 of the Act, any preference shares may, with the sanction of an
ordinary resolution, be issued on the terms that they are to be redeemed on such terms and in such
manner as the Company before the issue of the shares may, by special resolution, determine.
10. (1) The Company may exercise the power of paying commission conferred by sub-section (6) of
Section 40 of the Act, provided that the rate per cent or the amount of the commission paid or agreed to
be paid shall be disclosed in the manner required by that section and the rules made thereunder.
(2) The rate or amount of commission shall not exceed the rate or amount prescribed in rules made under
sub-section (6) of Section 40 of the Act.
(3) The commission may be satisfied by payment in cash or by allotment of fully or partly paid
shares or partly in one way and partly in the other.
11. Except as required by applicable law, no person shall be recognized by the Company as holding any
share upon any trust and the Company shall not be bound by or be compelled in any way to recognize
471
(even when having notice thereof) any equitable, contingent future or partial interest in any share or
any interest in any fractional part of a share or (except only as by these Articles or by law otherwise
provided) any other rights in respect of any share except an absolute right to the entirety thereof in the
registered holder.
12. Subject to the provisions of Section 62 of the Act and these Articles, the shares in the capital of the
Company for the time being shall be under the control of the directors who may issue, allot
or otherwise dispose of the same or any of them to such persons, in such proportion and on such terms
and conditions and either at a premium or at par or (subject to the compliance with the provision of
Section 53 of the Act) at a discount and at such time as they may from time to time thing fit and with
sanction of the Company in the general meeting to give to any person or persons the option or right to
call for any shares either at par or premium during such time and for such consideration as the
directors think fit, and may issue and allot shares in the capital of the Company on payment in full or
part of any property sold and transferred or for any services rendered to the Company in the conduct of
its business and any shares which may so be allotted may be issued as fully paid up shares and if so
issued, shall be deemed to be fully paid shares, provided that option or right to call of shares shall not
be given to any person or persons without the sanction of the Company in the general meeting.
12A. The Company shall not, at any time, vary the terms of a contract referred to in prospectus or objects for
which the prospectus was issued, except subject to the approval of, or except subject to an authority
given by the Company in general meeting by way of special resolution, and in accordance with the
provisions of the Act. Provided that the dissenting shareholders, being the shareholders who have not
agreed to the proposal to vary the terms of the contracts or the objects referred to in the prospectus,
shall be given an exit offer by the promoters or controlling shareholders of the Company, at the fair
market value of the equity shares as on the date of the resolution of the Board of Directors
recommending such variation in the terms of the contracts or the objects referred to in the prospectus,
in accordance with such terms and conditions as may be specified on this behalf by the Securities and
Exchange Board of India.
13. Every member shall be entitled, without payment, to one or more certificates in marketable lots, for all
the shares of each class or denomination registered in his name, or if the directors so approve (upon
paying such fee as the directors so time determine) to several certificates, each for one or more of such
shares and the Company shall complete and have ready for delivery such certificates within
two months from the date of allotment, unless the conditions of issue thereof otherwise provide, or
within one month of the receipt of application of registration of transfer, transmission, sub-
division, consolidation or renewal of any of its shares as the case may be. Every certificate of shares
shall be under the seal of the Company and shall specify the number and distinctive numbers of
shares in respect of which it is issued and amount paid-up thereon and shall be in such form as the
directors may prescribe and approve, provided that in respect of a share or shares held jointly by
several persons, the Company shall not be bound to issue more than one certificate and delivery of a
certificate of shares to one or several joint holders shall be a sufficient delivery to all such holders.
13A. Every holder of or subscriber to the securities of the Company shall have the option to receive Security
Certificates or to hold the securities with a Depository. Such a person who is the beneficial owner of
the securities can at any time opt out of a Depository, if permitted by law, in respect of any security in
the manner provided by the Depositories Act, 1996. If a person opts to hold its Security with a
Depository, the Company shall intimate such Depository the details of allotment of the security and on
receipt of such information, the Depository shall enter in its record, the name of the allottees as the
beneficial owner of that security. If a beneficial owner seeks to opt out of a Depository in respect of
any security, he shall inform the Depository accordingly. The Depository shall on receipt of such
information make appropriate entries in its records and shall inform the Company. The Company shall
within 30 (thirty) days of the receipt of intimation from a Depository and on fulfillment of
472
such conditions and on payment of such fees as may be specified by the regulations issue to the
beneficial owner the required Certificates for the securities.
14. (1) If any certificate be worn out, defaced, mutilated or torn or if there be no further space on the
back thereof for endorsement of transfer, then upon production and surrender thereof to the
Company, a new certificate may be issued in lieu thereof, and if any certificate is lost or destroyed
then upon proof thereof to the satisfaction of the Company and on execution of such indemnity as the
Company deems adequate being given, a new certificate in lieu thereof shall be given to the party
entitled to such lost or destroyed certificate. Every certificate under this Article shall be issued without
payment of fees if the directors so decide, or on payment of such fees (not exceeding Rs. 2/- for each
certificate) as the directors shall prescribe, provided that no fee shall be charged for issue of new
certificates in replacement of those which are old, defaced or worn out or where there is no further
space on the back thereof for endorsement of transfer.
(2) Provided that notwithstanding what is stated above, the directors shall comply with such rules
or regulation or requirements of any Stock Exchange or the rules made under the Act or rules made
under the Securities Contracts (Regulation) Act,1956 or any other Act, or rules applicable
thereof in this behalf.
(3) The provision of this Article shall mutatis mutandis apply to debentures of the Company.
15. (1) Where at any time after the expiry of two years from the formation of the Company or at any
time after the expiry of one year from the allotment of shares in the Company made for the first time
after its formation, whichever is earlier, it is proposed to increase the subscribed capital of the
Company by allotment of further shares either out of unissued capital or increased share capital,
then:
(a) Such further shares shall be offered to the persons who, at the date of the offer, are holders of
the equity shares of the Company, in proportion, as nearly as circumstances
admit, to the capital paid-up on those shares at that date;
(b) The offer aforesaid shall be made by a notice specifying the number of shares offered and
limiting a time not being less than thirty days from the date of the offer within which the offer,
if not accepted, will be deemed to have been declined;
(c) The offer aforesaid shall be deemed to include a right exercisable by the person
concerned to renounce the shares offered to him or any of them in favour of any other person
and the notice referred to in sub-clause (b) shall contain a statement of this right. Provided
that the directors may decline, without assigning any reason to allot any shares to any person
in whose favour any member may renounce the shares offered to him;
(d) After the expiry of the time specified in the notice aforesaid, or on receipt of earlier intimation
from the person to whom such notice is given that he declines to accept the shares offered, the
Board of Directors may dispose of them in such manner as they, in their sole discretion, think
fit.
(2) Notwithstanding anything contained in sub-clause (1) the further shares aforesaid may
be offered to any persons (whether or not those persons include the persons referred to in clause of
sub-clause (1) hereof) in any manner whatsoever:
(a) If a special resolution to that effect is passed by the Company in a general meeting, or
473
(b) Where no such resolution is passed, if the votes cast (whether on a show of hands or on a poll
as the case may be) in favour of the proposal contained in the resolution moved in that
general meeting (including the casting vote, if any, of the Chairman) by members who, being
entitled so to do, vote in person, or where proxies are allowed, by proxy, exceed the
votes, if any, cast against the proposal by members, so entitled and voting and the Central
Government is satisfied, on an application made by the Board of Directors in this behalf, that
the proposal is most beneficial to the Company.
(a) To extend the time within which the offer should be accepted; or
(b) To authorize any person to exercise the right of renunciation for a second time, on the ground
that the person in whose favour the renunciation was first made has declined to take the shares
comprised in the renunciation.
(4) Nothing in this Article shall apply to the increase of the subscribed capital of the Company
caused by the exercise of an option as a term attached to the debentures issued or loans raised by the
Company to convert such debenture or loans into shares in the Company.
(5) Provided that that the terms of issue of such debentures or loan containing such an option have
been approved before the issue of such debenture or the raising of loan by a special resolution passed
by the Company in general meeting.
ALTERATION OF CAPITAL
17. Subject to the provisions of Section 61 of the Act, the Company may, by ordinary resolution:
a) consolidate and divide all or any of its share capital into shares of larger amount than its
existing shares;
b) convert all or any of its fully paid-up shares into stock, and reconvert that stock into fully
paid-up shares of any denomination;
c) sub-divide its existing shares or any of them into shares of smaller amount than is fixed by the
memorandum;
d) cancel any shares which, at the date of the passing of the resolution, have not been taken or
agreed to be taken by any person.
19. The Company may, by special resolution, reduce in any manner and with, and subject to, any
incident authorised and consent required by law:
LIEN
20. The Company shall have a first and paramount lien upon all the shares/debentures (other than fully
paid-up shares/debentures) registered in the name of each member (whether solely or jointly
with others) and upon the proceeds of sale thereof for all moneys (whether presently payable or not)
called or payable at a fixed time in respect of such shares/debentures and no equitable interest in any
474
share shall be created except upon the footing and condition that this Article will have full effect and
such lien shall extend to all dividends and bonuses from time to time declared in respect of such
shares/debentures. Provided that the Company shall not have a lien upon fully paid-up
shares/debentures. Unless otherwise agreed the registration of a transfer of shares/debentures shall
RSHUDWHDVDZDLYHURIWKH&RPSDQ\¶VOLHQLIDQ\RQVXFKVKDUHVGHEHQWXUHV7KHGLUHFWRUVPD\DWDQ\
time declare any shares/debentures wholly or in part to be exempt from the provisions of this clause.
21. The Company may sell, in such manner as the Board of Directors thinks fit, any share on which the
Company has a lien, provided that no sale shall be made:
22. (1) To give effect to any such sale, the Board of Directors may authorize some person to transfer
the shares sold to the purchaser thereof.
(2) The purchaser shall be registered as the shareholder of the shares comprised in any
such transfer.
(3) The purchaser shall not be bound to see to the application of the purchase money nor shall his
title to the shares be affected by any irregularity or invalidity in the proceedings in references to the
sale.
23. (1) The proceeds of the sale shall be received by the Company and applied in payment of the
whole or part of the amount in respect of which the lien exist as is presently payable.
(2) The residue, if any, shall, subject to a like lien for sums not presently payable as existed upon
the shares as the date of sale, be paid to the person entitled to the shares at the date of the sale.
CALLS ON SHARES
24. (1) The Board of Directors may, from time to time, make calls upon the members in respect of
money unpaid on their shares (whether on account of the nominal value of the shares or by way of
premium) and not by the condition of allotment thereof made payable at fixed times, provided that no
call shall exceed one-fourth of the nominal value of the share or be payable at less than one month from
the date fixed for the payment of the last preceding call.
(2) (DFKPHPEHUVKDOOVXEMHFWWRUHFHLYLQJDWOHDVWIRXUWHHQGD\V¶QRWLFHVSHFLI\LQJWKHWLPHRU
times and place of payment of the call money, pay to the Company at the time or times and place so
specified, the amount called on his shares.
25. A call shall be deemed to have been made at the time when the resolution of the Board of Directors
authorising the call was passed. Call money may be required to be paid by installments.
26. The joint holders of a share shall be jointly and severally liable to pay all call in respect thereof.
27. (1) If a sum called in respect of a share is not paid before or on the day appointed for payment
thereof, the person from whom the sum is due shall pay interest thereon from the day
appointed for payment thereof to the time of actual payment at ten percent per annum or at such lower
rate, if any, as the Board of Directors may determine.
475
(2) The Board of Directors shall be at liberty to waive payment of any such interest wholly or
28. (1) Any sum which by the terms of issue of a share become payable on allotment or at any fixed
date, whether on account of the nominal value of the shares or by way of premium, shall for purposes
of these Articles, be deemed to be a call duly made and payable on the date on which by the terms of
issue such sum becomes payable.
(2) In case of non-payment of such sum, all the relevant provisions of these Articles as to
payment of interest and expenses, forfeiture or otherwise shall apply as if such sum had become
payable by virtue of a call duly made and notified.
29. (1) The Board of Directors may, if they think fit, subject to the provisions of Section 50 of the
Act, agree to and receive from any member willing to advance the same, whole or any part of the
moneys due upon the shares held by him beyond the sums actually called for, and upon the amount so
paid or satisfied in advance, or so much thereof as from time to time exceeds the amount of the calls
then made upon the shares in respect of which such advance has been made, the Company may pay
interest at such rate, not exceeding, unless the Company in a general meeting shall otherwise direct,
twelve per cent per annum, as the member paying such sum in advance and the directors agree upon
provided that money paid in advance of calls shall not confer a right to participate in profits or
dividend or to participate in profits. The directors may at any time repay the amount so advanced.
(2) The members shall not be entitled to any voting rights in respect of the moneys so paid by him
until the same would but for such payment, become presently payable.
(3) The provisions of these Articles shall mutatis mutandis apply to the calls on debentures of the
Company.
31. (1) The instrument of transfer of any share in the Company shall be executed by or on behalf of
both the transferor and the transferee.
(2) the transferor shall be deemed to remain a holder of the share until the name of the transferee
is entered in the Register of Members in respect thereof.
32. The instrument of transfer shall be in writing and all the provisions of Section 56 of the Act (and any
statutory modification thereof for the time being) shall be duly complied with in respect of all transfers
of shares and registration thereof.
34. No fee shall be charged for registration of transfer, transmission, probate, succession certificate and
Letters of Administration, Certificate of Death or Marriage, Power of Attorney or similar other
document.
35. 2QJLYLQJQRWOHVVWKDQVHYHQGD\V¶SUHYLRXVQRWLFHLQDFFRUGDQFHZLWK6HFWLRQRIWKH$FWDQGUXOHV
made thereunder, the registration of transfers may be suspended at such times and for such periods as
the Board of Directors may from time to time determine, provided that such registration shall not be
suspended for more than thirty days at any one time or for more than forty five days in the aggregate in
any year.
36. Subject to the provisions of Sections 58 and 59 of the Act, these Articles and other applicable
476
provisions of the Act or any other law for the time being in force, the Board of Directors may refuse
whether in pursuance of any power of the Company under these Articles or otherwise to register the
transfer of, or the transmission by operation of law of the right to, any shares or interest of a Member in
or debentures of the Company. The Company shall within one month from the date on which the
instrument of transfer, or the intimation of such transmission, as the case may be, was delivered to
Company, send notice of the refusal to the transferee and the transferor or to the person
giving intimation of such transmission, as the case may be, giving reasons for such refusal. Provided
that the registration of a transfer shall not be refused on the ground of the transferor being either alone
or jointly with any other person or persons indebted to the Company on any account whatsoever except
where the Company has a lien on shares. Transfer of shares/debentures in whatever lot shall not be
refused.
37. (1) On the death of a member, the survivor or survivors where the member was a joint holder and
his nominee or nominees or legal representative where he was a sole holder, shall be the only persons
recognized by the Company as having any title to his interest in the shares.
(2) Nothing in clause (1) shall release the estate of a deceased joint holder from any liability in
respect of any share which had been jointly held by him with other persons.
38. (1) Any person becoming entitled to a share in consequence of the death or insolvency of a
member may, upon such evidence being produced as may from time to time properly be
required by the Board of Directors and, subject as hereinafter provided elect, either:
(2) The Board of Directors shall, in either case, have the same right to decline or suspend
registration as it would have had, if the deceased or insolvent member had himself transferred the share
before his death or insolvency.
39. (1) If the person so becoming entitled, shall elect to be registered as holder of the share himself, he
shall deliver or send to the Company a note in writing signed by him stating that he so elects.
(2) If the person aforesaid shall elect to transfer the share, he shall testify his election by
executing a transfer of share.
(3) All the limitations, restrictions and provisions of these Articles relating to the right to transfer
and the registration of transfers of shares shall be applicable to any such notice or transfer as aforesaid
as if the death or insolvency of the member had not occurred and the notice of transfer were a
transfer signed by that member.
40. On the transfer of the share being registered in his name a person becoming entitled to a share by
reason of the death or insolvency of the holder shall be entitled to the same dividends and
other advantages to which he would be entitled if he was the registered as a member in respect of the
share be entitled in respect of it to excise any right conferred by membership in relation to meeting of
the Company, provided that the Board of Directors may, at any time, give notice requiring any such
person to elect either to be registered himself or to transfer the share and if the notice is not complied
with within 90 (ninety) days, the Board of Directors may thereafter withhold payment of all
dividends, bonus or other moneys payable in respect of the share, until the requirements of the notice
have been complied with.
41. The Company shall incur no liability whatsoever in consequence of its registering or giving effect, to
any transfer of share made or purporting to be made by any apparent legal owner thereof (as shown or
appearing in the register of members) to the prejudice of persons having or claiming any equitable
right, title of interest to or in the said shares notwithstanding that the Company may have had notice of
such equitable right, title or interest or notice prohibiting registration of such transfer and may have
477
entered such notice or referred thereto, in any book of the Company and the Company shall not be
bound or required to regard or attend or give effect to any notice which may be given to it of any
equitable right, title or interest or be under any liability for refusing or neglecting so to do, though it
may have been entered or referred to in some book of the Company but the Company though not bound
so to do, shall be at liberty to regard and attend to any such notice and give effect thereto if the Board
of Directors shall so think fit.
FORFEITURE OF SHARES
42. If a member fails to pay any call or installment of a call, on the day appointed for payment thereof, the
Board of Directors may, at any time thereafter during such time as any part of the call or installment
remains unpaid serve a notice on him requiring payment of so much of the call or installment as is
unpaid together with any interest which may have accrued.
a) Name a further day (not earlier than the expiry of 14 (fourteen) days from the date of service
of notice) on or before which the payment required by the notice is to be made; and
b) State that, in the e vent of non-payment on or before the days so named, the shares in respect
of which the call was made, will be liable to be forfeited.
44. If the requirements of any such notice as aforesaid are not complied with, any share in respect of which
the notice has been given may, at any time, thereafter, before the payment required by the notice has
been made, be forfeited by a resolution of the Board of Directors to that effect.
45. (1) A forfeited share may be sold or otherwise disposed of on such terms and in such manner as
the Board of Directors thinks fit.
(2) At any time before a sale or disposal, as aforesaid, the Board of Directors may cancel the
forfeiture on such terms as it thinks fit.
46. (1) A person whose shares have been forfeited shall cease to a member in respect of the forfeited
shares, but shall, notwithstanding the forfeiture, remain liable to pay to the Company all moneys
which, at date of forfeiture, were presently payable by him to the Company in respect of the shares.
(2) The liability of such person shall cease if and when the Company shall have received
payments in full of all such money in respect of the shares.
47. (1) A duly verified declaration in writing that the declarant is a director, the manager or the
secretary of the Company and that a share in the Company has been duly forfeited on a date stated in
the declaration, shall be conclusive evidence of the facts therein stated as against all persons claiming
to be entitled to the share.
(2) The Company may receive the consideration, if any, given for the share on any sale
or disposal thereof and may execute a transfer of the share in favour of the person to whom the share is
sold or disposed of.
(3) The transferee shall thereupon be registered as the holder of the share.
(4) The transferee shall not be bound to see to the application of the purchase money, if any, nor
shall his title to the share be affected by any irregularity or invalidity in the proceedings in reference to
the forfeiture, sale or disposal of the share.
48. The provisions of these Articles as to forfeiture shall apply, in the case of non-payment of any sum
which, by the terms of issue of the share, becomes payable at a fixed time, whether on account of the
nominal value of the share or by way of premium, as if the same had been payable by virtue of a call
478
duly made and notified.
49. The forfeiture of a share shall involve the extinction of all interest in and also of all claims
and demands against the Company in respect of the share, and all other rights incidental thereto except
only such of those rights as by these Articles are expressly saved.
50. Upon any sale, after forfeiture or for enforcing a lien in purported exercise of powers hereinbefore
given, the Board of Directors may appoint some person to execute an instrument of transfer of the
shares sold and use the purchaser's name to be entered in the Register in respect of the shares sold and
the purchaser shall not be bound to see to the regularity of the proceedings or to be application of the
purchase money and after his name has been entered in the Register in respect of such shares, the
validity, of the sale shall not be impeached by any person and the remedy of any person aggrieved by
the sale shall be in damages only and against only and against the Company exclusively.
51. Upon any sale, re-allotment or other disposal under the provisions of these Articles relating to lien or to
forfeiture, the certificate or certificates originally issued in respect of the relative shares shall (unless
the same shall on demand by the Company have been previously surrendered to it by the defaulting
member) stand cancelled and become null and void and of no effect. When any shares, under the
powers in that behalf herein contained are sold by the Board of Directors and the certificate in respect
thereof has not been delivered up to the Company by the former holder of such shares, the Board of
Directors may issue a new certificate for such shares distinguishing it in such manner as it may think
fit, from the certificate not so delivered.
52. The Board of Directors may, subject to the provisions of the Act, accept from any member on such
terms and conditions as shall be agreed, a surrender of his shares or stock or any part thereof.
BUY-BACK OF SHARES
53. Notwithstanding anything contained in these Articles, but subject to the provisions of Sections 67 to 70
of the Act and any other applicable provision of the Act or any other law for the time being in force, the
Company may purchase its own shares or other specified securities.
GENERAL MEETING
54. All general meeting other that the annual general meetings of the Company shall be called
extra- ordinary general meetings.
55. (1) The Board of Directors may, whenever it thinks fit call an extraordinary general meeting,
(2) If at any time directors capable of acting who are sufficient in number to form a quorum are
not within India, any director or any two members of the Company may call an extra-ordinary general
meeting in the same manner, as nearly as possible, as that in which such a meeting may be called by the
Board.
(3) The Board of Directors shall call an extraordinary general meeting, upon a requisition
in writing by any member or members holding in the aggregate not less than one-tenth of such of the
paid-up capital as on that date carries the right of voting. Any valid requisition so made by Members
must state the object or objects of the meeting proposed to be called, and must be signed by the
requisitionists and be deposited at the Office, provided that such requisition may consist of several
documents in like form each signed by one or more requisitionists. Upon the receipt of any such
requisition, the Board of Directors shall forthwith call an extraordinary general meeting and if
they do not proceed within twenty-one days from the date of the requisition being deposited to
cause a meeting to be called on a day not later than forty-five days from the date of deposit of the
requisition, the requisitionists may themselves call the meeting, within a period of three months from
the date of the requisition. Any meeting called under the foregoing Articles by the requisitionists
shall be called in the same manner, as nearly as possible, as that in which meetings are to be called
479
by the Board.
56. (1) No business shall be transacted at any general meeting, unless a quorum or members is present
at the time when the meeting proceeds to business.
(2) Save as otherwise provided herein, the quorum for the general meeting shall be as provided in
Section 103 of the Act.
57. The Chairman, if any of the Board of Directors shall preside as Chairman at every general meeting of
the Company.
58. If there is no such Chairman or if he is not present within fifteen minutes after the time appointed for
holding the meeting or is unwilling to act as Chairman of the meeting, the directors present shall elect
one of their members to be the Chairman of the meeting
59. If at any meeting no director is willing to act as Chairman or if no director is present within 15
(fifteen) minutes of the time appointed for holding the meeting, the members present shall choose
one of their members to be the Chairman of the meeting.
60. No business shall be discussed at any general meeting except the election of a Chairman, whilst the
chair is vacant.
61. (1) The Chairman may with the consent of any meeting at which a quorum is present and shall, if
so directed by the meeting, adjourn the meeting, from time to time and place to place.
(2) No business shall be transacted at any adjourned meeting, other than the business left
unfinished at the meeting from which the case of an original meeting.
3) When a meeting is adjourned for thirty days or more, fresh notice of any adjourned meeting
given as in the chaser of an original meeting.
4) Save as aforesaid, and as provided in Section 103 of the Act, it shall not be necessary to give
any notice of any adjournment or of the business to be transacted at an adjourned meeting.
62. In the case of an equality of votes, whether on a show of hands or on a poll, the Chairman of the
meeting at which the show of hands takes places or at which poll is demanded shall be entitled to a
second or casting vote.
VOTES OF MEMBERS
63. Subject to any rights or restrictions for the time being attached to any class or classes of shares:
a) on a show of hands, every members present in person shall have one vote; and
b) on a poll, the voting rights of members shall be in proportion to his share in the paid-up equity
share capital of the Company.
64. A member may exercise his vote at a meeting by electronic means in accordance with Section 108 of
the Act and shall vote only once.
65. In the case of joint holders, the vote of the senior who tenders a vote whether in person or by proxy,
shall be accepted to the exclusion of the votes of the other joint holders. For this purpose, seniority
shall be determined by the order in which the names of joint holders stand in the Register of
480
Members.
66. A member of unsound mind or in respect of whom an order has been made by any court having
jurisdiction in lunacy, may vote, whether on a show of hands or on a poll, by his committee or other
legal guardian, and any such committee or guardian may on a poll, vote by proxy.
67. Any business other than that upon which a poll has been demanded, may be proceeded with, pending
the taking of the poll.
68. No members shall be entitled to vote at any general meeting unless all calls and other sums presently
payable by him in respect of shares in the Company or in respect of shares on which the Company has
exercised any right of lien, have been paid.
69. (1) No objection shall be raised to the qualification of any voter, except at the meeting
or adjourned meeting at which the vote objected to is given or tendered and every vote not disallowed
at such meeting shall be valid for all purposes.
(2) Any such objection made in due time shall be referred to the Chairman of the meeting, whose
decision thereon shall be final and conclusive.
70. The instrument appointing a proxy and the power of attorney or other authority, if any, under which it
is signed or an notarised copy of that power or authority shall be deposited at the Office of the
Company, not less than 48 hours before the time for holding the meetings or adjourned meetings at
which the parson named in the instrument proposed to vote, or in the case of a poll, not less than 24
hours before the time appointed for the taking of the poll; and in default the instrument of proxy shall
not be treated as valid.
71. An instrument appointed a proxy shall be in the form as prescribed in the rules made under Section 105
of the Act.
72. A vote given in accordance with the terms of an instrument of proxy shall be valid, notwithstanding the
previous death or insanity of the principal or the revocation of the proxy or of the authority under
which the proxy was executed or the transfer or the shares in respect of which the proxy is given,
provided that no intimation in writing of such death, insanity, revocation or transfer shall have been
received by the Company at its Office before commencement of the meeting or adjourned meeting at
which the proxy is used.
BOARD OF DIRECTORS
75. The Board of Directors may meet for the conduct of business, adjourn and otherwise regulate its
meetings as it thinks fit. A director may, and the manager or secretary on the requisition of a director
shall, at any time, summon a meeting of the Board.
76. The directors may participate in any meeting of the Board or a committee thereof, through electronic
mode subject to compliance with applicable law.
77. At every annual general meeting of the Company one-third of such of the directors of the time being as
are liable to retire by rotation in accordance with the provisions of Section152 of the Act, or if their
number is not three or a multiple of three, then the number nearest to one third retire from office.
78. (1) The remuneration of be directors shall, in so far as it consists of a monthly payment, be
deemed to accrue from day to day.
(2) In addition to the remuneration payable to them in pursuance to the Act, the directors may be
481
paid all travelling, hotel and other expenses properly incurred by them:
a) In attending and returning from meetings of the Board of Directors or any committee thereof
or general meetings of the Company; or
b) In connection with the business of the Company.
79. The directors shall not be required to hold any qualifications shares in the Company.
80. Subject to the provisions of Sections 149 and 161 of the Act, the Board of Directors shall have
power at any time, and from time to time, to appoint persons as additional directors, provided the
number of additional directors and directors together shall not at any time exceed the maximum
strength fixed for the Board of Directors by the Articles. Such a person shall hold office up to the date
of the next annual general meeting of the Company but shall be eligible for appointment by the
Company as a director at that meeting subject to the provisions of the Act.
81. In the course of its business and for its benefit the Company shall, subject to the provisions of the Act,
be entitled to agree with any person, firm, corporation, government, financing institution or other
authority that he or it shall have the right to appoint his or its nominee on the Board of
Directors of the Company upon such terms and conditions as the directors may deem fit. Such
nominees and their successors in office appointed under this Article shall be called Nominee
Directors. Nominee Directors shall be entitled to hold office until requested to retire by government,
authority, person, firm, institution or corporation who have appointed them and will not be liable to
retire by rotation. As and whenever a Nominee Director vacates office whether upon request as
aforesaid or by death, resignation or otherwise the government, authority, person, form, institution or
corporation who appointed such Nominee Director may if the agreement so provide, appoint another
director in his place.
82. Subject to the provisions of Section 161 of the Act, the Board of Directors shall have power to
appoint a person, not being a person holding any alternate directorship for any other director in the
Company, to act as an alternate director to act for a director during his absence for a period of not less
than three months from India.
83. The directors shall have power, at any time and from time to time, to appoint any qualified person to be
a director to fill a casual vacancy. Such casual vacancy shall be filled by the Board of Directors at a
meeting of the Board. Any person so appointed shall hold office only upon the date up to which the
director in whose place he is appointed would have held office if it had not been vacated as aforesaid
but he shall then be eligible for re-election.
84. The office of a director shall become vacant on the occurrence of any events described in Section 167
of the Act and other relevant provisions if the Act.
85. Every director present at any meeting of the Board of Directors or a committee there of shall sign his
name in a book to be kept for that purpose, to show his attendance there at.
86. The Board of Directors may pay all expenses incurred in the formation, promotion and registration of
the Company.
87. The Company may exercise the powers conferred on it by Section 88 of the Act with regard to the
keeping of a foreign register; and the Board of Directors may (subject to the provisions of that
Section) make and vary such regulations as it may think fit with respect to the keeping of any such
register.
88. The directors may enter into contracts or arrangements on behalf of the Company subject to the
necessary disclosures required by the Act being made wherever any Director is in any way, whether
482
directly or indirectly concerned or interested in the contract or arrangements.
BORROWING POWER
89. Subject to the provisions of Act, including Sections 73, 74, 179 and 180 of the Act, and the rules
framed thereunder, and the regulations thereunder and directions issued by the RBI, the directors
may from time to time at their discretion by a resolution passed at a meeting of the Board, exercise all
the powers of the Company to borrow money and to mortgage or charge its undertaking, property (both
present and future) and uncalled capital, or any part here of and to issue debentures, debenture stock
and other securities whether outright or as security for any debt, liability or obligation of the Company
or of any third party provided however, where the monies, to be borrowed together with the monies
DOUHDG\ERUURZHGDSDUWIURPWHPSRUDU\ORDQVREWDLQHG IURPWKH &RPSDQ\¶VEDQNHUVLQ WKH ordinary
course of business) exceed the aggregate of the paid up capital of the Company and its free reserves
(not being reserves set apart for any specific purpose) the Board of Directors shall not borrow such
monies without the consent of the members in general meeting.
90. The payment or repayment of moneys borrowed as aforesaid may be secured in such manner and
upon such terms and conditions in all respects as the Board of Directors may think fit and in
particular by a resolution passed at a meeting of the Board of Directors, or any committee thereof, if
any, (and not by circulation) by the issue of debenture or debenture stock or other securities of the
Company, charged upon all or any of the property of the Company (both present and future),
including its uncalled capital for the time being.
91. Any debentures, debenture-stock or other securities may be issued at a discount, premium or
otherwise and may be issued on condition that they shall be convertible into shares of any
denomination, and with any privileges and conditions as to redemption, surrender, drawing,
allotment of shares and attending (but not voting) at a general meeting, appointment of directors and
otherwise. Debentures with the right to conversion into or allotment of shares shall be issued only with
the consent of the Company in a general meeting by special resolution.
92. All cheques, promissory notes, drafts, hundies, bills of exchange and other negotiable instruments
and all receipts for moneys paid to the Company, shall be signed, drawn, accepted, endorsed
or otherwise executed, as the case may be, by such person and in such manner as the Board of
Directors may, from time to time, by resolution determine.
105. All related party transactions will be approved by the Board of Directors, and, if applicable, by the
shareholders in a general meeting through a special resolution, in accordance with the provisions of the
Act and rules framed thereunder.
107. The Company in general meeting may declare dividends, but no dividend shall exceed the amount
recommended by the Board.
108. Subject to the provisions of Section 123 of the Act, the Board of Directors may, from time to time, pay
to the members such interim dividends as appear it to be justified by the profits earned by
the Company.
109. (1) The Board of Directors may, before recommending any dividend, set aside out of the profits
of the Company, such sums, as it thinks fit as a reserve or reserves which shall, at the
discretion of the Board, be applicable for any of the purposes to which the profits of the Company
may be properly applied, including provision for meeting contingencies or for equalizing
dividends and pending such applications may at the like discretion either be employed in the
businesses of the Company or be invested in such investments (other than shares of the Company) as
483
the Board of Directors may, from time to time, thinks fit.
(2) The Board of Directors may also carry forward any profits which it may think prudent not to
divide, without setting them aside as a reserve.
110. (1) Subject to the rights of the persons, if any, entitled to shares with special rights as to
dividends, all dividends shall be declared and paid according to the amounts paid or credited as paid on
the shares in respect whereof the dividend is paid, but if and so long as nothing is paid upon any of the
shares in the Company, dividends may be declared and paid according to the amounts of the shares.
(2) No amount paid or credited as paid on a share in advance of calls shall be treated for the
purposes of this Article as having been paid on the share.
(3) All dividends shall be apportioned and paid proportionately to the amounts paid or credited as
paid on the shares during any portion or portions of the period in respect of which the
dividend is paid but if any share is issued on terms providing that it shall rank for dividend as from a
particular date such share shall rank for dividend accordingly.
111. The Board of Directors may deduct from any dividend payable to any member all sums of money, if
any, presently payable by him to the Company on account of calls or otherwise in relation to the shares
of the Company.
112. (1) Any dividend, interest or other moneys payable in cash in respect of shares may be paid by
cheque or warrant sent through the post directed to the reregistered address of the holder or in case of
joint holders, to the registered address of that one of the joint holders who is first named on the register
of member, or to such persons and to such address as the holder or joint holders may in writing direct.
(2) Every such cheque or warrant shall be made payable to the order of the person to whom it is
sent.
113. Any one of two or more joint holders of a share may give effective receipts for any dividends, bonuses
or other moneys payable in respect of such share.
114. Notice of any dividend that may have been declared shall be given to the person entitled to share
therein in the manner mentioned in the Act.
116. Where the Company has declared a dividend but which has not been paid or claimed within 30 days
from the date of declaration, the Company shall, within seven days from the date of expiry of the said
period of 30 days, transfer the total amount of dividend which remains unpaid or unclaimed within the
said period of 30 days, to a special account to be opened by the Company in that behalf in any
VFKHGXOHGEDQNWREHFDOOHG³8QSDLG'LYLGHQGRI&/(GXFDWH/LPLWHG$FFRXQW´
117. Any money transferred to the unpaid dividend account of the Company which remains unpaid
or unclaimed for a period of seven years from the date of such transfer, shall be transferred by
the Company to the Investor Education and Protection Fund established under Section 125 of the Act.
118. No unclaimed or unpaid dividend shall be forfeited by the Board of Directors until the claim becomes
barred by law.
ACCOUNTS
119. (1) The Board of Directors shall cause proper books of accounts to be maintained including under
Section 128 of the Act.
484
(2) The Board of Directors shall, from time to time, determine whether and to what extent and at
what times and places and under what conditions or regulations, the accounts and books of the
Company or any or them, shall be open to the inspection of member not being directors.
(3) No member (not being a director) shall have any right of inspecting any account or book or
document of the Company except as conferred by law or authorized by the Board of Directors or by the
Company in general meeting.
120. Balance sheet and profit of the Company will be audited once in a year by a qualified auditor for
correctness or as required under the Act.
CAPITALISATION OF PROFITS
122. (1) The Company in general meeting may, upon the recommendation of the Board of Directors
resolve
a) that it is desirable to capitalize any part of the amount for the time being standing to the credit
of any of the Company's reserve accounts or to the credit of the Profit and Loss Account, or
otherwise available for distribution; and
b) that such sum be accordingly set free for distribution in the manner specified in clause
(2) among the members who would have been entitled thereto, if distributed by way of
dividend and in the same proportions.
(2) The sum aforesaid shall not be paid in cash, but shall be applied, subject to the provisions
contained in clause (3), either in or towards:
a) paying up may amounts for the time being paid on any shares held by such members
respectively;
b) paying up in full, unissued shares of the Company to be allotted and distributed, credited as
fully paid up, to and amongst such members in the portions aforesaid; or
c) partly in the way specified in sub-clause (a) and partly in that is specified in sub- clause (b).
d) a securities premium account and a capital redemption reserve account may, for the purpose of
this regulation, be applied in the paying up of unissued shares to be issued to members of the
Company as fully paid bonus shares.
e) the Board of Directors shall give effect to the resolution passed by the Company in pursuance
of this Article.
123. (1) Whenever such as resolution as aforesaid shall have been passed, the Board of Directors shall:
a) make all appropriations and applications of the undivided profits resolved to be capitalized
thereby, and all allotments and issues of fully paid shares, if any; and
b) generally do all acts and things required to give effect there to.
485
b) to authorize any person to enter, on behalf of all the members entitled thereto, into an
agreement with the Company providing for the allotment to them respectively, credited as
fully paid-up, of any further shares to which they may be entitled upon such capitalization or
(as the case may require) for the payment by the Company of their behalf, by the application
thereto of their respective proportions of the profit, resolved to be capitalized, of the amounts
or any part of the amounts remaining unpaid on their existing shares.
(3) Any agreement made under such authority shall be effective and binding on all such members.
WINDING UP
124. (1) If the Company shall be wound up, the liquidator may, with the sanction of a special
resolution of the Company, and any other sanction required by the Act, divide amongst the member in
specie or kind, the whole or any part of the assets of the Company, whether they shall consist of
property of the same kind or not.
(2) For the purpose aforesaid, the liquidator may set such values as he deems fair upon any
property to be decided as aforesaid and may determine how such division shall be carried out as
between the members or different classes of members.
(3) The liquidator may, with the like sanction, vest the whole or any part of such assets in
trustees upon such trusts for the benefit of the contributories if he considers necessary, but so that no
member shall be compelled to accept any shares or other securities whereon there is any liability.
INDEMNITY
125. Every officer of the Company shall be indemnified out of the assets of the Company against any
liability incurred by him in defending any proceedings, whether civil or criminal, in which judgment is
given in his favour or in which he is acquitted or in which relief is granted to him by a competent court
or the tribunal.
CHAPTER B
126. The provisions of this Chapter B shall govern the rights and obligations of SPA (as defined below), the
Founders (as defined below) and the Company inter se and, as long as this Chapter B remains a part of
these Articles, in the event of any conflict or inconsistency, the provisions of this Chapter B shall
prevail over the provisions of Chapter A.
127. Except for Article143, the provisions of this Chapter B shall cease to remain in effect and shall fall
away without any further action by any party (including the Company or any of its members),
immediately upon listing and the commencement of trading of the equity shares of the Company on the
Recognized Stock Exchanges (as defined below) pursuant to the initial public offering of equity shares
of the Company through the book building process, in accordance with the provisions of the Securities
and Exchange Board of India (Issue of Capital and Disclosure Requirements) Regulations, 2009 as
amended, the Act and other applicable law.
BOARD OF DIRECTORS
143. The Board shall, comprise of such number of Directors, of whom one (1) Director shall be Mr. Gopal
Jain (or his alternate) or his nominee. Notwithstanding the foregoing, Mr. Gopal Jain shall always have
a right to representation on the Board of Directors of the Company and its committees in
direct proportion to the joint Shareholding Interest of Gaja Capital India Fund ± I, GPE (India) Limited
and Mr. Shantanu Prakash. Provided that so long as Gaja Capital India Fund ± I, GPE (India) Limited
and Mr. Shantanu Prakash, jointly, directly or indirectly through their respective Affiliates, hold
486
an aggregate of 10% of the issued and paid up share capital of the Company, Mr. Gopal Jain shall at all
times be entitled to be appointed, or to nominate a person to be appointed, as a Director on the Board of
Directors of the Company, and the Founders will vote their shares of the Company so that Mr. Gopal
Jain (or his alternate) or his nominee is appointed to the Board of Directors as aforesaid. Mr. Gopal Jain
(or his alternate) or his nominee shall not be liable to retirement by rotation. In addition, the Founders
shall not exercise to vote their shares to remove Mr. Gopal Jain (or his alternate) or his nominee, except
with the consent of Gaja Capital India Fund ± I, GPE (India) Limited and Mr. Gopal Jain. However,
Mr. Gopal Jain may cause the removal of his alternate or nominee director and substitute another
person in his/her place, at any time, with or without cause; and the Founders agree to vote all of their
shares for such removal. In addition, if, at any time, by reason of the death, disability, retirement,
removal (with or without cause), resiJQDWLRQRURWKHUZLVHRI0U*RSDO-DLQ¶VDOWHUQDWHRUQRPLQHH
director, a vacancy in the office of the director has been created, such vacancy shall be filled by Mr.
Gopal Jain.
487
SECTION IX ± OTHER INFORMATION
MATERIAL CONTRACTS AND DOCUMENTS FOR INSPECTION
The following contracts (not being contracts entered into in the ordinary course of business carried on by our
Company or entered into more than two years before the date of the Draft Red Herring Prospectus) which are, or
may be deemed material, have been entered or to be entered into by our Company. These contracts, copies of
which will be attached to the copy of the Red Herring Prospectus delivered to the RoC for registration, and also
the documents for inspection referred to hereunder may be inspected at our Registered Office and our Corporate
Office, from 10.00 am to 4.00 pm on Working Days from the date of the Red Herring Prospectus until the
Bid/Offer Closing Date.
1. Engagement Letter dated September 25, 2014, for appointment of Kotak Mahindra Capital Company
Limited.
2. Offer Agreement dated September 26, 2014 entered into among our Company, the Selling Shareholders
and the BRLM.
3. Agreement dated September 26, 2014, entered into among our Company, the Selling Shareholders and
the Registrar to the Offer.
4. (VFURZ$JUHHPHQWGDWHG>Ɣ@ entered into among our Company, the Selling Shareholders, the BRLM,
the Syndicate Members, Escrow Collection Banks, and the Registrar to the Offer.
5. Syndicate Agreement dDWHG>Ɣ@ entered into among our Company, the Selling Shareholders, the BRLM
and Syndicate Members.
6. 8QGHUZULWLQJ $JUHHPHQW GDWHG >Ɣ@ entered into among our Company, the Selling Shareholders, the
BRLM and Syndicate Members.
1. 6KDUH VXEVFULSWLRQ DQG VKDUHKROGHUV¶ DJUHHPHQW GDWHG 6HSWHPEHU EHWZHHQ *3( ,QGLD
Limited, Mauritius, our individual Promoters and our Company, as amended on March 9, 2011,
November 2, 2012 and August 12, 2014;
2. Share subscription agreement dated September 20, 2007 between Gaja Capital India Fund ± I, our
individual Promoters and our Company as amended on February 11, 2008, March 9, 2011, March 29,
2011, and November 2, 2012; and
3. Share subscripWLRQDQGVKDUHKROGHUV¶DJUHHPHQWGDWHG6HSWHPEHUZLWK6KDQWDQX3UDNDVKour
individual Promoters and our Company.
4. 6KDUHKROGHUV¶DJUHHPHQWGDWHG6HSWHPEHUEHWZHHQ+RXVLQJ'HYHORSPHQW)LQDQFH&RUSRUDWLRQ
Limited, our Company and our individual Promoters.
Material Documents
1. Certified copies of our Memorandum of Association and Articles of Association as amended until date.
2. Certificates of incorporation dated April 25, 1996, June 17, 2000 and March 18, 2011.
3. %RDUGUHVROXWLRQDQGVKDUHKROGHUV¶UHVROXWLRQRIRXU&RPSDQ\GDWHG July 22, 2014 and September 5,
2014, respectively, authorizing the Offer and other related matters.
4. Consent letters of each of the Selling Shareholders authorizing the Offer for Sale.
5. Copies of our annual reports for the five fiscal years.
6. Copy of the Career Launcher Employee Stock Options Plan 2008 as amended.
7. The examination reports of the Auditors, Haribhakti & Co. LLP, Chartered Accountants, on our restated
financial information and statement of tax benefits included in this Draft Red Herring Prospectus.
8. Consent of the Auditors, Haribhakti & Co. LLP, Chartered Accountants, as referred to, in their capacity
and for inclusion of their examination reports on our restated financial information and the statement of
tax benefits in the form and context in which it appears in this Draft Red Herring Prospectus.
9. Certificates, each dated September 22, 2014 from M P R & Co. Chartered Accountants, in relation to
(i) funding working capital requirements of our Company; (ii) pre-payment of a debt facility availed of
by CLIP, our Subsidiary; (iii) investment in CLIP through CLEIS, our Subsidiaries, for capacity
488
expansion and infrastructure development at certain Indus World Schools; and (iv) investment in our
Subsidiary, GKP, for meeting working capital requirements.
10. Consents of Bankers to our Company, the BRLM, Syndicate Members, Registrar to the Offer, Bankers
to the Offer, legal counsel, Directors of our Company, Company Secretary and Compliance Officer,
Chief Financial Officer as referred to act, in their respective capacities and the Auditors for inclusion of
their report on accounts in the form and context in which they appear in this Draft Red Herring
Prospectus.
11. In-SULQFLSOHOLVWLQJDSSURYDOVGDWHG>Ɣ@ and [Ɣ] from BSE and NSE.
12. Tripartite Agreement dated May 19, 2011 among our Company, National Securities Depository
Limited and the Registrar to the Offer.
13. Tripartite Agreement dated August 25, 2014 among our Company, CDSL and the Registrar to the
Offer.
14. Due diligence certificate to SEBI from the BRLM, dated September 26, 2014.
Any of the contracts or documents mentioned in this Draft Red Herring Prospectus may be amended or modified
at any time if so required in the interest of our Company or if required by the other parties, without reference to
the shareholders, subject to compliance with the provisions contained in the Companies Act and other relevant
statutes.
489
DECLARATION
We certify and declare that all relevant provisions of the Companies Act and the rules, regulations and
guidelines issued by the Government of India, or the regulations issued by SEBI, as the case may be, have been
complied with and no statement made in this Draft Red Herring Prospectus is contrary to the provisions of the
Companies Act, the Securities and Exchange Board of India Act, 1992 or the rules or regulations issued
thereunder, as the case may be. We further certify that all the statements in this Draft Red Herring Prospectus
are true and correct.
__________________________ __________________________
Satya Narayanan .R Gautam Puri
(Chairman and Executive Director) (Vice Chairman and Managing Director)
__________________________ __________________________
Nikhil Mahajan Gopal Jain
(Executive Director) (Nominee Director)
__________________________ ________________________
Madhumita Ganguli Sridar A. Iyengar
(Nominee Director) (Independent Director)
__________________________ _________________________
Safir Anand Viraj Tyagi
(Independent Director) (Independent Director)
__________________________ __________________________
Kamil Hasan Sangeeta Bhagwatiprasad Modi
(Independent Director) (Independent Director)
AND
__________________________
Nikhil Mahajan
(Chief Financial Officer)
490
Each Selling Shareholder certifies that all statements made by the respective Selling Shareholder in this Draft
Red Herring Prospectus in relation solely to itself and the Equity Shares offered in the Offer, in connection with
the Offer for Sale, are true and correct. The Selling Shareholders assume no responsibility for any other
statements, including, inter-alia, any of the statements made by or relating to the Company or its business in this
Draft Red Herring Prospectus.
Signed by:
491
Each Selling Shareholder certifies that all statements made by the respective Selling Shareholder in this Draft
Red Herring Prospectus in relation solely to itself and the Equity Shares offered in the Offer, in connection with
the Offer for Sale, are true and correct. The Selling Shareholders assume no responsibility for any other
statements, including, inter-alia, any of the statements made by or relating to the Company or its business in this
Draft Red Herring Prospectus.
For and on behalf of (i) Parul Mahajan; (ii) Nikhil Mahajan HUF; (iii) Arindam Lahiri; (iv) Sanjay
Shivnani; (v) Manav Agarwal; (vi) Rakesh Mittal; (vii) Poonam Mittal; (viii) Akansha Consultancy
Services Limited; (ix) R.V.Subramanian; (x) Vivek Trilokinath; (xi) Narayan Ramachandran; (xii)
Edelweiss Finance & Investments Limited; (xiii) GHIOF Mauritius; and (xiv) Sharad Awasthi; acting
through Gautam Puri, Nikhil Mahajan and Rachna Sharma, power of attorney holders.
Rachna Sharma
(Company Secretary and Compliance Officer)
492
Each Selling Shareholder certifies that all statements made by the respective Selling Shareholder in this Draft
Red Herring Prospectus in relation solely to itself and the Equity Shares offered in the Offer, in connection with
the Offer for Sale, are true and correct. The Selling Shareholders assume no responsibility for any other
statements, including, inter-alia, any of the statements made by or relating to the Company or its business in this
Draft Red Herring Prospectus.
For and on behalf of Gaja Trustee Company Private Limited (as trustee for Gaja Capital India Fund ±I)
493