TECHNICAL SECTION

Q1. typedef struct{ char *; nodeptr next; } * nodeptr ; What does nodeptr stand for?

Q2. What does. int *x[](); means ?

Q3.

struct list{ int x; struct list *next; }*head; the struct head.x =100 Is the above assignment to pointer is correct or wrong ?

Ans. Wrong

Q4.What is the output of the following ? int i; i=1; i=i+2*i++; printf(%d,i); Ans. 4

Q5.

FILE *fp1,*fp2; fp1=fopen("one","w") fp2=fopen("one","w") fputc('A',fp1) fputc('B',fp2) fclose(fp1) fclose(fp2)} a.error b. c. d. Ans. no error. But It will over writes on same file.

What are the output(s) for the following ?

Q6. #include<malloc.h> char *f() {char *s=malloc(8); strcpy(s,"goodbye")} main() { char *f(); printf("%c",*f()='A'); }

Q7.

#define MAN(x,y) (x)>(y)?(x):(y) { int i=10;j=5;k=0; k= MAX(i++,++j) printf(%d %d %d %d,i,j,k) }

Ans. 10 5 0

Q8.

a=10;b=5; c=3;d=3; if(a<b)&&(c=d++) printf(%d %d %d %d a,b,c,d) else printf("%d %d %d %d a,b,c,d);

Q9.

#include<stdarg.h> show(int t,va_list ptr1) { int a,x,i; a=va_arg(ptr1,int) printf("\n %d",a) } display(char) { int x; listptr; va_star(otr,s);

n=va_arg(ptr,int); show(x,ptr); } main() { display("hello",4,12,13,14,44); }

Q10. main() { printf("hello"); fork(); }

Q11.

main() { int i = 10; printf(" %d %d %d \n", ++i, i++, ++i); }

Q12.

#include<stdio.h> main() { int *p, *c, i; i = 5; p = (int*) (malloc(sizeof(i))); printf("\n%d",*p); *p = 10; printf("\n%d %d",i,*p); c = (int*) calloc(2); printf("\n%d\n",*c); }

Q13.

#define MAX(x,y) (x) >(y)?(x):(y) main() { int i=10,j=5,k=0; k= MAX(i++,++j);

printf("%d..%d..%d",i,j,k); }

Q14.

#include <stdio.h> main() { enum _tag{ left=10, right, front=100, back}; printf("left is %d, right is %d, front is %d, back is %d",left,right,front,back); }

Q15.

main() { int a=10,b=20; a>=5?b=100:b=200; printf("%d\n",b); }

Q16.

#define PRINT(int) printf("int = %d ",int) main() { int x,y,z; x=03;y=02;z=01; PRINT(x^x); z<<=3;PRINT(x); y>>=3;PRINT(y); }

Q17.

#include<stdio.h> main() { char s[] = "Bouquets and Brickbats"; printf("\n%c, ",*(&s[2])); printf("%s, ",s+5); printf("\n%s",s); printf("\n%c",*(s+2)); }

Q18. main() { struct s1 { char *str; struct s1 *ptr; }; static struct s1 arr[] = { {"Hyderabad",arr+1}, {"Bangalore",arr+2}, {"Delhi",arr} }; struct s1 *p[3]; int i; for(i=0;i<=2;i++) p[i] = arr[i].ptr; printf("%s\n",(*p)->str); printf("%s\n",(++*p)->str); printf("%s\n",((*p)++)->str); }

Q19. .main() { char *p = "hello world!"; p[0] = 'H'; printf("%s",p); }

TCS Subject: C and COBOL (fwd)

this is the TCS C paper.it actually contains 50 questions.but i am

sending only 43 questions.though 46 questions are available only these are

visible.so it is i am sending 43 only.the set code is 'D'.

1.The C language terminator is a.semicolon b.colon c.period d.exclamation mark 2.What is false about the following A compound statement is a.A set of simple statments b.Demarcated on either side by curly brackets c.Can be used in place of simple statement d.A C function is not a compound statement. 3.What is true about the following C Functions a.Need not return any value b.Should always return an integer c.Should always return a float d.Should always return more than one value. 4.Main must be written as a.the first function in the program b.Second function in the program c.Last function in the program d.any where in the program 5.Which of the following about automatic variables within a function is correct ? a.its type must be declared before using the variable b.they are local

c.they are not initialised to zero d.they are global. 6.Write one statement equalent to the following two statements x=sqr(a); return(x); Choose from one of the alternatives a.return(sqr(a)); b.printf("sqr(a)"); c.return(a*a*a); d.printf("%d",sqr(a)); 7.Which of the following about the C comments is incorrect ? a.commentscan go over multiple lines b.comments can start any where in the line c.a line can contain comments with out any language statements d.comments can occur within comments 8.What is the value of y in the following code? x=7;y=0; if(x=6) y=7; else y=1; a.7 b.0 c.1 d.6 9.Read the function conv() given below

conv(int t) { int u; u=5/9 * (t-32); return(u0; } What a.15 b.0 c.16.1 d.29 10.which of the following represents true statement either x is inthe range of 10 and 50 or y is zero a.x>=10 && x<=50 || y==0; b. c. d. 11.Which of the following is not an infinite loop ? a.while(1){ .... } b.for(;;){ ... } c.x=0; do{

/*x unaltered within theloop*/ ... }while(x==0); d.# define TRUE 0 ... while(TRUE){ .... } 12.what does the following function print? func(int i) { if(i%2)return 0; eale return 1; } main() { int =3; i=func(i); i=func(i); printf("%d",i);} a.3 b.1 c.0 d.2 13.how does the C compiler interpret the following two statements p=p+x;

q=q+y; a.p=p+x; q=q+y b.p=p+xq=q+y c.p=p+xq; q=q+y d.p=p+x/q=q+y

For questions 14,15,16,17 use the following alternatives

a.int b.char c.string BIT

BIT Mesra BIRLASOFT-2003(Technical) set Tech-02

1.What is stub in software testing ?

a) b) c) d)

A dummy sub program A test case,which fails regularly A defect log report A defect ,which is not closed

2. What does 100% code coverage mean while testing software ?

a) b) c) d)

Basic flow of software is tested All critical test cases are tested Each line of code is executed at least once while testing . No while and If loops are tested

3. What does GPF in Windows95 stands for ?

a) b) c) d)

Great Performance Format General Performance Error General Protection Fault Group Performance Frequency

4. Which of the following best fits for testing boundary values ?

a) b) c) d)

Age test box accepts age between 10-20 (both inclusive) Name text box can have any value Date text box should have data in dd/mm/yyyy format Employee Grade text box can have one of the following values L1,M1,E1

5. string somestring; Which of the following choices will convert a standard C++ string object somestring to a C string

a) b) c) d)

somestring.c_str() &somestring[1] Copy.somestring() Std::cstring(something)

6. Which of the following best suites load scenario ?

a) b) c) d)

100 users chatting in a chat application Testing for compulsory fields in a employee details form Checking for date format in date of birth field Registering into www.hotmail.com site

7. What is the function of the modulus operator in most languages ?

a) b) c) d)

Sets a system environmental value to either base 10 ,base 8 or base 16 Returns the remainder after dividing one number by another Returns the first argument raised to the second argument power Prints out the actual code written to standard output rather than executing the code

8. class professor{} class teacher: public virtual professor{}; class researcher: public virtual professor {} class myprofessor :public teacher,public researcher {};

Referring to the sample code above ,if an object of class myprofessor were created ,how many instances of professor will it contain?

a) b) c) d)

0 1 2 3

9. What function will read a specified number of elements from a file ?

a) b) c) d)

fread() readfile() fileread() gets()

10. What is the largest value an integer can hold in a Standard C compiler ?

a) b) c) d)

32767 65536 2147483647 INT_MAX

11. With every use of memory allocation function should be used to release allocated memory which is no longer needed ?

a) b) c) d)

dropmem() dealloc() release() free()

12. Modern RDBMSs perfom the following the following functionc except ______________.

a) b) c) d)

Force column values in one table to match any of the values in a column of another table Automatically replicate data on another server Automatically create new indexes based on query history Prevent unauthorized users from accessing data at the firls level

13. Which is not the characteristics of a view ? a) b) c) d) Consumes Disk space for data Multiple tables Multiple rows Updateable

14. RDBMS triggers are typically bound to a _____________and one or more _____________

a) b) c) d)

Table,SQL statement types SQL statement type,user Column,rows User, tables

15. What relationship is resolved by an intersecting or associative entity ?

a) b) c) d)

Recursive Mandatory one to one Many to Many One to One

16. Select a,b,c,d from vtable where b>2 and c<4 Assuming you will execute the above query often ,changing only the values in the where clause ,what could you do to improve efficiency ?

a) b) c) d)

Create a database stored procedure with parameters to execute this statement Create an index on columns a&b Create a temporary table that contains the data and use triggers to maintain it Create a trigger that executes this statement and execute the trigger

17. Make a copy of file upper in the directory two levels up .

a) b) c) d)

jump 2 upper cp upper ../.. cp upper 2/ None of the above

18. Change the current directory to /usr/local/bin

a) mv /usr/local/bin b) cd /usr/local/bin c) setdir /usr/local/bin d) my/usr/local/bin 19. How do you change the access permission (add group read/write) to all the files in the current directory containing the word cali in their names ?

a) b) c) d)

chmod g+rw *cali* setperm r+w *cali* chmod 0660 *cali* Both A and C

C Questions
Note : All the programs are tested under Turbo C/C++ compilers. It is assumed that, Programs run under DOS environment, The underlying machine is an x86 system, Program is compiled using Turbo C/C++ compiler. The program output may depend on the information based on this assumptions (for example sizeof(int) == 2 may be assumed).

Predict the output or error(s) for the following:

1. void main()

{ int const * p=5; printf("%d",++(*p)); } Answer: Compiler error: Cannot modify a constant value. Explanation: p is a pointer to a "constant integer". But we tried to change the value of the "constant integer". 2. main() { char s[ ]="man"; int i; for(i=0;s[ i ];i++) printf("\n%c%c%c%c",s[ i ],*(s+i),*(i+s),i[s]); } Answer: mmmm aaaa nnnn Explanation: s[i], *(i+s), *(s+i), i[s] are all different ways of expressing the same idea. Generally array name is the base address for that array. Here s is the base address. i is the index number/displacement from the base address. So, indirecting it with * is same as s[i]. i[s] may be surprising. But in the case of C it is same as s[i]. 3. main() { float me = 1.1; double you = 1.1; if(me==you) printf("I love U"); else printf("I hate U"); } Answer: I hate U Explanation: For floating point numbers (float, double, long double) the values cannot be predicted exactly. Depending on the number of bytes, the precession with of the value represented varies. Float takes 4 bytes and long double takes 10 bytes. So float stores 0.9 with less precision than long double. Rule of Thumb: Never compare or at-least be cautious when using floating point numbers with relational operators (== , >, <, <=, >=,!= ) .

4. main() { static int var = 5; printf("%d ",var--); if(var) main(); } Answer: 54321 Explanation: When static storage class is given, it is initialized once. The change in the value of a static variable is retained even between the function calls. Main is also treated like any other ordinary function, which can be called recursively. 5. main() { int c[ ]={2.8,3.4,4,6.7,5}; int j,*p=c,*q=c; for(j=0;j<5;j++) { printf(" %d ",*c); ++q; } for(j=0;j<5;j++){ printf(" %d ",*p); ++p; } } Answer: 2222223465 Explanation: Initially pointer c is assigned to both p and q. In the first loop, since only q is incremented and not c , the value 2 will be printed 5 times. In second loop p itself is incremented. So the values 2 3 4 6 5 will be printed. 6. main() { extern int i; i=20; printf("%d",i); } Answer: Linker Error : Undefined symbol '_i' Explanation: extern storage class in the following declaration, extern int i;

specifies to the compiler that the memory for i is allocated in some other program and that address will be given to the current program at the time of linking. But linker finds that no other variable of name i is available in any other program with memory space allocated for it. Hence a linker error has occurred . 7. main() { int i=-1,j=-1,k=0,l=2,m; m=i++&&j++&&k++||l++; printf("%d %d %d %d %d",i,j,k,l,m); } Answer: 00131 Explanation : Logical operations always give a result of 1 or 0 . And also the logical AND (&&) operator has higher priority over the logical OR (||) operator. So the expression i++ && j++ && k++ is executed first. The result of this expression is 0 (-1 && -1 && 0 = 0). Now the expression is 0 || 2 which evaluates to 1 (because OR operator always gives 1 except for 0 || 0 combination- for which it gives 0). So the value of m is 1. The values of other variables are also incremented by 1. 8. main() { char *p; printf("%d %d ",sizeof(*p),sizeof(p)); } Answer: 12 Explanation: The sizeof() operator gives the number of bytes taken by its operand. P is a character pointer, which needs one byte for storing its value (a character). Hence sizeof(*p) gives a value of 1. Since it needs two bytes to store the address of the character pointer sizeof(p) gives 2. 9. main() { int i=3; switch(i) { default:printf("zero"); case 1: printf("one"); break; case 2:printf("two"); break; case 3: printf("three");

break; } } Answer : three Explanation : The default case can be placed anywhere inside the loop. It is executed only when all other cases doesn't match. 10. main() { printf("%x",-1<<4); } Answer: fff0 Explanation : -1 is internally represented as all 1's. When left shifted four times the least significant 4 bits are filled with 0's.The %x format specifier specifies that the integer value be printed as a hexadecimal value. 11. main() { char string[]="Hello World"; display(string); } void display(char *string) { printf("%s",string); } Answer: Compiler Error : Type mismatch in redeclaration of function display Explanation : In third line, when the function display is encountered, the compiler doesn't know anything about the function display. It assumes the arguments and return types to be integers, (which is the default type). When it sees the actual function display, the arguments and type contradicts with what it has assumed previously. Hence a compile time error occurs. 12. main() { int c=- -2; printf("c=%d",c); } Answer: c=2; Explanation:

Here unary minus (or negation) operator is used twice. Same maths rules applies, ie. minus * minus= plus. Note: However you cannot give like --2. Because -- operator can only be applied to variables as a decrement operator (eg., i--). 2 is a constant and not a variable. 13. #define int char main() { int i=65; printf("sizeof(i)=%d",sizeof(i)); } Answer: sizeof(i)=1 Explanation: Since the #define replaces the string int by the macro char 14. main() { int i=10; i=!i>14; Printf ("i=%d",i); } Answer: i=0

Explanation: In the expression !i>14 , NOT (!) operator has more precedence than > symbol. ! is a unary logical operator. !i (!10) is 0 (not of true is false). 0>14 is false (zero). 15. #include<stdio.h> main() { char s[]={'a','b','c','\n','c','\0'}; char *p,*str,*str1; p=&s[3]; str=p; str1=s; printf("%d",++*p + ++*str1-32); } Answer: 77 Explanation: p is pointing to character '\n'. str1 is pointing to character 'a' ++*p. "p is pointing to '\n' and that is incremented by one." the ASCII value of '\n' is 10, which is then incremented to 11.

The value of ++*p is 11. ++*str1, str1 is pointing to 'a' that is incremented by 1 and it becomes 'b'. ASCII value of 'b' is 98. Now performing (11 + 98 32), we get 77("M"); So we get the output 77 :: "M" (Ascii is 77). 16. #include<stdio.h> main() { int a[2][2][2] = { {10,2,3,4}, {5,6,7,8} }; int *p,*q; p=&a[2][2][2]; *q=***a; printf("%d----%d",*p,*q); } Answer: SomeGarbageValue---1 Explanation: p=&a[2][2][2] you declare only two 2D arrays, but you are trying to access the third 2D(which you are not declared) it will print garbage values. *q=***a starting address of a is assigned integer pointer. Now q is pointing to starting address of a. If you print *q, it will print first element of 3D array. 17. #include<stdio.h> main() { struct xx { int x=3; char name[]="hello"; }; struct xx *s; printf("%d",s->x); printf("%s",s->name); } Answer: Compiler Error Explanation: You should not initialize variables in declaration 18. #include<stdio.h> main() { struct xx { int x; struct yy

{ char s; struct xx *p; }; struct yy *q; }; } Answer: Compiler Error Explanation: The structure yy is nested within structure xx. Hence, the elements are of yy are to be accessed through the instance of structure xx, which needs an instance of yy to be known. If the instance is created after defining the structure the compiler will not know about the instance relative to xx. Hence for nested structure yy you have to declare member. 19. main() { printf("\nab"); printf("\bsi"); printf("\rha"); } Answer: hai Explanation: \n - newline \b - backspace \r - linefeed 20. main() { int i=5; printf("%d%d%d%d%d%d",i++,i--,++i,--i,i); } Answer: 45545 Explanation: The arguments in a function call are pushed into the stack from left to right. The evaluation is by popping out from the stack. and the evaluation is from right to left, hence the result. 21. #define square(x) x*x main() { int i; i = 64/square(4); printf("%d",i);

} Answer: 64 Explanation: the macro call square(4) will substituted by 4*4 so the expression becomes i = 64/4*4 . Since / and * has equal priority the expression will be evaluated as (64/4)*4 i.e. 16*4 = 64
22. main() { char *p="hai friends",*p1; p1=p; while(*p!='\0') ++*p++; printf("%s %s",p,p1); } Answer: ibj!gsjfoet Explanation: ++*p++ will be parse in the given order *p that is value at the location currently pointed by p will be taken ++*p the retrieved value will be incremented when ; is encountered the location will be incremented that is p++ will be executed Hence, in the while loop initial value pointed by p is h, which is changed to i by executing ++*p and pointer moves to point, a which is similarly changed to b and so on. Similarly blank space is converted to !. Thus, we obtain value in p becomes ibj!gsjfoet and since p reaches \0 and p1 points to p thus p1doesnot print anything.

23. #include <stdio.h> #define a 10 main() { #define a 50 printf("%d",a); } Answer: 50 Explanation:

The preprocessor directives can be redefined anywhere in the program. So the most recently assigned value will be taken. 24. #define clrscr() 100 main() { clrscr(); printf("%d\n",clrscr()); } Answer: 100 Explanation: Preprocessor executes as a seperate pass before the execution of the compiler. So textual replacement of clrscr() to 100 occurs.The input program to compiler looks like this : main() { 100; printf("%d\n",100); } Note: 100; is an executable statement but with no action. So it doesn't give any problem 25. main() { printf("%p",main); } Answer: Some address will be printed. Explanation: Function names are just addresses (just like array names are addresses). main() is also a function. So the address of function main will be printed. %p in printf specifies that the argument is an address. They are printed as hexadecimal numbers. 27) main() { clrscr(); } clrscr(); Answer: No output/error Explanation: The first clrscr() occurs inside a function. So it becomes a function call. In the second clrscr(); is a function declaration (because it is not inside any function). 28) enum colors {BLACK,BLUE,GREEN}

main() { printf("%d..%d..%d",BLACK,BLUE,GREEN); return(1); } Answer: 0..1..2 Explanation: enum assigns numbers starting from 0, if not explicitly defined. 29) void main() { char far *farther,*farthest; printf("%d..%d",sizeof(farther),sizeof(farthest)); } Answer: 4..2 Explanation: the second pointer is of char type and not a far pointer 30) main() { int i=400,j=300; printf("%d..%d"); } Answer: 400..300 Explanation: printf takes the values of the first two assignments of the program. Any number of printf's may be given. All of them take only the first two values. If more number of assignments given in the program,then printf will take garbage values. main() { char *p; p="Hello"; printf("%c\n",*&*p); } Answer: H Explanation:

31)

* is a dereference operator & is a reference operator. They can be applied any number of times provided it is meaningful. Here p points to the first character in the string "Hello". *p dereferences it and so its value is H. Again & references it to an address and * dereferences it to the value H. 32) main() { int i=1; while (i<=5) { printf("%d",i); if (i>2) goto here; i++; } } fun() { here: printf("PP"); } Answer: Compiler error: Undefined label 'here' in function main Explanation: Labels have functions scope, in other words The scope of the labels is limited to functions . The label 'here' is available in function fun() Hence it is not visible in function main. main() { static char names[5][20]={"pascal","ada","cobol","fortran","perl"}; int i; char *t; t=names[3]; names[3]=names[4]; names[4]=t; for (i=0;i<=4;i++) printf("%s",names[i]); } Answer: Compiler error: Lvalue required in function main Explanation: Array names are pointer constants. So it cannot be modified. void main() {

33)

34)

int i=5; printf("%d",i++ + ++i); } Answer: Output Cannot be predicted exactly. Explanation: Side effects are involved in the evaluation of i 35) void main() { int i=5; printf("%d",i+++++i); } Answer: Compiler Error Explanation: The expression i+++++i is parsed as i ++ ++ + i which is an illegal combination of operators. #include<stdio.h> main() { int i=1,j=2; switch(i) { case 1: printf("GOOD"); break; case j: printf("BAD"); break; } } Answer: Compiler Error: Constant expression required in function main. Explanation: The case statement can have only constant expressions (this implies that we cannot use variable names directly so an error). Note: Enumerated types can be used in case statements. main() { int i; printf("%d",scanf("%d",&i)); // value 10 is given as input here } Answer: 1

36)

37)

Explanation: Scanf returns number of items successfully read and not 1/0. Here 10 is given as input which should have been scanned successfully. So number of items read is 1. 38) #define f(g,g2) g##g2 main() { int var12=100; printf("%d",f(var,12)); } Answer: 100 main() { int i=0; for(;i++;printf("%d",i)) ; printf("%d",i); } Answer: 1 Explanation: before entering into the for loop the checking condition is "evaluated". Here it evaluates to 0 (false) and comes out of the loop, and i is incremented (note the semicolon after the for loop). 40) #include<stdio.h> main() { char s[]={'a','b','c','\n','c','\0'}; char *p,*str,*str1; p=&s[3]; str=p; str1=s; printf("%d",++*p + ++*str1-32); } Answer: M Explanation: p is pointing to character '\n'.str1 is pointing to character 'a' ++*p meAnswer:"p is pointing to '\n' and that is incremented by one." the ASCII value of '\n' is 10. then it is incremented to 11. the value of ++*p is 11. ++*str1 meAnswer:"str1 is pointing to 'a' that is incremented by 1 and it becomes 'b'. ASCII value of 'b' is 98. both 11 and 98 is added and result is subtracted from 32. i.e. (11+98-32)=77("M");

39)

41)

#include<stdio.h> main() { struct xx { int x=3; char name[]="hello"; }; struct xx *s=malloc(sizeof(struct xx)); printf("%d",s->x); printf("%s",s->name); } Answer: Compiler Error Explanation: Initialization should not be done for structure members inside the structure declaration #include<stdio.h> main() { struct xx { int x; struct yy { char s; struct xx *p; }; struct yy *q; }; } Answer: Compiler Error Explanation: in the end of nested structure yy a member have to be declared. main() { extern int i; i=20; printf("%d",sizeof(i)); } Answer: Linker error: undefined symbol '_i'.

42)

43)

Explanation: extern declaration specifies that the variable i is defined somewhere else. The compiler passes the external variable to be resolved by the linker. So compiler doesn't find an error. During linking the linker searches for the definition of i. Since it is not found the linker flags an error. 44) main() { printf("%d", out); } int out=100; Answer: Compiler error: undefined symbol out in function main. Explanation: The rule is that a variable is available for use from the point of declaration. Even though a is a global variable, it is not available for main. Hence an error. main() { extern out; printf("%d", out); } int out=100; Answer: 100 Explanation: This is the correct way of writing the previous program. main() { show(); } void show() { printf("I'm the greatest"); } Answer: Compier error: Type mismatch in redeclaration of show. Explanation: When the compiler sees the function show it doesn't know anything about it. So the default return type (ie, int) is assumed. But when compiler sees the actual definition of show mismatch occurs since it is declared as void. Hence the error. The solutions are as follows: 1. declare void show() in main() . 2. define show() before main(). 3. declare extern void show() before the use of show().

45)

46)

47)

main( ) { int a[2][3][2] = {{{2,4},{7,8},{3,4}},{{2,2},{2,3},{3,4}}}; printf(%u %u %u %d \n,a,*a,**a,***a); printf(%u %u %u %d \n,a+1,*a+1,**a+1,***a+1); } Answer: 100, 100, 100, 2 114, 104, 102, 3

Explanation:
The given array is a 3-D one. It can also be viewed as a 1-D array.

100 102 104 106 108 110 112 114 116 118 120 122

thus, for the first printf statement a, *a, **a give address of first element . since the indirection ***a gives the value. Hence, the first line of the output. for the second printf a+1 increases in the third dimension thus points to value at 114, *a+1 increments in second dimension thus points to 104, **a +1 increments the first dimension thus points to 102 and ***a+1 first gets the value at first location and then increments it by 1. Hence, the output.

48)

main( ) { int a[ ] = {10,20,30,40,50},j,*p; for(j=0; j<5; j++) { printf(%d ,*a);

a++; } p = a; for(j=0; j<5; j++) { printf(%d ,*p); p++; } }

Answer: Compiler error: lvalue required. Explanation:

Error is in line with statement a++. The operand must be an lvalue and may be of any of scalar type for the any operator, array name only when subscripted is an lvalue. Simply array name is a non-modifiable lvalue.

49)

main( ) { static int a[ ] = {0,1,2,3,4}; int *p[ ] = {a,a+1,a+2,a+3,a+4}; int **ptr = p; ptr++; printf(\n %d %d %d, ptr-p, *ptr-a, **ptr); *ptr++; printf(\n %d %d %d, ptr-p, *ptr-a, **ptr); *++ptr; printf(\n %d %d %d, ptr-p, *ptr-a, **ptr); ++*ptr;

printf(\n %d %d %d, ptr-p, *ptr-a, **ptr); } Answer: 111 222 333 344

Explanation:
Let us consider the array and the two pointers with some address a 0 100 1 102 2 104 106 3 108 p 100 1000 102 1002 ptr 1000 2000 104 1004 106 1006 108 4

1008

After execution of the instruction ptr++ value in ptr becomes 1002, if scaling factor for integer is 2 bytes. Now ptr p is value in ptr starting location of array p, (1002 1000) / (scaling factor) = 1, *ptr a = value at address pointed by ptr starting value of array a, 1002 has a value 102 so the value is (102 100)/(scaling factor) = 1, **ptr is the value stored in the location pointed by the pointer of ptr = value pointed by value pointed by 1002 = value pointed by 102 = 1. Hence the output of the firs printf is 1, 1, 1. After execution of *ptr++ increments value of the value in ptr by scaling factor, so it becomes1004. Hence, the outputs for the second printf are ptr p = 2, *ptr a = 2, **ptr = 2. After execution of *++ptr increments value of the value in ptr by scaling factor, so it becomes1004. Hence, the outputs for the third printf are ptr p = 3, *ptr a = 3, **ptr = 3. After execution of ++*ptr value in ptr remains the same, the value pointed by the value is incremented by the scaling factor. So the value in array p at location

1006 changes from 106 10 108,. Hence, the outputs for the fourth printf are ptr p = 1006 1000 = 3, *ptr a = 108 100 = 4, **ptr = 4.
50) main( ) { char *q; int j; for (j=0; j<3; j++) scanf(%s ,(q+j)); for (j=0; j<3; j++) printf(%c ,*(q+j)); for (j=0; j<3; j++) printf(%s ,(q+j)); }

Explanation:
Here we have only one pointer to type char and since we take input in the same pointer thus we keep writing over in the same location, each time shifting the pointer value by 1. Suppose the inputs are MOUSE, TRACK and VIRTUAL. Then for the first input suppose the pointer starts at location 100 then the input one is stored as

\0

When the second input is given the pointer is incremented as j value becomes 1, so the input is filled in memory starting from 101.

M M

T T

R V

A I

C R

\0 T U A L
\0

The third input starts filling from the location 102

This is the final value stored . The first printf prints the values at the position q, q+1 and q+2 = M T V The second printf prints three strings starting from locations q, q+1, q+2 i.e MTVIRTUAL, TVIRTUAL and VIRTUAL.

51)

main( ) { void *vp;

char ch = g, *cp = goofy; int j = 20; vp = &ch; printf(%c, *(char *)vp); vp = &j; printf(%d,*(int *)vp); vp = cp; printf(%s,(char *)vp + 3); } Answer: g20fy

Explanation:
Since a void pointer is used it can be type casted to any other type pointer. vp = &ch stores address of char ch and the next statement prints the value stored in vp after type casting it to the proper data type pointer. the output is g. Similarly the output from second printf is 20. The third printf statement type casts it to print the string from the 4th value hence the output is fy.

52)

main ( ) { static char *s[ ] = {black, white, yellow, violet}; char **ptr[ ] = {s+3, s+2, s+1, s}, ***p; p = ptr; **++p; printf(%s,*--*++p + 3); } Answer: ck

Explanation: In this problem we have an array of char pointers pointing to start of 4 strings. Then we have ptr which is a pointer to a pointer of type char and a variable p which is a pointer to a pointer to a pointer of type char. p hold the initial value of ptr, i.e. p = s+3. The next statement increment value in p by 1 , thus now value of p = s+2. In the printf statement the expression is evaluated *++p causes gets value s+1 then the pre decrement is executed and we get s+1 1 = s . the indirection operator now gets the value from the array of s and adds 3 to the starting address. The string is printed starting from this position. Thus, the output is ck.
53) main() { int i, n; char *x = girl; n = strlen(x); *x = x[n]; for(i=0; i<n; ++i) { printf(%s\n,x); x++; } }

Answer: (blank space)

irl rl l

Explanation:

Here a string (a pointer to char) is initialized with a value girl. The strlen function returns the length of the string, thus n has a value 4. The next statement assigns value at the nth location (\0) to the first location. Now the string becomes \0irl . Now the printf statement prints the string after each iteration it

increments it starting position. Loop starts from 0 to 4. The first time x[0] = \0 hence it prints nothing and pointer value is incremented. The second time it prints from x[1] i.e irl and the third time it prints rl and the last time it prints l and the loop terminates. 54) int i,j; for(i=0;i<=10;i++) { j+=5; assert(i<5); } Answer: Runtime error: Abnormal program termination. assert failed (i<5), <file name>,<line number> Explanation: asserts are used during debugging to make sure that certain conditions are satisfied. If assertion fails, the program will terminate reporting the same. After debugging use, #undef NDEBUG and this will disable all the assertions from the source code. Assertion is a good debugging tool to make use of. main() { int i=-1; +i; printf("i = %d, +i = %d \n",i,+i); } Answer: i = -1, +i = -1 Explanation: Unary + is the only dummy operator in C. Where-ever it comes you can just ignore it just because it has no effect in the expressions (hence the name dummy operator). What are the files which are automatically opened when a C file is executed? Answer: stdin, stdout, stderr (standard input,standard output,standard error).

55)

56)

57) what will be the position of the file marker? a: fseek(ptr,0,SEEK_SET); b: fseek(ptr,0,SEEK_CUR); Answer : a: The SEEK_SET sets the file position marker to the starting of the file. b: The SEEK_CUR sets the file position marker to the current position of the file.

58)

main() { char name[10],s[12]; scanf(" \"%[^\"]\"",s); } How scanf will execute? Answer: First it checks for the leading white space and discards it.Then it matches with a quotation mark and then it reads all character upto another quotation mark. What is the problem with the following code segment? while ((fgets(receiving array,50,file_ptr)) != EOF) ; Answer & Explanation: fgets returns a pointer. So the correct end of file check is checking for != NULL. main() { main(); } Answer: Runtime error : Stack overflow. Explanation: main function calls itself again and again. Each time the function is called its return address is stored in the call stack. Since there is no condition to terminate the function call, the call stack overflows at runtime. So it terminates the program and results in an error. main() { char *cptr,c; void *vptr,v; c=10; v=0; cptr=&c; vptr=&v; printf("%c%v",c,v); } Answer: Compiler error (at line number 4): size of v is Unknown. Explanation: You can create a variable of type void * but not of type void, since void is an empty type. In the second line you are creating variable vptr of type void * and v of type void hence an error. main() {

59)

60)

61)

62)

char *str1="abcd"; char str2[]="abcd"; printf("%d %d %d",sizeof(str1),sizeof(str2),sizeof("abcd")); } Answer: 255 Explanation: In first sizeof, str1 is a character pointer so it gives you the size of the pointer variable. In second sizeof the name str2 indicates the name of the array whose size is 5 (including the '\0' termination character). The third sizeof is similar to the second one. 63) main() { char not; not=!2; printf("%d",not); } Answer: 0 Explanation: ! is a logical operator. In C the value 0 is considered to be the boolean value FALSE, and any non-zero value is considered to be the boolean value TRUE. Here 2 is a non-zero value so TRUE. !TRUE is FALSE (0) so it prints 0. #define FALSE -1 #define TRUE 1 #define NULL 0 main() { if(NULL) puts("NULL"); else if(FALSE) puts("TRUE"); else puts("FALSE"); } Answer: TRUE Explanation: The input program to the compiler after processing by the preprocessor is, main(){ if(0) puts("NULL"); else if(-1) puts("TRUE"); else

64)

puts("FALSE"); } Preprocessor doesn't replace the values given inside the double quotes. The check by if condition is boolean value false so it goes to else. In second if -1 is boolean value true hence "TRUE" is printed. 65) main() { int k=1; printf("%d==1 is ""%s",k,k==1?"TRUE":"FALSE"); } Answer: 1==1 is TRUE Explanation: When two strings are placed together (or separated by white-space) they are concatenated (this is called as "stringization" operation). So the string is as if it is given as "%d==1 is %s". The conditional operator( ?: ) evaluates to "TRUE". main() { int y; scanf("%d",&y); // input given is 2000 if( (y%4==0 && y%100 != 0) || y%100 == 0 ) printf("%d is a leap year"); else printf("%d is not a leap year"); } Answer: 2000 is a leap year Explanation: An ordinary program to check if leap year or not. #define max 5 #define int arr1[max] main() { typedef char arr2[max]; arr1 list={0,1,2,3,4}; arr2 name="name"; printf("%d %s",list[0],name); } Answer: Compiler error (in the line arr1 list = {0,1,2,3,4}) Explanation: arr2 is declared of type array of size 5 of characters. So it can be used to declare the variable name of the type arr2. But it is not the case of arr1. Hence an error.

66)

67)

Rule of Thumb: #defines are used for textual replacement whereas typedefs are used for declaring new types. 68) int i=10; main() { extern int i; { int i=20; { const volatile unsigned i=30; printf("%d",i); } printf("%d",i); } printf("%d",i); } Answer: 30,20,10 Explanation: '{' introduces new block and thus new scope. In the innermost block i is declared as, const volatile unsigned which is a valid declaration. i is assumed of type int. So printf prints 30. In the next block, i has value 20 and so printf prints 20. In the outermost block, i is declared as extern, so no storage space is allocated for it. After compilation is over the linker resolves it to global variable i (since it is the only variable visible there). So it prints i's value as 10. main() { int *j; { int i=10; j=&i; } printf("%d",*j); } Answer: 10 Explanation: The variable i is a block level variable and the visibility is inside that block only. But the lifetime of i is lifetime of the function so it lives upto the exit of main function. Since the i is still allocated space, *j prints the value stored in i since j points i.

69)

70)

main() { int i=-1; -i; printf("i = %d, -i = %d \n",i,-i); } Answer: i = -1, -i = 1 Explanation: -i is executed and this execution doesn't affect the value of i. In printf first you just print the value of i. After that the value of the expression -i = -(-1) is printed. #include<stdio.h> main() { const int i=4; float j; j = ++i; printf("%d %f", i,++j); } Answer: Compiler error Explanation: i is a constant. you cannot change the value of constant #include<stdio.h> main() { int a[2][2][2] = { {10,2,3,4}, {5,6,7,8} }; int *p,*q; p=&a[2][2][2]; *q=***a; printf("%d..%d",*p,*q); } Answer: garbagevalue..1 Explanation: p=&a[2][2][2] you declare only two 2D arrays. but you are trying to access the third 2D(which you are not declared) it will print garbage values. *q=***a starting address of a is assigned integer pointer. now q is pointing to starting address of a.if you print *q meAnswer:it will print first element of 3D array. #include<stdio.h> main() {

71)

72)

73)

register i=5; char j[]= "hello"; printf("%s %d",j,i); } Answer: hello 5 Explanation: if you declare i as register compiler will treat it as ordinary integer and it will take integer value. i value may be stored either in register or in memory. 74) main() { int i=5,j=6,z; printf("%d",i+++j); } Answer: 11 Explanation: the expression i+++j is treated as (i++ + j) struct aaa{ struct aaa *prev; int i; struct aaa *next; }; main() { struct aaa abc,def,ghi,jkl; int x=100; abc.i=0;abc.prev=&jkl; abc.next=&def; def.i=1;def.prev=&abc;def.next=&ghi; ghi.i=2;ghi.prev=&def; ghi.next=&jkl; jkl.i=3;jkl.prev=&ghi;jkl.next=&abc; x=abc.next->next->prev->next->i; printf("%d",x); } Answer: 2 Explanation: above all statements form a double circular linked list; abc.next->next->prev->next->i this one points to "ghi" node the value of at particular node is 2. struct point

76)

77)

{ int x; int y; }; struct point origin,*pp; main() { pp=&origin; printf("origin is(%d%d)\n",(*pp).x,(*pp).y); printf("origin is (%d%d)\n",pp->x,pp->y); } Answer: origin is(0,0) origin is(0,0) Explanation: pp is a pointer to structure. we can access the elements of the structure either with arrow mark or with indirection operator. Note: Since structure point is globally declared x & y are initialized as zeroes 78) main() { int i=_l_abc(10); printf("%d\n",--i); } int _l_abc(int i) { return(i++); } Answer: 9 Explanation: return(i++) it will first return i and then increments. i.e. 10 will be returned. main() { char *p; int *q; long *r; p=q=r=0; p++; q++; r++; printf("%p...%p...%p",p,q,r); }

79)

Answer: 0001...0002...0004 Explanation: ++ operator when applied to pointers increments address according to their corresponding data-types. 80) main() { char c=' ',x,convert(z); getc(c); if((c>='a') && (c<='z')) x=convert(c); printf("%c",x); } convert(z) { return z-32; } Answer: Compiler error Explanation: declaration of convert and format of getc() are wrong. main(int argc, char **argv) { printf("enter the character"); getchar(); sum(argv[1],argv[2]); } sum(num1,num2) int num1,num2; { return num1+num2; } Answer: Compiler error. Explanation: argv[1] & argv[2] are strings. They are passed to the function sum without converting it to integer values. # include <stdio.h> int one_d[]={1,2,3}; main() { int *ptr; ptr=one_d;

81)

82)

ptr+=3; printf("%d",*ptr); } Answer: garbage value Explanation: ptr pointer is pointing to out of the array range of one_d. 83) # include<stdio.h> aaa() { printf("hi"); } bbb(){ printf("hello"); } ccc(){ printf("bye"); } main() { int (*ptr[3])(); ptr[0]=aaa; ptr[1]=bbb; ptr[2]=ccc; ptr[2](); } Answer: bye Explanation: ptr is array of pointers to functions of return type int.ptr[0] is assigned to address of the function aaa. Similarly ptr[1] and ptr[2] for bbb and ccc respectively. ptr[2]() is in effect of writing ccc(), since ptr[2] points to ccc. #include<stdio.h> main() { FILE *ptr; char i; ptr=fopen("zzz.c","r"); while((i=fgetch(ptr))!=EOF) printf("%c",i); } Answer: contents of zzz.c followed by an infinite loop Explanation: The condition is checked against EOF, it should be checked against NULL.

85)

86)

main() { int i =0;j=0; if(i && j++) printf("%d..%d",i++,j); printf("%d..%d,i,j); } Answer: 0..0 Explanation: The value of i is 0. Since this information is enough to determine the truth value of the boolean expression. So the statement following the if statement is not executed. The values of i and j remain unchanged and get printed. main() { int i; i = abc(); printf("%d",i); } abc() { _AX = 1000; } Answer: 1000 Explanation: Normally the return value from the function is through the information from the accumulator. Here _AH is the pseudo global variable denoting the accumulator. Hence, the value of the accumulator is set 1000 so the function returns value 1000. int i; main(){ int t; for ( t=4;scanf("%d",&i)-t;printf("%d\n",i)) printf("%d--",t--); } // If the inputs are 0,1,2,3 find the o/p Answer: 4--0 3--1 2--2 Explanation: Let us assume some x= scanf("%d",&i)-t the values during execution

87)

88)

will be, t i x 4 0 -4 3 1 -2 2 2 0 89) main(){ int a= 0;int b = 20;char x =1;char y =10; if(a,b,x,y) printf("hello"); } Answer: hello Explanation: The comma operator has associativity from left to right. Only the rightmost value is returned and the other values are evaluated and ignored. Thus the value of last variable y is returned to check in if. Since it is a non zero value if becomes true so, "hello" will be printed. main(){ unsigned int i; for(i=1;i>-2;i--) printf("c aptitude"); } Explanation: i is an unsigned integer. It is compared with a signed value. Since the both types doesn't match, signed is promoted to unsigned value. The unsigned equivalent of 2 is a huge value so condition becomes false and control comes out of the loop. In the following pgm add a stmt in the function fun such that the address of 'a' gets stored in 'j'. main(){ int * j; void fun(int **); fun(&j); } void fun(int **k) { int a =0; /* add a stmt here*/ } Answer: *k = &a Explanation: The argument of the function is a pointer to a pointer. What are the following notations of defining functions known as?

90)

91)

92)

i.

int abc(int a,float b) { /* some code */ } ii. int abc(a,b) int a; float b; { /* some code*/ } Answer: i. ANSI C notation ii. Kernighan & Ritche notation 93) main() { char *p; p="%d\n"; p++; p++; printf(p-2,300); } Answer: 300 Explanation: The pointer points to % since it is incremented twice and again decremented by 2, it points to '%d\n' and 300 is printed. main(){ char a[100]; a[0]='a';a[1]]='b';a[2]='c';a[4]='d'; abc(a); } abc(char a[]){ a++; printf("%c",*a); a++; printf("%c",*a); } Explanation: The base address is modified only in function and as a result a points to 'b' then after incrementing to 'c' so bc will be printed. func(a,b) int a,b; { return( a= (a==b) );

94)

95)

} main() { int process(),func(); printf("The value of process is %d !\n ",process(func,3,6)); } process(pf,val1,val2) int (*pf) (); int val1,val2; { return((*pf) (val1,val2)); } Answer: The value if process is 0 ! Explanation: The function 'process' has 3 parameters - 1, a pointer to another function 2 and 3, integers. When this function is invoked from main, the following substitutions for formal parameters take place: func for pf, 3 for val1 and 6 for val2. This function returns the result of the operation performed by the function 'func'. The function func has two integer parameters. The formal parameters are substituted as 3 for a and 6 for b. since 3 is not equal to 6, a==b returns 0. therefore the function returns 0 which in turn is returned by the function 'process'.
96) void main() { static int i=5; if(--i){ main(); printf("%d ",i); } }

Answer:
0000

Explanation:
The variable "I" is declared as static, hence memory for I will be allocated for only once, as it encounters the statement. The function main() will be called recursively unless I becomes equal to 0, and since main() is recursively called, so the value of static I ie., 0 will be printed every time the control is returned.

97)

void main() { int k=ret(sizeof(float)); printf("\n here value is %d",++k); } int ret(int ret) { ret += 2.5; return(ret); } Answer: Here value is 7

Explanation: The int ret(int ret), ie., the function name and the argument name can be the same.
Firstly, the function ret() is called in which the sizeof(float) ie., 4 is passed, after the first expression the value in ret will be 6, as ret is integer hence the value stored in ret will have implicit type conversion from float to int. The ret is returned in main() it is printed after and preincrement.

98)

void main() { char a[]="12345\0"; int i=strlen(a); printf("here in 3 %d\n",++i); } Answer: here in 3 6

Explanation:

The char array 'a' will hold the initialized string, whose length will be counted from 0 till the null character. Hence the 'I' will hold the value equal to 5, after the pre-increment in the printf statement, the 6 will be printed.

99)

void main() { unsigned giveit=-1; int gotit; printf("%u ",++giveit); printf("%u \n",gotit=--giveit); } Answer: 0 65535

Explanation:
100) void main() { int i; char a[]="\0"; if(printf("%s\n",a)) printf("Ok here \n"); else printf("Forget it\n"); } Answer: Ok here

Explanation:

Printf will return how many characters does it print. Hence printing a null character returns 1 which makes the if statement true, thus "Ok here" is printed.

101)

void main() { void *v; int integer=2; int *i=&integer; v=i; printf("%d",(int*)*v); } Answer: Compiler Error. We cannot apply indirection on type void*.

Explanation:
Void pointer is a generic pointer type. No pointer arithmetic can be done on it. Void pointers are normally used for, 1. Passing generic pointers to functions and returning such pointers. 2. As a intermediate pointer type. 3. Used when the exact pointer type will be known at a later point of time. 102) void main() { int i=i++,j=j++,k=k++; printf(%d%d%d,i,j,k); } Answer: Garbage values.

Explanation:
An identifier is available to use in program code from the point of its declaration.

So expressions such as i = i++ are valid statements. The i, j and k are automatic variables and so they contain some garbage value. Garbage in is garbage out (GIGO).

103)

void main() { static int i=i++, j=j++, k=k++; printf(i = %d j = %d k = %d, i, j, k); } Answer: i=1j=1k=1

Explanation: Since static variables are initialized to zero by default.

104) void main() { while(1){ if(printf("%d",printf("%d"))) break; else continue; } } Answer: Garbage values

Explanation: The inner printf executes first to print some garbage value. The printf returns no of characters printed and this value also cannot be predicted. Still the outer printf prints something and so returns a non-zero value. So it encounters the break statement and comes out of the while statement.

104)

main() { unsigned int i=10; while(i-->=0) printf("%u ",i);

} Answer: 10 9 8 7 6 5 4 3 2 1 0 65535 65534..

Explanation:
Since i is an unsigned integer it can never become negative. So the expression i-- >=0 will always be true, leading to an infinite loop.

105)

#include<conio.h> main() { int x,y=2,z,a; if(x=y%2) z=2; a=2; printf("%d %d ",z,x); } Answer: Garbage-value 0

Explanation: The value of y%2 is 0. This value is assigned to x. The condition reduces to if (x) or in other words if(0) and so z goes uninitialized. Thumb Rule: Check all control paths to write bug free code.
106) main()

{ int a[10]; printf("%d",*a+1-*a+3); } Answer: 4

Explanation:
*a and -*a cancels out. The result is as simple as 1 + 3 = 4 !

107)

#define prod(a,b) a*b main() { int x=3,y=4; printf("%d",prod(x+2,y-1)); } Answer: 10

Explanation:
The macro expands and evaluates to as: x+2*y-1 => x+(2*y)-1 => 10

108)

main() { unsigned int i=65000; while(i++!=0); printf("%d",i); }

Answer: 1

Explanation:
Note the semicolon after the while statement. When the value of i becomes 0 it comes out of while loop. Due to post-increment on i the value of i while printing is 1.

109)

main() { int i=0; while(+(+i--)!=0) i-=i++; printf("%d",i); } Answer: -1

Explanation:
Unary + is the only dummy operator in C. So it has no effect on the expression and now the while loop is, while(i--!=0) which is false and so breaks out of while loop. The value 1 is printed due to the post-decrement operator.

113)

main() { float f=5,g=10; enum{i=10,j=20,k=50}; printf("%d\n",++k); printf("%f\n",f<<2); printf("%lf\n",f%g); printf("%lf\n",fmod(f,g));

} Answer: Line no 5: Error: Lvalue required Line no 6: Cannot apply leftshift to float Line no 7: Cannot apply mod to float

Explanation:
Enumeration constants cannot be modified, so you cannot apply ++. Bit-wise operators and % operators cannot be applied on float values. fmod() is to find the modulus values for floats as % operator is for ints.

110)

main() { int i=10;

void pascal f(int,int,int);

f(i++,i++,i++); printf(" %d",i); } void pascal f(integer :i,integer:j,integer :k) { write(i,j,k); } Answer: Compiler error: unknown type integer Compiler error: undeclared function write

Explanation:
Pascal keyword doesnt mean that pascal code can be used. It means that the function follows Pascal argument passing mechanism in calling the functions.

111)

void pascal f(int i,int j,int k) { printf(%d %d %d,i, j, k); } void cdecl f(int i,int j,int k) { printf(%d %d %d,i, j, k); } main() { int i=10;

f(i++,i++,i++);
printf(" %d\n",i); i=10;

f(i++,i++,i++);
printf(" %d",i); } Answer: 10 11 12 13 12 11 10 13

Explanation:
Pascal argument passing mechanism forces the arguments to be called from left to right. cdecl is the normal C argument passing mechanism where the arguments are passed from right to left.

112). What is the output of the program given below

main() {

signed char i=0; for(;i>=0;i++) ; printf("%d\n",i); } Answer -128 Explanation Notice the semicolon at the end of the for loop. THe initial value of the i is set to 0. The inner loop executes to increment the value from 0 to 127 (the positive range of char) and then it rotates to the negative value of -128. The condition in the for loop fails and so comes out of the for loop. It prints the current value of i that is -128.

113) main() { unsigned char i=0; for(;i>=0;i++) ; printf("%d\n",i); } Answer infinite loop Explanation The difference between the previous question and this one is that the char is declared to be unsigned. So the i++ can never yield negative value and i>=0 never becomes false so that it can come out of the for loop.

114) main() { char i=0;

for(;i>=0;i++) ; printf("%d\n",i);

} Answer: Behavior is implementation dependent. Explanation: The detail if the char is signed/unsigned by default is implementation dependent. If the implementation treats the char to be signed by default the program will print 128 and terminate. On the other hand if it considers char to be unsigned by default, it goes to infinite loop. Rule: You can write programs that have implementation dependent behavior. But dont write programs that depend on such behavior.

115) Is the following statement a declaration/definition. Find what does it mean? int (*x)[10]; Answer Definition. x is a pointer to array of(size 10) integers.

Apply clock-wise rule to find the meaning of this definition.

116). What is the output for the program given below

typedef enum errorType{warning, error, exception,}error; main()

{ error g1; g1=1; printf("%d",g1); } Answer Compiler error: Multiple declaration for error Explanation The name error is used in the two meanings. One means that it is a enumerator constant with value 1. The another use is that it is a type name (due to typedef) for enum errorType. Given a situation the compiler cannot distinguish the meaning of error to know in what sense the error is used: error g1; g1=error; // which error it refers in each case? When the compiler can distinguish between usages then it will not issue error (in pure technical terms, names can only be overloaded in different namespaces). Note: the extra comma in the declaration, enum errorType{warning, error, exception,} is not an error. An extra comma is valid and is provided just for programmers convenience.

117)

typedef struct error{int warning, error, exception;}error; main() { error g1; g1.error =1;

printf("%d",g1.error); }

Answer 1 Explanation The three usages of name errors can be distinguishable by the compiler at any instance, so valid (they are in different namespaces). Typedef struct error{int warning, error, exception;}error; This error can be used only by preceding the error by struct kayword as in: struct error someError; typedef struct error{int warning, error, exception;}error; This can be used only after . (dot) or -> (arrow) operator preceded by the variable name as in : g1.error =1; printf("%d",g1.error); typedef struct error{int warning, error, exception;}error; This can be used to define variables without using the preceding struct keyword as in: error g1; Since the compiler can perfectly distinguish between these three usages, it is perfectly legal and valid.

Note This code is given here to just explain the concept behind. In real programming dont use such overloading of names. It reduces the readability of the code. Possible doesnt mean that we should use it!

118)

#ifdef something int some=0;

#endif

main() { int thing = 0; printf("%d %d\n", some ,thing); }

Answer: Compiler error : undefined symbol some Explanation: This is a very simple example for conditional compilation. The name something is not already known to the compiler making the declaration int some = 0; effectively removed from the source code.

119)

#if something == 0 int some=0; #endif

main() { int thing = 0; printf("%d %d\n", some ,thing); }

Answer

00 Explanation This code is to show that preprocessor expressions are not the same as the ordinary expressions. If a name is not known the preprocessor treats it to be equal to zero.

120). What is the output for the following program

main() { int arr2D[3][3]; printf("%d\n", ((arr2D==* arr2D)&&(* arr2D == arr2D[0])) ); } Answer 1 Explanation This is due to the close relation between the arrays and pointers. N dimensional arrays are made up of (N-1) dimensional arrays. arr2D is made up of a 3 single arrays that contains 3 integers each . arr2D arr2D[1]

arr2D[2] arr2D[3]

The name arr2D refers to the beginning of all the 3 arrays. *arr2D refers to the start of the first 1D array (of 3 integers) that is the same address as arr2D. So the expression (arr2D == *arr2D) is true (1). Similarly, *arr2D is nothing but *(arr2D + 0), adding a zero doesnt change the value/meaning. Again arr2D[0] is the another way of telling *(arr2D + 0). So the expression (*(arr2D + 0) == arr2D[0]) is true (1). Since both parts of the expression evaluates to true the result is true(1) and the same is printed.

121) void main() { if(~0 == (unsigned int)-1) printf(You can answer this if you know how values are represented in memory); } Answer You can answer this if you know how values are represented in memory Explanation ~ (tilde operator or bit-wise negation operator) operates on 0 to produce all ones to fill the space for an integer. 1 is represented in unsigned value as all 1s and so both are equal.

122) int swap(int *a,int *b) { *a=*a+*b;*b=*a-*b;*a=*a-*b; } main() { int x=10,y=20; swap(&x,&y);

printf("x= %d y = %d\n",x,y); } Answer x = 20 y = 10 Explanation This is one way of swapping two values. Simple checking will help understand this.

123)

main()
{ char *p = ayqm; printf(%c,++*(p++)); } Answer: b

124)

main() { int i=5; printf("%d",++i++); } Answer: Compiler error: Lvalue required in function main Explanation:
++i yields an rvalue. For postfix ++ to operate an lvalue is required.

125)

main() { char *p = ayqm; char c; c = ++*p++;

printf(%c,c); }

Answer:
b

Explanation:
There is no difference between the expression ++*(p++) and ++*p++. Parenthesis just works as a visual clue for the reader to see which expression is first evaluated.

126) int aaa() {printf(Hi);} int bbb(){printf(hello);} iny ccc(){printf(bye);}

main() { int ( * ptr[3]) (); ptr[0] = aaa; ptr[1] = bbb; ptr[2] =ccc; ptr[2](); } Answer: bye Explanation: int (* ptr[3])() says that ptr is an array of pointers to functions that takes no arguments and returns the type int. By the assignment ptr[0] = aaa; it means that the first function pointer in the array is initialized with the address of the function aaa. Similarly, the other two array elements also get initialized with the addresses of the functions bbb and ccc.

Since ptr[2] contains the address of the function ccc, the call to the function ptr[2]() is same as calling ccc(). So it results in printing "bye".

127) main() { int i=5; printf(%d,i=++i ==6); }

Answer: 1 Explanation: The expression can be treated as i = (++i==6), because == is of higher precedence than = operator. In the inner expression, ++i is equal to 6 yielding true(1). Hence the result.

128)

main() { char p[ ]="%d\n"; p[1] = 'c'; printf(p,65); } Answer: A Explanation: Due to the assignment p[1] = c the string becomes, %c\n. Since this string becomes the format string for printf and ASCII value of 65 is A, the same gets printed.

129)

void ( * abc( int, void ( *def) () ) ) ();

Answer:: abc is a ptr to a function which takes 2 parameters .(a). an integer variable.(b). ptrto a funtion which returns void. the return type of the function is void. Explanation: Apply the clock-wise rule to find the result. a

130)

main() { while (strcmp(some,some\0)) printf(Strings are not equal\n); } Answer: No output Explanation: Ending the string constant with \0 explicitly makes no difference. So some and some\0 are equivalent. So, strcmp returns 0 (false) hence breaking out of the while loop.

131)

main() { char str1[] = {s,o,m,e}; char str2[] = {s,o,m,e,\0}; while (strcmp(str1,str2)) printf(Strings are not equal\n); }

Answer: Strings are not equal Strings are not equal . Explanation: If a string constant is initialized explicitly with characters, \0 is not appended automatically to the string. Since str1 doesnt have null termination, it treats whatever the values that are in the following positions as part of the string until it randomly reaches a \0. So str1 and str2 are not the same, hence the result.

132)

main() { int i = 3; for (;i++=0;) printf(%d,i); }

Answer: Compiler Error: Lvalue required. Explanation: As we know that increment operators return rvalues and hence it cannot appear on the left hand side of an assignment operation.

133)

void main() { int *mptr, *cptr; mptr = (int*)malloc(sizeof(int)); printf(%d,*mptr); int *cptr = (int*)calloc(sizeof(int),1);

printf(%d,*cptr); } Answer: garbage-value 0 Explanation: The memory space allocated by malloc is uninitialized, whereas calloc returns the allocated memory space initialized to zeros.

134)

void main() { static int i; while(i<=10) (i>2)?i++:i--; printf(%d, i); } Answer: 32767 Explanation: Since i is static it is initialized to 0. Inside the while loop the conditional operator evaluates to false, executing i--. This continues till the integer value rotates to positive value (32767). The while condition becomes false and hence, comes out of the while loop, printing the i value.

135)

main() { int i=10,j=20; j = i, j?(i,j)?i:j:j; printf("%d %d",i,j);

Answer: 10 10 Explanation: The Ternary operator ( ? : ) is equivalent for if-then-else statement. So the question can be written as: if(i,j) { if(i,j) j = i; else j = j; } else j = j;

136)

1. const char *a; 2. char* const a; 3. char const *a; -Differentiate the above declarations.

Answer: 1. 'const' applies to char * rather than 'a' ( pointer to a constant char ) *a='F' a="Hi" : illegal : legal

2. 'const' applies to 'a' rather than to the value of a (constant pointer to char ) *a='F' a="Hi" : legal : illegal

3. Same as 1.

137)

main() { int i=5,j=10; i=i&=j&&10; printf("%d %d",i,j); }

Answer: 1 10 Explanation: The expression can be written as i=(i&=(j&&10)); The inner expression (j&&10) evaluates to 1 because j==10. i is 5. i = 5&1 is 1. Hence the result.

138)

main() { int i=4,j=7; j = j || i++ && printf("YOU CAN"); printf("%d %d", i, j); }

Answer: 41 Explanation: The boolean expression needs to be evaluated only till the truth value of the expression is not known. j is not equal to zero itself means that the expressions truth value is 1. Because it is followed by || and true || (anything) => true where (anything) will not be evaluated. So the remaining expression is not evaluated and so the value of i remains the same. Similarly when && operator is involved in an expression, when any of the operands become false, the whole expressions truth value becomes false and hence the remaining expression will not be evaluated. false && (anything) => false where (anything) will not be evaluated.

139)

main() { register int a=2; printf("Address of a = %d",&a); printf("Value of a = %d",a); } Answer: Compier Error: '&' on register variable Rule to Remember: & (address of ) operator cannot be applied on register variables.

140)

main() { float i=1.5; switch(i) {

case 1: printf("1"); case 2: printf("2"); default : printf("0"); } } Answer: Compiler Error: switch expression not integral Explanation: Switch statements can be applied only to integral types.

141)

main() { extern i; printf("%d\n",i); { int i=20; printf("%d\n",i); } } Answer: Linker Error : Unresolved external symbol i Explanation: The identifier i is available in the inner block and so using extern has no use in resolving it.

142)

main() {

int a=2,*f1,*f2; f1=f2=&a; *f2+=*f2+=a+=2.5; printf("\n%d %d %d",a,*f1,*f2); } Answer: 16 16 16 Explanation: f1 and f2 both refer to the same memory location a. So changes through f1 and f2 ultimately affects only the value of a.

143)

main() { char *p="GOOD"; char a[ ]="GOOD"; printf("\n sizeof(p) = %d, sizeof(*p) = %d, strlen(p) = %d", sizeof(p), sizeof(*p), strlen(p)); printf("\n sizeof(a) = %d, strlen(a) = %d", sizeof(a), strlen(a)); } Answer: sizeof(p) = 2, sizeof(*p) = 1, strlen(p) = 4 sizeof(a) = 5, strlen(a) = 4 Explanation: sizeof(p) => sizeof(char*) => 2 sizeof(*p) => sizeof(char) => 1 Similarly, sizeof(a) => size of the character array => 5

When sizeof operator is applied to an array it returns the sizeof the array and it is not the same as the sizeof the pointer variable. Here the sizeof(a) where a is the character array and the size of the array is 5 because the space necessary for the terminating NULL character should also be taken into account. 144) #define DIM( array, type) sizeof(array)/sizeof(type) main() { int arr[10]; printf(The dimension of the array is %d, DIM(arr, int)); }
Answer:

10
Explanation: The size of integer array of 10 elements is 10 * sizeof(int). The macro expands to sizeof(arr)/sizeof(int) => 10 * sizeof(int) / sizeof(int) => 10.

145)

int DIM(int array[]) { return sizeof(array)/sizeof(int ); } main() { int arr[10]; printf(The dimension of the array is %d, DIM(arr)); }
Answer:

1
Explanation: Arrays cannot be passed to functions as arguments and only the pointers can be passed. So the argument is equivalent to int * array (this is one of the very few places where [] and * usage are equivalent). The return statement becomes, sizeof(int *)/ sizeof(int) that happens to be equal in this case.

146)

main() { static int a[3][3]={1,2,3,4,5,6,7,8,9}; int i,j;

static *p[]={a,a+1,a+2}; for(i=0;i<3;i++) { for(j=0;j<3;j++) printf("%d\t%d\t%d\t%d\n",*(*(p+i)+j), *(*(j+p)+i),*(*(i+p)+j),*(*(p+j)+i)); } } Answer: 1 2 3 4 5 6 7 8 9 Explanation: *(*(p+i)+j) is equivalent to p[i][j]. 1 4 7 2 5 8 3 6 9 1 2 3 4 5 6 7 8 9 1 4 7 2 5 8 3 6 9

147)

main() { void swap(); int x=10,y=8; swap(&x,&y);

printf("x=%d y=%d",x,y); } void swap(int *a, int *b) { *a ^= *b, *b ^= *a, *a ^= *b; } Answer: x=10 y=8 Explanation: Using ^ like this is a way to swap two variables without using a temporary variable and that too in a single statement. Inside main(), void swap(); means that swap is a function that may take any number of arguments (not no arguments) and returns nothing. So this doesnt issue a compiler error by the call swap(&x,&y); that has two arguments. This convention is historically due to pre-ANSI style (referred to as Kernighan and Ritchie style) style of function declaration. In that style, the swap function will be defined as follows, void swap() int *a, int *b { *a ^= *b, *b ^= *a, *a ^= *b; } where the arguments follow the (). So naturally the declaration for swap will look like, void swap() which means the swap can take any number of arguments.

148)

main() { int i = 257; int *iPtr = &i;

printf("%d %d", *((char*)iPtr), *((char*)iPtr+1) ); } Answer: 11 Explanation: The integer value 257 is stored in the memory as, 00000001 00000001, so the individual bytes are taken by casting it to char * and get printed.

149)

main() { int i = 258; int *iPtr = &i; printf("%d %d", *((char*)iPtr), *((char*)iPtr+1) ); } Answer: 21 Explanation: The integer value 257 can be represented in binary as, 00000001 00000001. Remember that the INTEL machines are small-endian machines. Small-endian means that the lower order bytes are stored in the higher memory addresses and the higher order bytes are stored in lower addresses. The integer value 258 is stored in memory as: 00000001 00000010.

150)

main() { int i=300; char *ptr = &i; *++ptr=2;

printf("%d",i); } Answer: 556 Explanation: The integer value 300 in binary notation is: 00000001 00101100. It is stored in memory (small-endian) as: 00101100 00000001. Result of the expression *++ptr = 2 makes the memory representation as: 00101100 00000010. So the integer corresponding to it is 00000010 00101100 => 556.

151)

#include <stdio.h> main() { char * str = "hello"; char * ptr = str; char least = 127; while (*ptr++) least = (*ptr<least ) ?*ptr :least; printf("%d",least); } Answer: 0 Explanation: After ptr reaches the end of the string the value pointed by str is \0. So the value of str is less than that of least. So the value of least finally is 0.

152)

Declare an array of N pointers to functions returning pointers to functions returning pointers to characters?

Answer: (char*(*)( )) (*ptr[N])( );

153)

main() { struct student { char name[30]; struct date dob; }stud; struct date { int day,month,year; }; scanf("%s%d%d%d", &student.dob.year); } Answer: Compiler Error: Undefined structure date Explanation: Inside the struct definition of student the member of type struct date is given. The compiler doesnt have the definition of date structure (forward reference is not allowed in C in this case) so it issues an error. stud.rollno, &student.dob.day, &student.dob.month,

154)

main() { struct date; struct student

{ char name[30]; struct date dob; }stud; struct date { int day,month,year; }; scanf("%s%d%d%d", &student.dob.year); } Answer: Compiler Error: Undefined structure date Explanation: Only declaration of struct date is available inside the structure definition of student but to have a variable of type struct date the definition of the structure is required. stud.rollno, &student.dob.day, &student.dob.month,

155)

There were 10 records stored in somefile.dat but the following program printed 11 names. What went wrong? void main() { struct student { char name[30], rollno[6]; }stud; FILE *fp = fopen(somefile.dat,r); while(!feof(fp)) {

fread(&stud, sizeof(stud), 1 , fp); puts(stud.name); } } Explanation: fread reads 10 records and prints the names successfully. It will return EOF only when fread tries to read another record and fails reading EOF (and returning EOF). So it prints the last record again. After this only the condition feof(fp) becomes false, hence comes out of the while loop.

156)

Is there any difference between the two declarations, 1. int foo(int *arr[]) and 2. int foo(int *arr[2]) Answer: No Explanation: Functions can only pass pointers and not arrays. The numbers that are allowed inside the [] is just for more readability. So there is no difference between the two declarations.

157)

What is the subtle error in the following code segment? void fun(int n, int arr[]) { int *p=0; int i=0; while(i++<n) p = &arr[i]; *p = 0; }

Answer & Explanation: If the body of the loop never executes p is assigned no address. So p remains NULL where *p =0 may result in problem (may rise to runtime error NULL pointer assignment and terminate the program).

158)

What is wrong with the following code? int *foo() { int *s = malloc(sizeof(int)100); assert(s != NULL); return s; } Answer & Explanation: assert macro should be used for debugging and finding out bugs. The check s != NULL is for error/exception handling and for that assert shouldnt be used. A plain if and the corresponding remedy statement has to be given.

159)

What is the hidden bug with the following statement? assert(val++ != 0); Answer & Explanation: Assert macro is used for debugging and removed in release version. In assert, the experssion involves side-effects. So the behavior of the code becomes different in case of debug version and the release version thus leading to a subtle bug. Rule to Remember: Dont use expressions that have side-effects in assert statements.

160)

void main() { int *i = 0x400; // i points to the address 400

*i = 0; } Answer:

// set the value of memory location pointed by i;

Undefined behavior Explanation: The second statement results in undefined behavior because it points to some location whose value may not be available for modification. This type of pointer in which the non-availability of the implementation of the referenced location is known as 'incomplete type'.

161)

#define assert(cond) if(!(cond)) \ (fprintf(stderr, "assertion failed: %s, file %s, line %d \n",#cond,\ __FILE__,__LINE__), abort())

void main() { int i = 10; if(i==0) assert(i < 100); else printf("This statement becomes else for if in assert macro"); } Answer: No output Explanation: The else part in which the printf is there becomes the else for if in the assert macro. Hence nothing is printed. The solution is to use conditional operator instead of if statement,

#define assert(cond) ((cond)?(0): (fprintf (stderr, "assertion failed: \ %s, file %s, line %d \n",#cond, __FILE__,__LINE__), abort()))

Note: However this problem of matching with nearest else cannot be solved by the usual method of placing the if statement inside a block like this, #define assert(cond) { \ if(!(cond)) \ (fprintf(stderr, "assertion failed: %s, file %s, line %d \n",#cond,\ __FILE__,__LINE__), abort()) \ }

162)

Is the following code legal? struct a { int x; struct a b; } Answer: No Explanation: Is it not legal for a structure to contain a member that is of the same type as in this case. Because this will cause the structure declaration to be recursive without end.

163)

Is the following code legal? struct a {

int x; struct a *b; } Answer: Yes. Explanation: *b is a pointer to type struct a and so is legal. The compiler knows, the size of the pointer to a structure even before the size of the structure is determined(as you know the pointer to any type is of same size). This type of structures is known as self-referencing structure.

164)

Is the following code legal? typedef struct a { int x; aType *b; }aType Answer: No Explanation: The typename aType is not known at the point of declaring the structure (forward references are not made for typedefs).

165)

Is the following code legal? typedef struct a aType; struct a { int x;

aType *b; }; Answer: Yes Explanation: The typename aType is known at the point of declaring the structure, because it is already typedefined.

166)

Is the following code legal? void main() { typedef struct a aType; aType someVariable; struct a { int x; aType *b; }; } Answer: No Explanation: When the declaration, typedef struct a aType; is encountered body of struct a is not known. This is known as incomplete types.

167)

void main()

{ printf(sizeof (void *) = %d \n, sizeof( void *)); printf(sizeof (int *) = %d \n, sizeof(int *));

printf(sizeof (double *) = %d \n, sizeof(double *)); printf(sizeof(struct unknown *) = %d \n, sizeof(struct unknown *)); } Answer : sizeof (void *) = 2 sizeof (int *) =2

sizeof (double *) = 2 sizeof(struct unknown *) = 2 Explanation: The pointer to any type is of same size.

168)

char inputString[100] = {0}; To get string input from the keyboard which one of the following is better? 1) gets(inputString) 2) fgets(inputString, sizeof(inputString), fp) Answer & Explanation: The second one is better because gets(inputString) doesn't know the size of the string passed and so, if a very big input (here, more than 100 chars) the charactes will be written past the input string. When fgets is used with stdin performs the same operation as gets but is safe.

169)

Which version do you prefer of the following two, 1) printf(%s,str); 2) printf(str); Answer & Explanation: // or the more curt one

Prefer the first one. If the str contains any format characters like %d then it will result in a subtle bug.

170)

void main() { int i=10, j=2; int *ip= &i, *jp = &j; int k = *ip/*jp; printf(%d,k); } Answer: Compiler Error: Unexpected end of file in comment started in line 5. Explanation: The programmer intended to divide two integers, but by the maximum munch rule, the compiler treats the operator sequence / and * as /* which happens to be the starting of comment. To force what is intended by the programmer, int k = *ip/ *jp; // give space explicity separating / and * //or int k = *ip/(*jp); // put braces to force the intention will solve the problem.

171)

void main() { char ch; for(ch=0;ch<=127;ch++) printf(%c %d \n, ch, ch);

} Answer: Implementaion dependent Explanation: The char type may be signed or unsigned by default. If it is signed then ch++ is executed after ch reaches 127 and rotates back to -128. Thus ch is always smaller than 127.

172)

Is this code legal? int *ptr;

ptr = (int *) 0x400; Answer: Yes Explanation:

The pointer ptr will point at the integer in the memory location 0x400.
173) main() { char a[4]="HELLO"; printf("%s",a); } Answer: Compiler error: Too many initializers Explanation: The array a is of size 4 but the string constant requires 6 bytes to get stored.

174)

main() { char a[4]="HELL"; printf("%s",a);

} Answer: HELL%@!~@!@???@~~! Explanation: The character array has the memory just enough to hold the string HELL and doesnt have enough space to store the terminating null character. So it prints the HELL correctly and continues to print garbage values till it accidentally comes across a NULL character.

175)

main() { int a=10,*j; void *k; j=k=&a; j++; k++; printf("\n %u %u ",j,k); } Answer: Compiler error: Cannot increment a void pointer Explanation: Void pointers are generic pointers and they can be used only when the type is not known and as an intermediate address storage type. No pointer arithmetic can be done on it and you cannot apply indirection operator (*) on void pointers.

176)

main() { extern int i;

{ {

int i=20;

const volatile unsigned i=30; printf("%d",i); } printf("%d",i); } printf("%d",i); } int i;

177)

Printf can be implemented by using __________ list. Answer: Variable length argument lists

178) char *someFun() { char *temp = string constant"; return temp; } int main() { puts(someFun()); } Answer: string constant Explanation: The program suffers no problem and gives the output correctly because the character constants are stored in code/data area and not allocated in stack, so this doesnt lead to dangling pointers.

179)

char *someFun1() { char temp[ ] = string"; return temp; } char *someFun2() { char temp[ ] = {s, t,r,i,n,g}; return temp; } int main() { puts(someFun1()); puts(someFun2()); }

Answer: Garbage values. Explanation: Both the functions suffer from the problem of dangling pointers. In someFun1() temp is a character array and so the space for it is allocated in heap and is initialized with character string string. This is created dynamically as the function is called, so is also deleted dynamically on exiting the function so the string data is not available in the calling function main() leading to print some garbage values. The function someFun2() also suffers from the same problem but the problem can be easily identified in this case.

C,C++ Questions
1. Base class has some virtual method and derived class has a method with the same name. If we initialize the base class pointer with derived object,. calling of that virtual method will result in which method being called?

a. Base method b. Derived method.. Ans. b 2. For the following C program #define AREA(x)(3.14*x*x) main() {float r1=6.25,r2=2.5,a; a=AREA(r1); printf("\n Area of the circle is %f", a); a=AREA(r2); printf("\n Area of the circle is %f", a); } What is the output? Ans. Area of the circle is 122.656250 Area of the circle is 19.625000 3. What do the following statements indicate. Explain. int(*p)[10] int*f() int(*pf)() int*p[10]

Refer to: -- Kernighan & Ritchie page no. 122 -- Schaum series page no. 323 4. void main() { int d=5; printf("%f",d); } Ans: Undefined

5. void main() { int i; for(i=1;i<4,i++)

switch(i) case 1: printf("%d",i);break; { case 2:printf("%d",i);break; case 3:printf("%d",i);break; } switch(i) case 4:printf("%d",i); } Ans: 1,2,3,4

6. void main() { char *s="\12345s\n"; printf("%d",sizeof(s)); } Ans: 6

7. void main() { unsigned i=1; /* unsigned char k= -1 => k=255; */ signed j=-1; /* char k= -1 => k=65535 */ /* unsigned or signed int k= -1 =>k=65535 */ if(i<j) printf("less"); else if(i>j) printf("greater"); else if(i==j) printf("equal"); } Ans: less

8. void main() { float j; j=1000*1000; printf("%f",j); }

1. 1000000 2. Overflow 3. Error 4. None Ans: 4

9. How do you declare an array of N pointers to functions returning pointers to functions returning pointers to characters? Ans: The first part of this question can be answered in at least three ways: 1. char *(*(*a[N])())(); 2. Build the declaration up incrementally, using typedefs: typedef char *pc; /* pointer to char */ typedef pc fpc(); /* function returning pointer to char */ typedef fpc *pfpc; /* pointer to above */ typedef pfpc fpfpc(); /* function returning... */ typedef fpfpc *pfpfpc; /* pointer to... */ pfpfpc a[N]; /* array of... */ 3. Use the cdecl program, which turns English into C and vice versa: cdecl> declare a as array of pointer to function returning pointer to function returning pointer to char char *(*(*a[])())() cdecl can also explain complicated declarations, help with casts, and indicate which set of parentheses the arguments go in (for complicated function definitions, like the one above). Any good book on C should explain how to read these complicated C declarations "inside out" to understand them ("declaration mimics use"). The pointer-to-function declarations in the examples above have not included parameter type information. When the parameters have complicated types, declarations can *really* get messy. (Modern versions of cdecl can help here, too.)

10. A structure pointer is defined of the type time . With 3 fields min,sec hours having pointers to intergers. Write the way to initialize the 2nd element to 10.

11. In the above question an array of pointers is declared. Write the statement to initialize the 3rd element of the 2 element to 10;

12.

int f() void main() { f(1); f(1,2); f(1,2,3); } f(int i,int j,int k) { printf("%d %d %d",i,j,k); } What are the number of syntax errors in the above? Ans: None.

13. void main() { int i=7; printf("%d",i++*i++); } Ans: 56

14. #define one 0 #ifdef one printf("one is defined "); #ifndef one printf("one is not defined "); Ans: "one is defined"

15. void main() { int count=10,*temp,sum=0; temp=&count; *temp=20; temp=&sum; *temp=count; printf("%d %d %d ",count,*temp,sum); } Ans: 20 20 20

16. There was question in c working only on unix machine with pattern matching.

14. what is alloca() Ans : It allocates and frees memory after use/after getting out of scope

17. main() { static i=3; printf("%d",i--); return i>0 ? main():0; } Ans: 321

18. char *foo() { char result[100]); strcpy(result,"anything is good"); return(result); } void main() { char *j; j=foo() printf("%s",j); } Ans: anything is good.

19. void main() { char *s[]={ "dharma","hewlett-packard","siemens","ibm"}; char **p; p=s; printf("%s",++*p); printf("%s",*p++); printf("%s",++*p); } Ans: "harma" (p->add(dharma) && (*p)->harma) "harma" (after printing, p->add(hewlett-packard) &&(*p)->harma) "ewlett-packard" 20. Output of the following program is

main() {int i=0; for(i=0;i<20;i++) {switch(i) case 0:i+=5; case 1:i+=2; case 5:i+=5; default i+=4; break;} printf("%d,",i); } } a) 0,5,9,13,17 b) 5,9,13,17 c) 12,17,22 d) 16,21 e) Syntax error Ans. (d) 21. What is the ouptut in the following program main() {char c=-64; int i=-32 unsigned int u =-16; if(c>i) {printf("pass1,"); if(c<u) printf("pass2"); else printf("Fail2"); } else printf("Fail1); if(i<u) printf("pass2"); else printf("Fail2") } a) Pass1,Pass2 b) Pass1,Fail2 c) Fail1,Pass2 d) Fail1,Fail2 e) None of these Ans. (c) 22. What will the following program do? void main() {

int i; char a[]="String"; char *p="New Sring"; char *Temp; Temp=a; a=malloc(strlen(p) + 1); strcpy(a,p); //Line number:9// p = malloc(strlen(Temp) + 1); strcpy(p,Temp); printf("(%s, %s)",a,p); free(p); free(a); } //Line number 15// a) Swap contents of p & a and print:(New string, string) b) Generate compilation error in line number 8 c) Generate compilation error in line number 5 d) Generate compilation error in line number 7 e) Generate compilation error in line number 1 Ans. (b) 23. In the following code segment what will be the result of the function, value of x , value of y {unsigned int x=-1; int y; y = ~0; if(x == y) printf("same"); else printf("not same"); } a) same, MAXINT, -1 b) not same, MAXINT, -MAXINT c) same , MAXUNIT, -1 d) same, MAXUNIT, MAXUNIT e) not same, MAXINT, MAXUNIT Ans. (a) 24. What will be the result of the following program ? char *gxxx() {static char xxx[1024]; return xxx; } main() {char *g="string"; strcpy(gxxx(),g); g = gxxx(); strcpy(g,"oldstring");

printf("The string is : %s",gxxx()); } a) The string is : string b) The string is :Oldstring c) Run time error/Core dump d) Syntax error during compilation e) None of these Ans. (b) 25. Find the output for the following C program main() { char *p1="Name"; char *p2; p2=(char *)malloc(20); while(*p2++=*p1++); printf("%s\n",p2); } Ans. An empty string 26. Find the output for the following C program main() { int x=20,y=35; x = y++ + x++; y = ++y + ++x; printf("%d %d\n",x,y); } Ans. 57 94 27. Find the output for the following C program main() { int x=5; printf("%d %d %d\n",x,x<<2,x>>2); } Ans. 5 20 1 28 Find the output for the following C program #define swap1(a,b) a=a+b;b=a-b;a=a-b; main() { int x=5,y=10; swap1(x,y);

printf("%d %d\n",x,y); swap2(x,y); printf("%d %d\n",x,y); } int swap2(int a,int b) { int temp; temp=a; b=a; a=temp; return; } Ans. 10 5

29 Find the output for the following C program main() { char *ptr = "Ramco Systems"; (*ptr)++; printf("%s\n",ptr); ptr++; printf("%s\n",ptr); } Ans. Samco Systems

30 Find the output for the following C program #include<stdio.h> main() { char s1[]="Ramco"; char s2[]="Systems"; s1=s2; printf("%s",s1); } Ans. Compilation error giving it cannot be an modifiable 'lvalue'

31 Find the output for the following C program #include<stdio.h> main() { char *p1; char *p2; p1=(char *) malloc(25); p2=(char *) malloc(25); strcpy(p1,"Ramco");

strcpy(p2,"Systems"); strcat(p1,p2); printf("%s",p1); } Ans. RamcoSystems

32. Find the output for the following C program given that [1]. The following variable is available in file1.c static int average_float; Ans. All the functions in the file1.c can access the variable

33. Find the output for the following C program # define TRUE 0 some code while(TRUE) { some code } Ans. This won't go into the loop as TRUE is defined as 0 34. struct list{ int x; struct list *next; }*head; the struct head.x =100 Is the above assignment to pointer is correct or wrong ? Ans. Wrong 35.What is the output of the following ? int i; i=1; i=i+2*i++; printf(%d,i); Ans. 4 36. FILE *fp1,*fp2; fp1=fopen("one","w") fp2=fopen("one","w") fputc('A',fp1) fputc('B',fp2) fclose(fp1)

fclose(fp2) } Find the Error, If Any? Ans. no error. But It will over writes on same file. 37. What are the output(s) for the following ? 38. #include<malloc.h> char *f() {char *s=malloc(8); strcpy(s,"goodbye"); } main() { char *f(); printf("%c",*f()='A');

39. #define MAN(x,y) (x)>(y)?(x):(y) {int i=10; j=5; k=0; k=MAX(i++,++j); printf(%d %d %d %d,i,j,k); } Ans. 10 5 0 40. void main() { int i=7; printf("%d",i++*i++); } Ans: 56

C++ Questions

Note : All the programs are tested under Turbo C++ 3.0, 4.5 and Microsoft VC++ 6.0 compilers. It is assumed that,

Programs run under Windows environment, The underlying machine is an x86 based system, Program is compiled using Turbo C/C++ compiler. The program output may depend on the information based on this assumptions (for example sizeof(int) == 2 may be assumed).

1) class Sample { public: int *ptr; Sample(int i) { ptr = new int(i); } ~Sample() { delete ptr; } void PrintVal() { cout << "The value is " << *ptr; } }; void SomeFunc(Sample x) { cout << "Say i am in someFunc " << endl; } int main()

{ Sample s1= 10; SomeFunc(s1); s1.PrintVal(); } Answer: Say i am in someFunc Null pointer assignment(Run-time error) Explanation: As the object is passed by value to SomeFunc the destructor of the object is called when the control returns from the function. So when PrintVal is called it meets up with ptr that has been freed.The solution is to pass the Sample object by reference to SomeFunc:

void SomeFunc(Sample &x) { cout << "Say i am in someFunc " << endl; }

because when we pass objects by refernece that object is not destroyed. while returning from the function.

2) Which is the parameter that is added to every non-static member function when it is called? Answer: this pointer

3) class base { public:

int bval; base(){ bval=0;} };

class deri:public base { public: int dval; deri(){ dval=1;} }; void SomeFunc(base *arr,int size) { for(int i=0; i<size; i++,arr++) cout<<arr->bval; cout<<endl; }

int main() { base BaseArr[5]; SomeFunc(BaseArr,5); deri DeriArr[5]; SomeFunc(DeriArr,5); }

Answer:

00000 01010 Explanation: The function SomeFunc expects two arguments.The first one is a pointer to an array of base class objects and the second one is the sizeof the array.The first call of someFunc calls it with an array of bae objects, so it works correctly and prints the bval of all the objects. When Somefunc is called the second time the argument passed is the pointeer to an array of derived class objects and not the array of base class objects. But that is what the function expects to be sent. So the derived class pointer is promoted to base class pointer and the address is sent to the function. SomeFunc() knows nothing about this and just treats the pointer as an array of base class objects. So when arr++ is met, the size of base class object is taken into consideration and is incremented by sizeof(int) bytes for bval (the deri class objects have bval and dval as members and so is of size >= sizeof(int)+sizeof(int) ).

4) class base { public: void baseFun(){ cout<<"from base"<<endl;} }; class deri:public base { public: void baseFun(){ cout<< "from derived"<<endl;} }; void SomeFunc(base *baseObj) { baseObj->baseFun(); } int main() { base baseObject;

SomeFunc(&baseObject); deri deriObject; SomeFunc(&deriObject); } Answer: from base from base Explanation: As we have seen in the previous case, SomeFunc expects a pointer to a base class. Since a pointer to a derived class object is passed, it treats the argument only as a base class pointer and the corresponding base function is called.

5) class base { public: virtual void baseFun(){ cout<<"from base"<<endl;} }; class deri:public base { public: void baseFun(){ cout<< "from derived"<<endl;} }; void SomeFunc(base *baseObj) { baseObj->baseFun(); } int main()

{ base baseObject; SomeFunc(&baseObject); deri deriObject; SomeFunc(&deriObject); } Answer: from base from derived Explanation: Remember that baseFunc is a virtual function. That means that it supports run-time polymorphism. So the function corresponding to the derived class object is called.

void main() { int a, *pa, &ra; pa = &a; ra = a; cout <<"a="<<a <<"*pa="<<*pa <<"ra"<<ra ; } /* Answer : Compiler Error: 'ra',reference must be initialized Explanation : Pointers are different from references. One of the main differences is that the pointers can be both initialized and assigned, whereas references can only be initialized. So this code issues an error. */ const int size = 5; void print(int *ptr) { cout<<ptr[0]; }

void print(int ptr[size]) { cout<<ptr[0]; } void main() { int a[size] = {1,2,3,4,5}; int *b = new int(size); print(a); print(b); } /* Answer: Compiler Error : function 'void print(int *)' already has a body Explanation: Arrays cannot be passed to functions, only pointers (for arrays, base addresses) can be passed. So the arguments int *ptr and int prt[size] have no difference as function arguments. In other words, both the functoins have the same signature and so cannot be overloaded. */ class some{ public: ~some() { cout<<"some's destructor"<<endl; } }; void main() { some s; s.~some(); } /* Answer: some's destructor some's destructor Explanation: Destructors can be called explicitly. Here 's.~some()' explicitly calls the destructor of 's'. When main() returns, destructor of s is called again, hence the result. */

#include <iostream.h> class fig2d { int dim1; int dim2; public: fig2d() { dim1=5; dim2=6;} virtual void operator<<(ostream & rhs); }; void fig2d::operator<<(ostream &rhs) { rhs <<this->dim1<<" "<<this->dim2<<" "; } /*class fig3d : public fig2d { int dim3; public: fig3d() { dim3=7;} virtual void operator<<(ostream &rhs); }; void fig3d::operator<<(ostream &rhs) { fig2d::operator <<(rhs); rhs<<this->dim3; } */ void main() { fig2d obj1; // fig3d obj2; obj1 << cout; // obj2 << cout; } /* Answer : 56 Explanation: In this program, the << operator is overloaded with ostream as argument. This enables the 'cout' to be present at the right-hand-side. Normally, 'cout'

is implemented as global function, but it doesn't mean that 'cout' is not possible to be overloaded as member function. Overloading << as virtual member function becomes handy when the class in which it is overloaded is inherited, and this becomes available to be overrided. This is as opposed to global friend functions, where friend's are not inherited. */ class opOverload{ public: bool operator==(opOverload temp); }; bool opOverload::operator==(opOverload temp){ if(*this == temp ){ cout<<"The both are same objects\n"; return true; } else{ cout<<"The both are different\n"; return false; } } void main(){ opOverload a1, a2; a1= =a2; } Answer : Runtime Error: Stack Overflow Explanation : Just like normal functions, operator functions can be called recursively. This program just illustrates that point, by calling the operator == function recursively, leading to an infinite loop.

class complex{ double re; double im; public: complex() : re(1),im(0.5) {} bool operator==(complex &rhs); operator int(){} }; bool complex::operator == (complex &rhs){

if((this->re == rhs.re) && (this->im == rhs.im)) return true; else return false; } int main(){ complex c1; cout<< c1; } Answer : Garbage value Explanation: The programmer wishes to print the complex object using output re-direction operator,which he has not defined for his lass.But the compiler instead of giving an error sees the conversion function and converts the user defined object to standard object and prints some garbage value.

class complex{ double re; double im; public: complex() : re(0),im(0) {} complex(double n) { re=n,im=n;}; complex(int m,int n) { re=m,im=n;} void print() { cout<<re; cout<<im;} }; void main(){ complex c3; double i=5; c3 = i; c3.print(); } Answer: 5,5 Explanation: Though no operator= function taking complex, double is defined, the double on the rhs is converted into a temporary object using the single argument constructor taking double and assigned to the lvalue.

void main() { int a, *pa, &ra; pa = &a; ra = a; cout <<"a="<<a <<"*pa="<<*pa <<"ra"<<ra ; } Answer : Compiler Error: 'ra',reference must be initialized Explanation : Pointers are different from references. One of the main differences is that the pointers can be both initialized and assigned, whereas references can only be initialized. So this code issues an error.
Try it Yourself

1) Determine the output of the 'C++' Codelet. class base { public : out() { cout<<"base "; } }; class deri{ public : out() { cout<<"deri "; } }; void main()

deri dp[3]; base *bp = (base*)dp; for (int i=0; i<3;i++) (bp++)->out();

2) Justify the use of virtual constructors and destructors in C++. 3) Each C++ object possesses the 4 member fns,(which can be declared by the programmer explicitly or by the implementation if they are not available). What are those 4 functions? 4) What is wrong with this class declaration? class something { char *str; public: something(){ st = new char[10]; } ~something() { delete str; } };

5) Inheritance is also known as -------- relationship. Containership as ________ relationship.

6) When is it necessary to use member-wise initialization list (also known as header initialization list) in C++?

7) Which is the only operator in C++ which can be overloaded but NOT inherited.

8) Is there anything wrong with this C++ class declaration? class temp { int value1; mutable int value2; public : void fun(int val) const{ ((temp*) this)->value1 = 10; value2 = 10; } };

1. What is a modifier? Answer: A modifier, also called a modifying function is a member function that changes the value of at least one data member. In other words, an operation that modifies the state of an object. Modifiers are also known as mutators.

2. What is an accessor? Answer: An accessor is a class operation that does not modify the state of an object. The accessor functions need to be declared as const operations

3. Differentiate between a template class and class template. Answer: Template class: A generic definition or a parameterized class not instantiated until the client provides the needed information. Its jargon for plain templates. Class template: A class template specifies how individual classes can be constructed much like the way a class specifies how individual objects can be constructed. Its jargon for plain classes.

4. When does a name clash occur? Answer: A name clash occurs when a name is defined in more than one place. For example., two different class libraries could give two different classes the same name. If you try to use many class libraries at the same time, there is a fair chance that you will be unable to compile or link the program because of name clashes.

5. Define namespace. Answer:

It is a feature in c++ to minimize name collisions in the global name space. This namespace keyword assigns a distinct name to a library that allows other libraries to use the same identifier names without creating any name collisions. Furthermore, the compiler uses the namespace signature for differentiating the definitions.

6. What is the use of using declaration. Answer: A using declaration makes it possible to use a name from a namespace without the scope operator.

7. What is an Iterator class? Answer: A class that is used to traverse through the objects maintained by a container class. There are five categories of iterators: input iterators, output iterators, forward iterators, bidirectional iterators, random access. An iterator is an entity that gives access to the contents of a container object without violating encapsulation constraints. Access to the contents is granted on a one-at-a-time basis in order. The order can be storage order (as in lists and queues) or some arbitrary order (as in array indices) or according to some ordering relation (as in an ordered binary tree). The iterator is a construct, which provides an interface that, when called, yields either the next element in the container, or some value denoting the fact that there are no more elements to examine. Iterators hide the details of access to and update of the elements of a container class. The simplest and safest iterators are those that permit read-only access to the contents of a container class. The following code fragment shows how an iterator might appear in code: cont_iter:=new cont_iterator(); x:=cont_iter.next(); while x/=none do ... s(x); ...

x:=cont_iter.next(); end; In this example, cont_iter is the name of the iterator. It is created on the first line by instantiation of cont_iterator class, an iterator class defined to iterate over some container class, cont. Succesive elements from the container are carried to x. The loop terminates when x is bound to some empty value. (Here, none)In the middle of the loop, there is s(x) an operation on x, the current element from the container. The next element of the container is obtained at the bottom of the loop.

9. List out some of the OODBMS available. Answer: GEMSTONE/OPAL of Gemstone systems. ONTOS of Ontos. Objectivity of Objectivity inc. Versant of Versant object technology. Object store of Object Design. ARDENT of ARDENT software. POET of POET software. 10. List out some of the object-oriented methodologies. Answer: Object Oriented Development (OOD) (Booch 1991,1994). Object Oriented Analysis and Design (OOA/D) (Coad and Yourdon 1991). Object Modelling Techniques (OMT) (Rumbaugh 1991). Object Oriented Software Engineering (Objectory) (Jacobson 1992). Object Oriented Analysis (OOA) (Shlaer and Mellor 1992). The Fusion Method (Coleman 1991). 11. What is an incomplete type? Answer: Incomplete types refers to pointers in which there is non availability of the implementation of the referenced location or it points to some location whose value is not available for modification. Example: int *i=0x400 // i points to address 400 *i=0; //set the value of memory location pointed by i.

Incomplete types are otherwise called uninitialized pointers.

12. What is a dangling pointer? Answer: A dangling pointer arises when you use the address of an object after its lifetime is over. This may occur in situations like returning addresses of the automatic variables from a function or using the address of the memory block after it is freed.

13. Differentiate between the message and method. Answer: Message Objects communicate by sending messages to each other. A message is sent to invoke a method. It is an implementation of an operation. Method Provides response to a message.

14. What is an adaptor class or Wrapper class? Answer: A class that has no functionality of its own. Its member functions hide the use of a third party software component or an object with the non-compatible interface or a non- object- oriented implementation.

15. What is a Null object? Answer: It is an object of some class whose purpose is to indicate that a real object of that class does not exist. One common use for a null object is a return value from a member function that is supposed to return an object with some specified properties but cannot find such an object.

16. What is class invariant? Answer:

A class invariant is a condition that defines all valid states for an object. It is a logical condition to ensure the correct working of a class. Class invariants must hold when an object is created, and they must be preserved under all operations of the class. In particular all class invariants are both preconditions and post-conditions for all operations or member functions of the class.

17. What do you mean by Stack unwinding? Answer: It is a process during exception handling when the destructor is called for all local objects between the place where the exception was thrown and where it is caught.

18. Define precondition and post-condition to a member function. Answer: Precondition: A precondition is a condition that must be true on entry to a member function. A class is used correctly if preconditions are never false. An operation is not responsible for doing anything sensible if its precondition fails to hold. For example, the interface invariants of stack class say nothing about pushing yet another element on a stack that is already full. We say that isful() is a precondition of the push operation.

Post-condition: A post-condition is a condition that must be true on exit from a member function if the precondition was valid on entry to that function. A class is implemented correctly if post-conditions are never false. For example, after pushing an element on the stack, we know that isempty() must necessarily hold. This is a post-condition of the push operation.

19. What are the conditions that have to be met for a condition to be an invariant of the class?
Answer: The condition should hold at the end of every constructor. The condition should hold at the end of every mutator(non-const) operation.

20. What are proxy objects?

Answer: Objects that stand for other objects are called proxy objects or surrogates. Example: template<class T> class Array2D { public: class Array1D { public: T& operator[] (int index); const T& operator[] (int index) const; ... }; Array1D operator[] (int index); const Array1D operator[] (int index) const; ... };

The following then becomes legal: Array2D<float>data(10,20); ........ cout<<data[3][6]; // fine

Here data[3] yields an Array1D object and the operator [] invocation on that object yields the float in position(3,6) of the original two dimensional array. Clients of the Array2D class need not be aware of the presence of the Array1D class. Objects of this latter class stand for one-dimensional array objects that, conceptually, do not exist for clients of Array2D. Such clients program as if they were using real, live, two-dimensional arrays. Each Array1D object stands for a one-dimensional array that is absent from a conceptual model used by the clients of Array2D. In the above example, Array1D is a proxy class. Its instances stand for one-dimensional arrays that, conceptually, do not exist.

21. Name some pure object oriented languages.

Answer: Smalltalk, Java, Eiffel, Sather.

22. Name the operators that cannot be overloaded.

Answer: sizeof . .* .-> :: ?:

23. What is a node class? Answer: A node class is a class that, relies on the base class for services and implementation, provides a wider interface to te users than its base class, relies primarily on virtual functions in its public interface depends on all its direct and indirect base class can be understood only in the context of the base class can be used as base for further derivation can be used to create objects. A node class is a class that has added new services or functionality beyond the services inherited from its base class.

24. What is an orthogonal base class? Answer:

If two base classes have no overlapping methods or data they are said to be independent of, or orthogonal to each other. Orthogonal in the sense means that two classes operate in different dimensions and do not interfere with each other in any way. The same derived class may inherit such classes with no difficulty.

25. What is a container class? What are the types of container classes? Answer: A container class is a class that is used to hold objects in memory or external storage. A container class acts as a generic holder. A container class has a predefined behavior and a well-known interface. A container class is a supporting class whose purpose is to hide the topology used for maintaining the list of objects in memory. When a container class contains a group of mixed objects, the container is called a heterogeneous container; when the container is holding a group of objects that are all the same, the container is called a homogeneous container.

26. What is a protocol class? Answer: An abstract class is a protocol class if: it neither contains nor inherits from classes that contain member data, non-virtual functions, or private (or protected) members of any kind. it has a non-inline virtual destructor defined with an empty implementation, all member functions other than the destructor including inherited functions, are declared pure virtual functions and left undefined. 27. What is a mixin class? Answer: A class that provides some but not all of the implementation for a virtual base class is often called mixin. Derivation done just for the purpose of redefining the virtual functions in the base classes is often called mixin inheritance. Mixin classes typically don't share common bases.

28. What is a concrete class? Answer:

A concrete class is used to define a useful object that can be instantiated as an automatic variable on the program stack. The implementation of a concrete class is defined. The concrete class is not intended to be a base class and no attempt to minimize dependency on other classes in the implementation or behavior of the class.

29.What is the handle class? Answer: A handle is a class that maintains a pointer to an object that is programmatically accessible through the public interface of the handle class. Explanation:

In case of abstract classes, unless one manipulates the objects of these classes through pointers and references, the benefits of the virtual functions are lost. User code may become dependent on details of implementation classes because an abstract type cannot be allocated statistically or on the stack without its size being known. Using pointers or references implies that the burden of memory management falls on the user. Another limitation of abstract class object is of fixed size. Classes however are used to represent concepts that require varying amounts of storage to implement them.
A popular technique for dealing with these issues is to separate what is used as a single object in two parts: a handle providing the user interface and a representation holding all or most of the object's state. The connection between the handle and the representation is typically a pointer in the handle. Often, handles have a bit more data than the simple representation pointer, but not much more. Hence the layout of the handle is typically stable, even when the representation changes and also that handles are small enough to move around relatively freely so that the user neednt use the pointers and the references.

30. What is an action class? Answer: The simplest and most obvious way to specify an action in C++ is to write a function. However, if the action has to be delayed, has to be transmitted 'elsewhere' before being performed, requires its own data, has to be combined with other actions, etc then it often becomes attractive to provide the action in the form of a class that can execute the desired action and provide other services as well. Manipulators used with iostreams is an obvious example. Explanation:

A common form of action class is a simple class containing just one virtual function.
class Action

{ public: virtual int do_it( int )=0; virtual ~Action( ); }

Given this, we can write code say a member that can store actions for later execution without using pointers to functions, without knowing anything about the objects involved, and without even knowing the name of the operation it invokes. For example:
class write_file : public Action { File& f; public: int do_it(int) { return fwrite( ).suceed( ); } }; class error_message: public Action { response_box db(message.cstr( ),"Continue","Cancel","Retry"); switch (db.getresponse( )) { case 0: return 0; case 1: abort(); case 2: current_operation.redo( );return 1; }

};

A user of the Action class will be completely isolated from any knowledge of derived classes such as write_file and error_message.

31. When can you tell that a memory leak will occur? Answer: A memory leak occurs when a program loses the ability to free a block of dynamically allocated memory.

32.What is a parameterized type? Answer: A template is a parameterized construct or type containing generic code that can use or manipulate any type. It is called parameterized because an actual type is a parameter of the code body. Polymorphism may be achieved through parameterized types. This type of polymorphism is called parameteric polymorphism. Parameteric polymorphism is the mechanism by which the same code is used on different types passed as parameters.

33. Differentiate between a deep copy and a shallow copy? Answer: Deep copy involves using the contents of one object to create another instance of the same class. In a deep copy, the two objects may contain ht same information but the target object will have its own buffers and resources. the destruction of either object will not affect the remaining object. The overloaded assignment operator would create a deep copy of objects. Shallow copy involves copying the contents of one object into another instance of the same class thus creating a mirror image. Owing to straight copying of references and pointers, the two objects will share the same externally contained contents of the other object to be unpredictable. Explanation: Using a copy constructor we simply copy the data values member by member. This method of copying is called shallow copy. If the object is a simple class, comprised of built in types and no pointers this would be acceptable. This function would use the values and the objects and its behavior would not

be altered with a shallow copy, only the addresses of pointers that are members are copied and not the value the address is pointing to. The data values of the object would then be inadvertently altered by the function. When the function goes out of scope, the copy of the object with all its data is popped off the stack. If the object has any pointers a deep copy needs to be executed. With the deep copy of an object, memory is allocated for the object in free store and the elements pointed to are copied. A deep copy is used for objects that are returned from a function.

34. What is an opaque pointer? Answer: A pointer is said to be opaque if the definition of the type to which it points to is not included in the current translation unit. A translation unit is the result of merging an implementation file with all its headers and header files.

35. What is a smart pointer? Answer: A smart pointer is an object that acts, looks and feels like a normal pointer but offers more functionality. In C++, smart pointers are implemented as template classes that encapsulate a pointer and override standard pointer operators. They have a number of advantages over regular pointers. They are guaranteed to be initialized as either null pointers or pointers to a heap object. Indirection through a null pointer is checked. No delete is ever necessary. Objects are automatically freed when the last pointer to them has gone away. One significant problem with these smart pointers is that unlike regular pointers, they don't respect inheritance. Smart pointers are unattractive for polymorphic code. Given below is an example for the implementation of smart pointers. Example: template <class X> class smart_pointer { public: smart_pointer(); smart_pointer(const X& x) // makes a null pointer // makes pointer to copy of x

X& operator *( ); const X& operator*( ) const; X* operator->() const;

smart_pointer(const smart_pointer <X> &); const smart_pointer <X> & operator =(const smart_pointer<X>&); ~smart_pointer(); private: //... }; This class implement a smart pointer to an object of type X. The object itself is located on the heap. Here is how to use it: smart_pointer <employee> p= employee("Harris",1333); Like other overloaded operators, p will behave like a regular pointer, cout<<*p; p->raise_salary(0.5);

36. What is reflexive association? Answer: The 'is-a' is called a reflexive association because the reflexive association permits classes to bear the is-a association not only with their super-classes but also with themselves. It differs from a 'specializes-from' as 'specializes-from' is usually used to describe the association between a super-class and a sub-class. For example: Printer is-a printer.

37. What is slicing? Answer:

Slicing means that the data added by a subclass are discarded when an object of the subclass is passed or returned by value or from a function expecting a base class object. Explanation: Consider the following class declaration: class base { ... base& operator =(const base&); base (const base&); } void fun( ) { base e=m; e=m; } As base copy functions don't know anything about the derived only the base part of the derived is copied. This is commonly referred to as slicing. One reason to pass objects of classes in a hierarchy is to avoid slicing. Other reasons are to preserve polymorphic behavior and to gain efficiency.

38. What is name mangling? Answer:

Name mangling is the process through which your c++ compilers give each function in your program a unique name. In C++, all programs have at-least a few functions with the same name. Name mangling is a concession to the fact that linker always insists on all function names being unique.
Example:

In general, member names are made unique by concatenating the name of the member with that of the class e.g. given the declaration: class Bar { public: int ival; ... }; ival becomes something like: // a possible member name mangling ival__3Bar Consider this derivation: class Foo : public Bar { public: int ival; ... }

The internal representation of a Foo object is the concatenation of its base and derived class members.
// Pseudo C++ code // Internal representation of Foo class Foo { public: int ival__3Bar;

int ival__3Foo; ... };

Unambiguous access of either ival members is achieved through name mangling. Member functions, because they can be overloaded, require an extensive mangling to provide each with a unique name. Here the compiler generates the same name for the two overloaded instances(Their argument lists make their instances unique).

39. What are proxy objects? Answer: Objects that points to other objects are called proxy objects or surrogates. Its an object that provides the same interface as its server object but does not have any functionality. During a method invocation, it routes data to the true server object and sends back the return value to the object. 40. Differentiate between declaration and definition in C++. Answer:

A declaration introduces a name into the program; a definition provides a unique description of an entity (e.g. type, instance, and function). Declarations can be repeated in a given scope, it introduces a name in a given scope. There must be exactly one definition of every object, function or class used in a C++ program.
A declaration is a definition unless: it declares a function without specifying its body, it contains an extern specifier and no initializer or function body, it is the declaration of a static class data member without a class definition, it is a class name definition, it is a typedef declaration.

A definition is a declaration unless:

it defines a static class data member, it defines a non-inline member function.

41. What is cloning? Answer:

An object can carry out copying in two ways i.e. it can set itself to be a copy of another object, or it can return a copy of itself. The latter process is called cloning.

42. Describe the main characteristics of static functions. Answer: The main characteristics of static functions include, It is without the a this pointer, It can't directly access the non-static members of its class It can't be declared const, volatile or virtual. It doesn't need to be invoked through an object of its class, although for convenience, it may. 43. Will the inline function be compiled as the inline function always? Justify. Answer: An inline function is a request and not a command. Hence it won't be compiled as an inline function always. Explanation: Inline-expansion could fail if the inline function contains loops, the address of an inline function is used, or an inline function is called in a complex expression. The rules for inlining are compiler dependent.

44. Define a way other than using the keyword inline to make a function inline. Answer: The function must be defined inside the class.

45. How can a '::' operator be used as unary operator? Answer:

The scope operator can be used to refer to members of the global namespace. Because the global namespace doesnt have a name, the notation :: member-name refers to a member of the global namespace. This can be useful for referring to members of global namespace whose names have been hidden by names declared in nested local scope. Unless we specify to the compiler in which namespace to search for a declaration, the compiler simple searches the current scope, and any scopes in which the current scope is nested, to find the declaration for the name.

46. What is placement new? Answer:

When you want to call a constructor directly, you use the placement new. Sometimes you have some raw memory that's already been allocated, and you need to construct an object in the memory you have. Operator new's special version placement new allows you to do it.
class Widget { public : Widget(int widgetsize); ... Widget* Construct_widget_int_buffer(void *buffer,int widgetsize) { return new(buffer) Widget(widgetsize); } };

This function returns a pointer to a Widget object that's constructed within the buffer passed to the function. Such a function might be useful for applications using shared memory or memory-mapped I/O, because objects in such applications must be placed at specific addresses or in memory allocated by special routines.

OOAD
1. What do you mean by analysis and design? Analysis: Basically, it is the process of determining what needs to be done before how it should be done. In order to accomplish this, the developer refers the existing systems and documents. So, simply it is an art of discovery. Design: It is the process of adopting/choosing the one among the many, which best accomplishes the users needs. So, simply, it is compromising mechanism.

2. What are the steps involved in designing? Before getting into the design the designer should go through the SRS prepared by the System Analyst. The main tasks of design are Architectural Design and Detailed Design. In Architectural Design we find what are the main modules in the problem domain. In Detailed Design we find what should be done within each module.

3. What are the main underlying concepts of object orientation? Objects, messages, class, inheritance and polymorphism are the main concepts of object orientation.

4. What do u meant by "SBI" of an object? SBI stands for State, Behavior and Identity. Since every object has the above three. State: It is just a value to the attribute of an object at a particular time. Behaviour: It describes the actions and their reactions of that object. Identity: An object has an identity that characterizes its own existence. The identity makes it possible to distinguish any object in an unambiguous way, and independently from its state.

5. Differentiate persistent & non-persistent objects?

Persistent refers to an object's ability to transcend time or space. A persistent object stores/saves its state in a permanent storage system with out losing the information represented by the object. A non-persistent object is said to be transient or ephemeral. By default objects are considered as non-persistent.

6. What do you meant by active and passive objects? Active objects are one which instigate an interaction which owns a thread and they are responsible for handling control to other objects. In simple words it can be referred as client. Passive objects are one, which passively waits for the message to be processed. It waits for another object that requires its services. In simple words it can be referred as server.

Diagram: client (Active) server

(Passive)

7. What is meant by software development method? Software development method describes how to model and build software systems in a reliable and reproducible way. To put it simple, methods that are used to represent ones' thinking using graphical notations.

8. What are models and meta models? Model: It is a complete description of something (i.e. system). Meta model: It describes the model elements, syntax and semantics of the notation that allows their manipulation.

9. What do you meant by static and dynamic modeling? Static modeling is used to specify structure of the objects that exist in the problem domain. These are expressed using class, object and USECASE diagrams. But Dynamic modeling refers representing the object interactions during runtime. It is represented by sequence, activity, collaboration and statechart diagrams.

10. How to represent the interaction between the modeling elements? Model element is just a notation to represent (Graphically) the entities that exist in the problem domain. e.g. for modeling element is class notation, object notation etc. Relationships are used to represent the interaction between the modeling elements. The following are the Relationships.

Association: Its' just a semantic connection two classes. e.g.: uses classA classB

Aggregation: Its' the relationship between two classes which are related in the fashion that master and slave. The master takes full rights than the slave. Since the slave works under the master. It is represented as line with diamond in the master area. ex: car contains wheels, etc. car car wheels

Containment: This relationship is applied when the part contained with in the whole part, dies when the whole part dies. It is represented as darked diamond at the whole part. example: class A{ //some code };

class B {

A aa; // an object of class A; // some code for class B; }; In the above example we see that an object of class A is instantiated with in the class B. so the object class A dies when the object class B dies.we can represnt it in diagram like this.

classA

classB

Generalization: This relationship used when we want represents a class, which captures the common states of objects of different classes. It is represented as arrow line pointed at the class, which has captured the common states. classA

classB

classC

Dependency: It is the relationship between dependent and independent classes. Any change in the independent class will affect the states of the dependent class. DIAGRAM: class A class B

11. Why generalization is very strong? Even though Generalization satisfies Structural, Interface, Behaviour properties. It is mathematically very strong, as it is Antisymmetric and Transitive. Antisymmetric: employee is a person, but not all persons are employees. Mathematically all As are B, but all Bs not A.

Transitive: A=>B, B=>c then A=>c. A. Salesman. B. Employee. C. Person. Note: All the other relationships satisfy all the properties like Structural properties, Interface properties, Behaviour properties.

12. Differentiate Aggregation and containment? Aggregation is the relationship between the whole and a part. We can add/subtract some properties in the part (slave) side. It won't affect the whole part. Best example is Car, which contains the wheels and some extra parts. Even though the parts are not there we can call it as car. But, in the case of containment the whole part is affected when the part within that got affected. The human body is an apt example for this relationship. When the whole body dies the parts (heart etc) are died.

13. Can link and Association applied interchangeably? No, You cannot apply the link and Association interchangeably. Since link is used represent the relationship between the two objects. But Association is used represent the relationship between the two classes. link :: Association:: student:Abhilash student course:MCA course

14. what is meant by "method-wars"? Before 1994 there were different methodologies like Rumbaugh, Booch, Jacobson, Meyer etc who followed their own notations to model the systems. The developers were in a dilemma to choose the method which best accomplishes their needs. This particular span was called as "method-wars"

15. Whether unified method and unified modeling language are same or different? Unified method is convergence of the Rumbaugh and Booch. Unified modeling lang. is the fusion of Rumbaugh, Booch and Jacobson as well as Betrand Meyer (whose contribution is "sequence diagram"). Its' the superset of all the methodologies.

16. Who were the three famous amigos and what was their contribution to the object community? The Three amigos namely, James Rumbaugh (OMT): A veteran in analysis who came up with an idea about the objects and their Relationships (in particular Associations). Grady Booch: A veteran in design who came up with an idea about partitioning of systems into subsystems. Ivar Jacobson (Objectory): The father of USECASES, who described about the user and system interaction. 17. Differentiate the class representation of Booch, Rumbaugh and UML? If you look at the class representaiton of Rumbaugh and UML, It is some what similar and both are very easy to draw. Representation: OMT Diagram: UML.

Booch: In this method classes are represented as "Clouds" which are not very easy to draw as for as the developer's view is concern. Diagram:

18. What is an USECASE? Why it is needed? A Use Case is a description of a set of sequence of actions that a system performs that yields an observable result of value to a particular action. In SSAD process <=> In OOAD USECASE. It is represented elliptically.

Representation:

19. Who is an Actor? An Actor is someone or something that must interact with the system.In addition to that Actor initiates the process(that is USECASE). It is represented as a stickman like this. Diagram:

an

20. What is guard condition? Guard condition is one, which acts as a firewall. The access from a particular object can be made only when the particular condition is met. For Example, customer check customer number ATM.

Here the object on the customer accesses the ATM facility only when the guard condition is met.

21. Differentiate the following notations? I: :obj1 :obj2

II:

:obj1

:obj2

In the above representation I, obj1 sends message to obj2. But in the case of II the data is transferred from obj1 to obj2.

22. USECASE is an implementation independent notation. How will the designer give the implementation details of a particular USECASE to the programmer? This can be accomplished by specifying the relationship called "refinement which talks about the two different abstraction of the same thing. Or example,

calculate pay

calculate

class1 class2 class3

23. Suppose a class acts an Actor in the problem domain, how to represent it in the static model? In this scenario you can use stereotype. Since stereotype is just a string that gives extra semantic to the particular entity/model element. It is given with in the << >>.

class A << Actor>> attributes

methods.

24. Why does the function arguments are called as "signatures"? The arguments distinguish functions with the same name (functional polymorphism). The name alone does not necessarily identify a unique function. However, the name and its arguments (signatures) will uniquely identify a function. In real life we see suppose, in class there are two guys with same name, but they can be easily identified by their signatures. The same concept is applied here.

ex: class person { public: char getsex(); void setsex(char); void setsex(int); }; In the above example we see that there is a function setsex() with same name but with different signature.

Data Structure
1. What is data structure? A data structure is a way of organizing data that considers not only the items stored, but also their relationship to each other. Advance knowledge about the relationship between data items allows designing of efficient algorithms for the manipulation of data.

2. List out the areas in which data structures are applied extensively? Compiler Design, Operating System, Database Management System, Statistical analysis package, Numerical Analysis, Graphics, Artificial Intelligence, Simulation 3. What are the major data structures used in the following areas : RDBMS, Network data model & Hierarchical data model. RDBMS Array (i.e. Array of structures) Network data model Graph Hierarchical data model Trees

4. If you are using C language to implement the heterogeneous linked list, what pointer type will you use?

The heterogeneous linked list contains different data types in its nodes and we need a link, pointer to connect them. It is not possible to use ordinary pointers for this. So we go for void pointer. Void pointer is capable of storing pointer to any type as it is a generic pointer type.
5. Minimum number of queues needed to implement the priority queue? Two. One queue is used for actual storing of data and another for storing priorities.

6. What is the data structures used to perform recursion? Stack. Because of its LIFO (Last In First Out) property it remembers its caller so knows whom to return when the function has to return. Recursion makes use of system stack for storing the return addresses of the function calls. Every recursive function has its equivalent iterative (non-recursive) function. Even when such equivalent iterative procedures are written, explicit stack is to be used.

7. What are the notations used in Evaluation of Arithmetic Expressions using prefix and postfix forms? Polish and Reverse Polish notations.

8. Convert the expression ((A + B) * C (D E) ^ (F + G)) to equivalent Prefix and Postfix notations. Prefix Notation: ^ - * +ABC - DE + FG Postfix Notation: AB + C * DE - - FG + ^

9. Sorting is not possible by using which of the following methods? (a) Insertion (b) Selection (c) Exchange (d) Deletion

(d) Deletion. Using insertion we can perform insertion sort, using selection we can perform selection sort, using exchange we can perform the bubble sort (and other similar sorting methods). But no sorting method can be done just using deletion.

10. A binary tree with 20 nodes has 21

null branches?

Let us take a tree with 5 nodes (n=5)

NullBranches

It will have only 6 (ie,5+1) null branches. In general, A binary tree with n nodes has exactly n+1 null nodes.

11. What are the methods available in storing sequential files ? Straight merging, Natural merging, Polyphase sort, Distribution of Initial runs.

12. How many different trees are possible with 10 nodes ? 1014 For example, consider a tree with 3 nodes(n=3), it will have the maximum combination of 5 different (ie, 23 - 3 = 5) trees.

ii

iii

iv

In general: If there are n nodes, there exist 2n-n different trees.

13. List out few of the Application of tree data-structure? The manipulation of Arithmetic expression, Symbol Table construction, Syntax analysis. 14. List out few of the applications that make use of Multilinked Structures? Sparse matrix, Index generation. 15. In tree construction which is the suitable efficient data structure? (a) Array (b) Linked list (c) Stack (d) Queue (e) none

(b) Linked list

16. What is the type of the algorithm used in solving the 8 Queens problem? Backtracking

17. In an AVL tree, at what condition the balancing is to be done? If the pivotal value (or the Height factor) is greater than 1 or less than 1.

18. What is the bucket size, when the overlapping and collision occur at same time? One. If there is only one entry possible in the bucket, when the collision occurs, there is no way to accommodate the colliding value. This results in the overlapping of values.

19. Traverse the given tree using Inorder, Preorder and Postorder traversals. Giventree: A

Inorder : D H B E A F C I G J Preorder: A B D H E C F G I J Postorder: H D E B F I J G C A 20. There are 8, 15, 13, 14 nodes were there in 4 different trees. Which of them could have formed a full binary tree? 15. In general: There are 2n-1 nodes in a full binary tree. By the method of elimination: Full binary trees contain odd number of nodes. So there cannot be full binary trees with 8 or 14 nodes, so rejected. With 13 nodes you can form a complete binary tree but not a full binary tree. So the correct answer is 15. Note: Full and Complete binary trees are different. All full binary trees are complete binary trees but not vice versa.

21. In the given binary tree, using array you can store the node 4 at which location? 1

4 5 At location 6

Root

LC1

RC1

LC2

RC2

LC3

RC3

LC4

RC4

where LCn means Left Child of node n and RCn means Right Child of node n

22. Sort the given values using Quick Sort?

65

70

75

80

85

60

55

50

45

Sorting takes place from the pivot value, which is the first value of the given elements, this is marked bold. The values at the left pointer and right pointer are indicated using L and R respectively.

65

70L

75

80

85

60

55

50

45R

Since pivot is not yet changed the same process is continued after interchanging the values at positions

and

65

45

75 L

80

85

60

55

50 R

70

65

45

50

80 L

85

60

55 R

75

70

65

45

50

55

85 L

60 R

80

75

70

65

45

50

55

60 R

85 L

80

75

70

When the L and R pointers cross each other the pivot value is interchanged with the value at right pointer. If the pivot is changed it means that the pivot has occupied its original position in the sorted order (shown in bold italics) and hence two different arrays are formed, one from start of the original array to the pivot position-1 and the other from pivot position+1 to end.

60 L

45

50

55 R

65

85 L

80

75

70 R

55 L

45

50 R

60

65

70 R

80 L

75

85

50 L

45 R

55

60

65

70

80 L

75 R

85

In the next pass we get the sorted form of the array.

45

50

55

60

65

70

75

80

85

23. For the given graph, draw the DFS and BFS?

Thegivengraph:

BFS: DFS:

AXGHPEMYJ AXHPEYMJG

24. Classify the Hashing Functions based on the various methods by which the key value is found. Direct method, Subtraction method, Modulo-Division method, Digit-Extraction method, Mid-Square method, Folding method, Pseudo-random method. 25. What are the types of Collision Resolution Techniques and the methods used in each of the type? Open addressing (closed hashing), The methods used include: Overflow block, Closed addressing (open hashing) The methods used include: Linked list, Binary tree

26. In RDBMS, what is the efficient data structure used in the internal storage representation? B+ tree. Because in B+ tree, all the data is stored only in leaf nodes, that makes searching easier. This corresponds to the records that shall be stored in leaf nodes.

27. Draw the B-tree of order 3 created by inserting the following data arriving in sequence 92 24 6 7 11 8 22 4 5 16 19 20 78
1

19

24

28. Of the following tree structure, which is, efficient considering space and time complexities?
(a) Incomplete Binary Tree (b) Complete Binary Tree (c) Full Binary Tree (b) Complete Binary Tree. By the method of elimination: Full binary tree loses its nature when operations of insertions and deletions are done. For incomplete binary trees, extra storage is required and overhead of NULL node checking takes place. So complete binary tree is the better one since the property of complete binary tree is maintained even after operations like additions and deletions are done on it.

29. What is a spanning Tree? A spanning tree is a tree associated with a network. All the nodes of the graph appear on the tree once. A minimum spanning tree is a spanning tree organized so that the total edge weight between nodes is minimized.

30. Does the minimum spanning tree of a graph give the shortest distance between any 2 specified nodes? No. Minimal spanning tree assures that the total weight of the tree is kept at its minimum. But it doesnt mean that the distance between any two nodes involved in the minimum-spanning tree is minimum.

31. Convert the given graph with weighted edges to minimal spanning tree.

1
410

600 612 2985

3
310

200

5
400

1421

the equivalent minimal spanning tree is:

1

3 612 310 4 200 5

410 2

32. Which is the simplest file structure? (a) Sequential (b) Indexed (c) Random (a) Sequential

33. Whether Linked List is linear or Non-linear data structure? According to Access strategies Linked list is a linear one. According to Storage Linked List is a Non-linear one.

34. Draw a binary Tree for the expression : A * B - (C + D) * (P / Q)

35. For the following COBOL code, draw the Binary tree? 01 STUDENT_REC. 02 NAME. 03 FIRST_NAME PIC X(10). 03 LAST_NAME PIC X(10).

02 YEAR_OF_STUDY. 03 FIRST_SEM PIC XX. 03 SECOND_SEM PIC XX.

01 STUDENT_REC

02 NAME YEAR OF STUDY

02

03 FIRST NAME 1. What is database?

03 LAST NAME FIRST SEM

03 SECOND SEM

03

RDBMS Concepts
A database is a logically coherent collection of data with some inherent meaning, representing some aspect of real world and which is designed, built and populated with data for a specific purpose.

2. What is DBMS? It is a collection of programs that enables user to create and maintain a database. In other words it is general-purpose software that provides the users with the processes of defining, constructing and manipulating the database for various applications.

3. What is a Database system? The database and DBMS software together is called as Database system.

4. Advantages of DBMS?

Redundancy is controlled. Unauthorised access is restricted. Providing multiple user interfaces. Enforcing integrity constraints. Providing backup and recovery. 5. Disadvantage in File Processing System? Data redundancy & inconsistency. Difficult in accessing data. Data isolation. Data integrity. Concurrent access is not possible. Security Problems. 6. Describe the three levels of data abstraction? The are three levels of abstraction: Physical level: The lowest level of abstraction describes how data are stored. Logical level: The next higher level of abstraction, describes what data are stored in database and what relationship among those data. View level: The highest level of abstraction describes only part of entire database.

7. Define the "integrity rules" There are two Integrity rules. Entity Integrity: States that Primary key cannot have NULL value Referential Integrity: States that Foreign Key can be either a NULL value or should be Primary Key value of other relation. 8. What is extension and intension? Extension It is the number of tuples present in a table at any instance. This is time dependent. Intension It is a constant value that gives the name, structure of table and the constraints laid on it. 9. What is System R? What are its two major subsystems? System R was designed and developed over a period of 1974-79 at IBM San Jose Research Center. It is a prototype and its purpose was to demonstrate that it is possible to build a Relational System that can be used in a real life environment to solve real life problems, with performance at least comparable to that of existing system. Its two subsystems are Research Storage System Relational Data System. 10. How is the data structure of System R different from the relational structure? Unlike Relational systems in System R Domains are not supported

Enforcement of candidate key uniqueness is optional Enforcement of entity integrity is optional Referential integrity is not enforced
11. What is Data Independence?

Data independence means that the application is independent of the storage structure and access strategy of data. In other words, The ability to modify the schema definition in one level should not affect the schema definition in the next higher level.
Two types of Data Independence: Physical Data Independence: Modification in physical level should not affect the logical level. Logical Data Independence: Modification in logical level should affect the view level.

NOTE: Logical Data Independence is more difficult to achieve 12. What is a view? How it is related to data independence? A view may be thought of as a virtual table, that is, a table that does not really exist in its own right but is instead derived from one or more underlying base table. In other words, there is no stored file that direct represents the view instead a definition of view is stored in data dictionary. Growth and restructuring of base tables is not reflected in views. Thus the view can insulate users from the effects of restructuring and growth in the database. Hence accounts for logical data independence.
13. What is Data Model? A collection of conceptual tools for describing data, data relationships data semantics and constraints.

14. What is E-R model? This data model is based on real world that consists of basic objects called entities and of relationship among these objects. Entities are described in a database by a set of attributes.

15. What is Object Oriented model? This model is based on collection of objects. An object contains values stored in instance variables with in the object. An object also contains bodies of code that operate on the object. These bodies of code are called methods. Objects that contain same types of values and the same methods are grouped together into classes.

16. What is an Entity? It is a 'thing' in the real world with an independent existence.

17. What is an Entity type? It is a collection (set) of entities that have same attributes.

18. What is an Entity set? It is a collection of all entities of particular entity type in the database.

19. What is an Extension of entity type? The collections of entities of a particular entity type are grouped together into an entity set.

20. What is Weak Entity set? An entity set may not have sufficient attributes to form a primary key, and its primary key compromises of its partial key and primary key of its parent entity, then it is said to be Weak Entity set.

21. What is an attribute? It is a particular property, which describes the entity.

22. What is a Relation Schema and a Relation? A relation Schema denoted by R(A1, A2, , An) is made up of the relation name R and the list of attributes Ai that it contains. A relation is defined as a set of tuples. Let r be the relation which contains set tuples (t1, t2, t3, ..., tn). Each tuple is an ordered list of n-values t=(v1,v2, ..., vn).

23. What is degree of a Relation? It is the number of attribute of its relation schema.

24. What is Relationship? It is an association among two or more entities.

25. What is Relationship set? The collection (or set) of similar relationships.

26. What is Relationship type? Relationship type defines a set of associations or a relationship set among a given set of entity types.

27. What is degree of Relationship type? It is the number of entity type participating.

25. What is DDL (Data Definition Language)? A data base schema is specifies by a set of definitions expressed by a special language called DDL.

26. What is VDL (View Definition Language)? It specifies user views and their mappings to the conceptual schema.

27. What is SDL (Storage Definition Language)? This language is to specify the internal schema. This language may specify the mapping between two schemas.

28. What is Data Storage - Definition Language? The storage structures and access methods used by database system are specified by a set of definition in a special type of DDL called data storage-definition language.

29. What is DML (Data Manipulation Language)? This language that enable user to access or manipulate data as organised by appropriate data model. Procedural DML or Low level: DML requires a user to specify what data are needed and how to get those data. Non-Procedural DML or High level: DML requires a user to specify what data are needed without specifying how to get those data. 31. What is DML Compiler? It translates DML statements in a query language into low-level instruction that the query evaluation engine can understand.

32. What is Query evaluation engine? It executes low-level instruction generated by compiler.

33. What is DDL Interpreter? It interprets DDL statements and record them in tables containing metadata.

34. What is Record-at-a-time? The Low level or Procedural DML can specify and retrieve each record from a set of records. This retrieve of a record is said to be Record-at-a-time.

35. What is Set-at-a-time or Set-oriented? The High level or Non-procedural DML can specify and retrieve many records in a single DML statement. This retrieve of a record is said to be Set-at-a-time or Set-oriented.

36. What is Relational Algebra? It is procedural query language. It consists of a set of operations that take one or two relations as input and produce a new relation.

37. What is Relational Calculus? It is an applied predicate calculus specifically tailored for relational databases proposed by E.F. Codd. E.g. of languages based on it are DSL ALPHA, QUEL. 38. How does Tuple-oriented relational calculus differ from domain-oriented relational calculus The tuple-oriented calculus uses a tuple variables i.e., variable whose only permitted values are tuples of that relation. E.g. QUEL The domain-oriented calculus has domain variables i.e., variables that range over the underlying domains instead of over relation. E.g. ILL, DEDUCE. 39. What is normalization?
It is a process of analysing the given relation schemas based on their Functional Dependencies (FDs) and primary key to achieve the properties Minimizing redundancy Minimizing insertion, deletion and update anomalies. 40. What is Functional Dependency? A Functional dependency is denoted by X Y between two sets of attributes X and Y that are subsets of R specifies a constraint on the possible tuple that can form a relation state r of R. The constraint is for any two tuples t1 and t2 in r if t1[X] = t2[X] then they have t1[Y] = t2[Y]. This means the value of X component of a tuple uniquely determines the value of component Y.

41. When is a functional dependency F said to be minimal? Every dependency in F has a single attribute for its right hand side. We cannot replace any dependency X A in F with a dependency Y A where Y is a proper subset of X and still have a set of dependency that is equivalent to F. We cannot remove any dependency from F and still have set of dependency that is equivalent to F. 42. What is Multivalued dependency? Multivalued dependency denoted by X Y specified on relation schema R, where X and Y are both subsets of R, specifies the following constraint on any relation r of R: if two tuples t1 and t2 exist in r such that t1[X] = t2[X] then t3 and t4 should also exist in r with the following properties t3[x] = t4[X] = t1[X] = t2[X] t3[Y] = t1[Y] and t4[Y] = t2[Y] t3[Z] = t2[Z] and t4[Z] = t1[Z] where [Z = (R-(X U Y)) ]

43. What is Lossless join property? It guarantees that the spurious tuple generation does not occur with respect to relation schemas after decomposition.

44. What is 1 NF (Normal Form)? The domain of attribute must include only atomic (simple, indivisible) values.

45. What is Fully Functional dependency? It is based on concept of full functional dependency. A functional dependency X Y is full functional dependency if removal of any attribute A from X means that the dependency does not hold any more.

46. What is 2NF? A relation schema R is in 2NF if it is in 1NF and every non-prime attribute A in R is fully functionally dependent on primary key.

47. What is 3NF? A relation schema R is in 3NF if it is in 2NF and for every FD X

A either of the following is true

X is a Super-key of R. A is a prime attribute of R. In other words, if every non prime attribute is non-transitively dependent on primary key.

48. What is BCNF (Boyce-Codd Normal Form)? A relation schema R is in BCNF if it is in 3NF and satisfies an additional constraint that for every FD X A, X must be a candidate key.

49. What is 4NF? A relation schema R is said to be in 4NF if for every Multivalued dependency holds over R, one of following is true X is subset or equal to (or) XY = R. X is a super key.

Y that

50. What is 5NF? A Relation schema R is said to be 5NF if for every join dependency {R1, R2, ..., Rn} that holds R, one the following is true Ri = R for some i. The join dependency is implied by the set of FD, over R in which the left side is key of R. 51. What is Domain-Key Normal Form? A relation is said to be in DKNF if all constraints and dependencies that should hold on the the constraint can be enforced by simply enforcing the domain constraint and key constraint on the relation.

52. What are partial, alternate,, artificial, compound and natural key?
Partial Key:

It is a set of attributes that can uniquely identify weak entities and that are related to same owner entity. It is sometime called as Discriminator. Alternate Key: All Candidate Keys excluding the Primary Key are known as Alternate Keys. Artificial Key: If no obvious key, either stand alone or compound is available, then the last resort is to simply create a key, by assigning a unique number to each record or occurrence. Then this is known as developing an artificial key. Compound Key: If no single data element uniquely identifies occurrences within a construct, then combining multiple elements to create a unique identifier for the construct is known as creating a compound key. Natural Key: When one of the data elements stored within a construct is utilized as the primary key, then it is called the natural key. 53. What is indexing and what are the different kinds of indexing? Indexing is a technique for determining how quickly specific data can be found. Types:

Binary search style indexing B-Tree indexing Inverted list indexing Memory resident table Table indexing 54. What is system catalog or catalog relation? How is better known as? A RDBMS maintains a description of all the data that it contains, information about every relation and index that it contains. This information is stored in a collection of relations maintained by the system called metadata. It is also called data dictionary. 55. What is meant by query optimization? The phase that identifies an efficient execution plan for evaluating a query that has the least estimated cost is referred to as query optimization. 56. What is join dependency and inclusion dependency? Join Dependency:
A Join dependency is generalization of Multivalued dependency.A JD {R1, R2, ..., Rn} is said to hold over a relation R if R1, R2, R3, ..., Rn is a lossless-join decomposition of R . There is no set of sound and complete inference rules for JD.

Inclusion Dependency: An Inclusion Dependency is a statement of the form that some columns of a relation are contained in other columns. A foreign key constraint is an example of inclusion dependency. 57. What is durability in DBMS? Once the DBMS informs the user that a transaction has successfully completed, its effects should persist even if the system crashes before all its changes are reflected on disk. This property is called durability. 58. What do you mean by atomicity and aggregation? Atomicity: Either all actions are carried out or none are. Users should not have to worry about the effect of incomplete transactions. DBMS ensures this by undoing the actions of incomplete transactions. Aggregation: A concept which is used to model a relationship between a collection of entities and relationships. It is used when we need to express a relationship among relationships. 59. What is a Phantom Deadlock? In distributed deadlock detection, the delay in propagating local information might cause the deadlock detection algorithms to identify deadlocks that do not really exist. Such situations are called phantom deadlocks and they lead to unnecessary aborts. 60. What is a checkpoint and When does it occur?

A Checkpoint is like a snapshot of the DBMS state. By taking checkpoints, the DBMS can reduce the amount of work to be done during restart in the event of subsequent crashes. 61. What are the different phases of transaction? Different phases are Analysis phase Redo Phase Undo phase 62. What do you mean by flat file database? It is a database in which there are no programs or user access languages. It has no cross-file capabilities but is user-friendly and provides user-interface management. 63. What is "transparent DBMS"? It is one, which keeps its Physical Structure hidden from user. 64. Brief theory of Network, Hierarchical schemas and their properties Network schema uses a graph data structure to organize records example for such a database management system is CTCG while a hierarchical schema uses a tree data structure example for such a system is IMS. 65. What is a query? A query with respect to DBMS relates to user commands that are used to interact with a data base. The query language can be classified into data definition language and data manipulation language. 66. What do you mean by Correlated subquery?
Subqueries, or nested queries, are used to bring back a set of rows to be used by the parent query. Depending on how the subquery is written, it can be executed once for the parent query or it can be executed once for each row returned by the parent query. If the subquery is executed for each row of the parent, this is called a correlated subquery. A correlated subquery can be easily identified if it contains any references to the parent subquery columns in its WHERE clause. Columns from the subquery cannot be referenced anywhere else in the parent query. The following example demonstrates a non-correlated subquery.

E.g. Select * From CUST Where '10/03/1990' IN (Select ODATE From ORDER Where CUST.CNUM = ORDER.CNUM) 67. What are the primitive operations common to all record management systems? Addition, deletion and modification. 68. Name the buffer in which all the commands that are typed in are stored Edit Buffer 69. What are the unary operations in Relational Algebra? PROJECTION and SELECTION.

70. Are the resulting relations of PRODUCT and JOIN operation the same? No. PRODUCT: Concatenation of every row in one relation with every row in another. JOIN: Concatenation of rows from one relation and related rows from another. 71. What is RDBMS KERNEL? Two important pieces of RDBMS architecture are the kernel, which is the software, and the data dictionary, which consists of the system-level data structures used by the kernel to manage the database You might think of an RDBMS as an operating system (or set of subsystems), designed specifically for controlling data access; its primary functions are storing, retrieving, and securing data. An RDBMS maintains its own list of authorized users and their associated privileges; manages memory caches and paging; controls locking for concurrent resource usage; dispatches and schedules user requests; and manages space usage within its table-space structures . 72. Name the sub-systems of a RDBMS I/O, Security, Language Processing, Process Control, Storage Management, Logging and Recovery, Distribution Control, Transaction Control, Memory Management, Lock Management 73. Which part of the RDBMS takes care of the data dictionary? How Data dictionary is a set of tables and database objects that is stored in a special area of the database and maintained exclusively by the kernel. 74. What is the job of the information stored in data-dictionary? The information in the data dictionary validates the existence of the objects, provides access to them, and maps the actual physical storage location. 75. Not only RDBMS takes care of locating data it also determines an optimal access path to store or retrieve the data 76. How do you communicate with an RDBMS? You communicate with an RDBMS using Structured Query Language (SQL) 77. Define SQL and state the differences between SQL and other conventional programming Languages SQL is a nonprocedural language that is designed specifically for data access operations on normalized relational database structures. The primary difference between SQL and other conventional programming languages is that SQL statements specify what data operations should be performed rather than how to perform them. 78. Name the three major set of files on disk that compose a database in Oracle
There are three major sets of files on disk that compose a database. All the files are binary. These are

Database files Control files Redo logs

The most important of these are the database files where the actual data resides. The control files and the redo logs support the functioning of the architecture itself.
All three sets of files must be present, open, and available to Oracle for any data on the database to be useable. Without these files, you cannot access the database, and the database administrator might have to recover some or all of the database using a backup, if there is one.

79. What is an Oracle Instance?

The Oracle system processes, also known as Oracle background processes, provide functions for the user processesfunctions that would otherwise be done by the user processes themselves Oracle database-wide system memory is known as the SGA, the system global area or shared global area. The data and control structures in the SGA are shareable, and all the Oracle background processes and user processes can use them. The combination of the SGA and the Oracle background processes is known as an Oracle instance

80. What are the four Oracle system processes that must always be up and running for the database to be useable
The four Oracle system processes that must always be up and running for the database to be useable include DBWR (Database Writer), LGWR (Log Writer), SMON (System Monitor), and PMON (Process Monitor).

81. What are database files, control files and log files. How many of these files should a database have at least? Why?
Database Files The database files hold the actual data and are typically the largest in size. Depending on their sizes, the tables (and other objects) for all the user accounts can go in one database filebut that's not an ideal situation because it does not make the database structure very flexible for controlling access to storage for different users, putting the database on different disk drives, or backing up and restoring just part of the database.

You must have at least one database file but usually, more than one files are used. In terms of accessing and using the data in the tables and other objects, the number (or location) of the files is immaterial.
The database files are fixed in size and never grow bigger than the size at which they were created Control Files

The control files and redo logs support the rest of the architecture. Any database must have at least one control file, although you typically have more than one to guard against loss. The control file records the name of the database, the date and time it

was created, the location of the database and redo logs, and the synchronization information to ensure that all three sets of files are always in step. Every time you add a new database or redo log file to the database, the information is recorded in the control files.
Redo Logs Any database must have at least two redo logs. These are the journals for the database; the redo logs record all changes to the user objects or system objects. If any type of failure occurs, the changes recorded in the redo logs can be used to bring the database to a consistent state without losing any committed transactions. In the case of non-data loss failure, Oracle can apply the information in the redo logs automatically without intervention from the DBA. The redo log files are fixed in size and never grow dynamically from the size at which they were created.

82. What is ROWID?

The ROWID is a unique database-wide physical address for every row on every table. Once assigned (when the row is first inserted into the database), it never changes until the row is deleted or the table is dropped. The ROWID consists of the following three components, the combination of which uniquely identifies the physical storage location of the row. Oracle database file number, which contains the block with the rows Oracle block address, which contains the row The row within the block (because each block can hold many rows) The ROWID is used internally in indexes as a quick means of retrieving rows with a particular key value. Application developers also use it in SQL statements as a quick way to access a row once they know the ROWID

83. What is Oracle Block? Can two Oracle Blocks have the same address?
Oracle "formats" the database files into a number of Oracle blocks when they are first created making it easier for the RDBMS software to manage the files and easier to read data into the memory areas.

The block size should be a multiple of the operating system block size. Regardless of the block size, the entire block is not available for holding data; Oracle takes up some space to manage the contents of the block. This block header has a minimum size, but it can grow.
These Oracle blocks are the smallest unit of storage. Increasing the Oracle block size can improve performance, but it should be done only when the database is first created.

Each Oracle block is numbered sequentially for each database file starting at 1. Two blocks can have the same block address if they are in different database files.

84. What is database Trigger?

A database trigger is a PL/SQL block that can defined to automatically execute for insert, update, and delete statements against a table. The trigger can e defined to execute once for the entire statement or once for every row that is inserted, updated, or deleted. For any one table, there are twelve events for which you can define database triggers. A database trigger can call database procedures that are also written in PL/SQL.

85. Name two utilities that Oracle provides, which are use for backup and recovery.
Along with the RDBMS software, Oracle provides two utilities that you can use to back up and restore the database. These utilities are Export and Import. The Export utility dumps the definitions and data for the specified part of the database to an operating system binary file. The Import utility reads the file produced by an export, recreates the definitions of objects, and inserts the data If Export and Import are used as a means of backing up and recovering the database, all the changes made to the database cannot be recovered since the export was performed. The best you can do is recover the database to the time when the export was last performed.

86. What are stored-procedures? And what are the advantages of using them. Stored procedures are database objects that perform a user defined operation. A stored procedure can have a set of compound SQL statements. A stored procedure executes the SQL commands and returns the result to the client. Stored procedures are used to reduce network traffic. 87. How are exceptions handled in PL/SQL? Give some of the internal exceptions' name
PL/SQL exception handling is a mechanism for dealing with run-time errors encountered during procedure execution. Use of this mechanism enables execution to continue if the error is not severe enough to cause procedure termination. The exception handler must be defined within a subprogram specification. Errors cause the program to raise an exception with a transfer of control to the exception-handler block. After the exception handler executes, control returns to the block in which the handler was defined. If there are no more executable statements in the block, control returns to the caller. User-Defined Exceptions PL/SQL enables the user to define exception handlers in the declarations area of subprogram specifications. User accomplishes this by naming an exception as in the following example:

ot_failure EXCEPTION;

In this case, the exception name is ot_failure. Code associated with this handler is written in the EXCEPTION specification area as follows:

EXCEPTION when OT_FAILURE then out_status_code := g_out_status_code; out_msg := g_out_msg;

The following is an example of a subprogram exception:

EXCEPTION when NO_DATA_FOUND then g_out_status_code := 'FAIL'; RAISE ot_failure; Within this exception is the RAISE statement that transfers control back to the ot_failure exception handler. This technique of raising the exception is used to invoke all user-defined exceptions.
System-Defined Exceptions Exceptions internal to PL/SQL are raised automatically upon error. NO_DATA_FOUND is a system-defined exception. Table below gives a complete list of internal exceptions.

PL/SQL internal exceptions.

Exception Name
CURSOR_ALREADY_OPEN DUP_VAL_ON_INDEX INVALID_CURSOR INVALID_NUMBER LOGIN_DENIED NO_DATA_FOUND NOT_LOGGED_ON PROGRAM_ERROR STORAGE_ERROR TIMEOUT_ON_RESOURCE TOO_MANY_ROWS

Oracle Error
ORA-06511 ORA-00001 ORA-01001 ORA-01722 ORA-01017 ORA-01403 ORA-01012 ORA-06501 ORA-06500 ORA-00051 ORA-01422

TRANSACTION_BACKED_OUT VALUE_ERROR ZERO_DIVIDE

ORA-00061 ORA-06502 ORA-01476

In addition to this list of exceptions, there is a catch-all exception named OTHERS that traps all errors for which specific error handling has not been established.

88. Does PL/SQL support "overloading"? Explain

The concept of overloading in PL/SQL relates to the idea that you can define procedures and functions with the same name. PL/SQL does not look only at the referenced name, however, to resolve a procedure or function call. The count and data types of formal parameters are also considered.
PL/SQL also attempts to resolve any procedure or function calls in locally defined packages before looking at globally defined packages or internal functions. To further ensure calling the proper procedure, you can use the dot notation. Prefacing a procedure or function name with the package name fully qualifies any procedure or function reference.

89. Tables derived from the ERD a) Are totally unnormalised b) Are always in 1NF c) Can be further denormalised d) May have multi-valued attributes (b) Are always in 1NF 90. Spurious tuples may occur due to i. Bad normalization ii. Theta joins iii. Updating tables from join a) i & ii b) ii & iii c) i & iii d) ii & iii (a) i & iii because theta joins are joins made on keys that are not primary keys. 91. A B C is a set of attributes. The functional dependency is as follows AB -> B AC -> C C -> B a) is in 1NF b) is in 2NF c) is in 3NF d) is in BCNF

(a) is in 1NF since (AC)+ = { A, B, C} hence AC is the primary key. Since C B is a FD given, where neither C is a Key nor B is a prime attribute, this it is not in 3NF. Further B is not functionally dependent on key AC thus it is not in 2NF. Thus the given FDs is in 1NF. 92. In mapping of ERD to DFD a) entities in ERD should correspond to an existing entity/store in DFD b) entity in DFD is converted to attributes of an entity in ERD c) relations in ERD has 1 to 1 correspondence to processes in DFD d) relationships in ERD has 1 to 1 correspondence to flows in DFD (a) entities in ERD should correspond to an existing entity/store in DFD 93. A dominant entity is the entity a) on the N side in a 1 : N relationship b) on the 1 side in a 1 : N relationship c) on either side in a 1 : 1 relationship d) nothing to do with 1 : 1 or 1 : N relationship (b) on the 1 side in a 1 : N relationship 94. Select 'NORTH', CUSTOMER From CUST_DTLS Where REGION = 'N' Order By CUSTOMER Union Select 'EAST', CUSTOMER From CUST_DTLS Where REGION = 'E' Order By CUSTOMER The above is a) Not an error b) Error - the string in single quotes 'NORTH' and 'SOUTH' c) Error - the string should be in double quotes d) Error - ORDER BY clause (d) Error - the ORDER BY clause. Since ORDER BY clause cannot be used in UNIONS
95. What is Storage Manager? It is a program module that provides the interface between the low-level data stored in database, application programs and queries submitted to the system.

96. What is Buffer Manager? It is a program module, which is responsible for fetching data from disk storage into main memory and deciding what data to be cache in memory.

97. What is Transaction Manager? It is a program module, which ensures that database, remains in a consistent state despite system failures and concurrent transaction execution proceeds without conflicting.

98. What is File Manager? It is a program module, which manages the allocation of space on disk storage and data structure used to represent information stored on a disk.

99. What is Authorization and Integrity manager? It is the program module, which tests for the satisfaction of integrity constraint and checks the authority of user to access data.

100.

What are stand-alone procedures?

Procedures that are not part of a package are known as stand-alone because they independently defined. A good example of a stand-alone procedure is one written in a SQL*Forms application. These types of procedures are not available for reference from other Oracle tools. Another limitation of standalone procedures is that they are compiled at run time, which slows execution.

101.

What are cursors give different types of cursors.

PL/SQL uses cursors for all database information accesses statements. The language supports the use two types of cursors Implicit Explicit

102.

What is cold backup and hot backup (in case of Oracle)?

Cold Backup: It is copying the three sets of files (database files, redo logs, and control file) when the instance is shut down. This is a straight file copy, usually from the disk directly to tape. You must shut down the instance to guarantee a consistent copy. If a cold backup is performed, the only option available in the event of data file loss is restoring all the files from the latest backup. All work performed on the database since the last backup is lost. Hot Backup: Some sites (such as worldwide airline reservations systems) cannot shut down the database while making a backup copy of the files. The cold backup is not an available option. So different means of backing up database must be used the hot backup. Issue a SQL command to indicate to Oracle, on a tablespace-by-tablespace basis, that the files of the tablespace are to backed up. The users can continue to make full use of the files, including making changes to the data. Once the user has indicated that he/she wants to back up the tablespace files, he/she can use the operating system to copy those files to the desired backup destination. The database must be running in ARCHIVELOG mode for the hot backup option.

If a data loss failure does occur, the lost database files can be restored using the hot backup and the online and offline redo logs created since the backup was done. The database is restored to the most consistent state without any loss of committed transactions.

103.

What are Armstrong rules? How do we say that they are complete and/or sound
The well-known inference rules for FDs

Reflexive rule : If Y is subset or equal to X then X Augmentation rule: If X Transitive rule: If {X Decomposition rule : If X Union or Additive rule: If {X Pseudo Transitive rule : If {X Y, Y Z} then X Y. Z} then X YZ. Z. Z. Y then XZ YZ. Y.

YZ then X Y, X

Y, WY Z} then WX

Of these the first three are known as Amstrong Rules. They are sound because it is enough if a set of FDs satisfy these three. They are called complete because using these three rules we can generate the rest all inference rules.

104.

How can you find the minimal key of relational schema? Minimal key is one which can identify each tuple of the given relation schema uniquely. For finding the minimal key it is required to find the closure that is the set of all attributes that are dependent on any given set of attributes under the given set of functional dependency. Algo. I Determining X+, closure for X, given set of FDs F 1. Set X+ = X 2. Set Old X+ = X+ 3. For each FD Y Z in F and if Y belongs to X+ then add Z to X+ 4. Repeat steps 2 and 3 until Old X+ = X+ Algo.II Determining minimal K for relation schema R, given set of FDs F 1. Set K to R that is make K a set of all attributes in R 2. For each attribute A in K a. Compute (K A)+ with respect to F b. If (K A)+ = R then set K = (K A)+

105.

What do you understand by dependency preservation?

Given a relation R and a set of FDs F, dependency preservation states that the closure of the union of the projection of F on each decomposed relation Ri is equal to the closure of F. i.e., ((R1(F)) U U (Rn(F)))+ = F+ if decomposition is not dependency preserving, then some dependency is lost in the decomposition. 106. What is meant by Proactive, Retroactive and Simultaneous Update. Proactive Update: The updates that are applied to database before it becomes effective in real world . Retroactive Update: The updates that are applied to database after it becomes effective in real world . Simulatneous Update: The updates that are applied to database at the same time when it becomes effective in real world .
What are the different types of JOIN operations? Equi Join: This is the most common type of join which involves only equality comparisions. The disadvantage in this type of join is that there 107.

i2 Technologies Sample Test Paper

<http://www.placementpapers.com/index.html> Q1.Convert 0.9375 to binary a) 0.0111 b) 0.1011 c) 0.1111 d) none Ans. (c) Q2.( 1a00 * 10b )/ 1010 = 100 a) a=0, b=0 b)a=0, b=1 c) none Ans. (b) Q3. In 32 bit memory machine 24 bits for mantissa and 8 bits for exponent. To increase the range of floating point. a) more than 32 bit is to be there. b) increase 1 bit for mantissa and decrease 1 bit for exponent

c) increase 1 bit for exponent and decrease one bit for mantissa Q4.In C, "X ? Y : Z " is equal to a) if (X==0) Y ;else Z b) if (X!=0) Y ;else Z c) if (X==0) Y ; Z Ans. (b) Q5. From the following program foo() int foo(int a, int b) { if (a&b) return 1; return 0; } a) if either a or b are zero returns always 0 b) if both a & b are non zero returns always 1 c) if both a and b are negative returns 0 Q6. The following function gives some error. What changes have to be made void ( int a,int b) { int t; t=a; a=b; b=t; } a) define void as int and write return t b) change everywhere a to *a and b to *b Q7. Which of the following is incorrect a) if a and b are defined as int arrays then (a==b) can never be true b) parameters are passed to functions only by values c) defining functions in nested loops Q8. include<stdio.h> void swap(int*,int*); main() { int arr[8]={36,8,97,0,161,164,3,9} for (int i=0; i<7; i++) { for (int j=i+1; j<8;j++) if(arr[i]<arr[j]) swap(&arr[i],&arr[j]); } } void swap(int*x,int*y) { int temp; static int cnt=0; temp= *x; *x=*y;

*y=temp; cnt++; } What is cnt equal to a) 7 b) 15 c) 1 d) none of these Q9. int main() { FILE *fp; fp=fopen("test.dat","w"); fprintf(fp,'hello\n"); fclose(fp); fp=fopen ("test.dat","w"); fprintf (fp, "world"); fclose(fp); return 0; } If text.dat file is already present after compiling and execution how many bytes does the file occupy ? a) 0 bytes b) 5 bytes c) 11 bytes d) data is insufficient Q10. f1(int*x,intflag) int *y; *y=*x+3; switch(flag) { case 0: *x=*y+1; break; case 1: *x=*y; break; case 2: *x=*y-1; break; } return(*y) main()

{ *x=5; i=f1(x,0); j=f1(x,1); printf("%d %d %d ",i,j,*x); } What is the output? a) 8 8 8 b) 5 8 8 c) 8 5 8 d) none of these Q12. A function is like this swap( int a,int b) { int temp; temp=a; a=b; b=temp; } What will happen if we put *a and *b inplace of a & b ? Q13.To increase The Range of a Floating point Member what should be done? Ans. Mantissa should be decreased and exponential should be increased Miscellaneous Notes Other Problems in C included usage of Select Case, Bit-Wise Operators, Call By Reference/By Value, Pointers, Files etc. Also questions on DBMS (SQL queries), Logic Gates & Design can be asked

Part Two
One Big Question ( 20 Marks , 20 MIN.) Q. Write a program in C++ (or in C) for the following Data. A school Trust That manages many schools in a city has decided to merge two of its branches by moving all the students of different standards and divisions from both the branches to their newly acquired complex. How ever, when moving it is ensured that every student's standard and division remains same. Thus a student of 7F (standard 7,division F) from one of the branches will continue to be in 7F in the new school complex. Given that the student strength of both the branches in the form of a list of division and strength pairs terminated by a $ sign as shown in the example as follows..... 1A 30 1B 28 2A 35 2B 38 2C 36 2D 34 3A 32 3B 34 .... $

1A 25 1B 24 1C 26 1D 25 1E 22 2A 40 2B 42 3A 35 .... $ Write a program to read the above data and output the student strength of the new larger school in the same format. Your Program 1) Must not assume any limit on the no. of divisions or classes in schools. 2) Must not output divisions with 0 strength. 3) Must use dynamic structures. Back to top <http://www.placementpapers.com/I2/I21.htm>

IBM Global
Sample Paper Interview Profile of the company

Written Test
The written test consists of two sections each of 45 minutes duration. Section#1 This is the aptitude section consisting of 45 questions to be attempted in 45 minutes.As is in all the exams,this section is based on the MBA pattern of examination. Section#2 This is the technical section.There is a seperate paper for hardware and software.Candidates have to mention beforehand whether they want to write the software or the hardware paper. This section also carries 45 questions to be completed in 45 minutes. We are providing you with some of the questions asked in the exam, so that you have an idea of what to expect in the written test.

Interview There are two rounds of interviews,viz.,the technical and and the HR round. Technical and Personal Round for Software Candidates Mainly subjective questions in C,Operating Systems,DBMS,Data Structures are asked interspersed with some on the candidate's personal background. Typical questions in C and Data Structures 1.WAP to interchange 2 variables without using the third one. 2.Explain quick sort and merge sort algorithms amn derive the time-constraint relation for these. 3.Explain binary searching,fibonacci search. 4.General questions on binary trees,transversals

5.General questions on graphs and their representation.

Typical Questions on Operating Systems 1.Demand paging,page faults,replacement algos,thrashing,etc. 2.Paged segmentation and segment paging. HR Round for Software Candidates In this section, case studies are presented are presented before the candidate to percieve his reaction and his/her communication skills are tested. IBM expects teamwork and teamspirit from the candidates and their answers should reflect this attitude. Typical question is: You are a project manager of a big multinational project.There is a person X, assigned to you who has the best technical skills required for the project,even better than you.But he wishes to be the project manager ,which the management does not permit,due to which he threatens to quit.All others in the group are not as competent.Talk yourself out of this situation pretending that the interviewer is the disgruntled employee and explain the neceessary action. For the technical section questions the engg. textbooks would suffice.For a detailed list of authors and other improtant tips check our interview section. <../Intsec.htm>

Profile
IBM strives to lead in the creation, development and manufacture of the industry's most advanced information technologies, including computer systems, software, networking systems, storage devices and microelectronics.IBM brings its products and services through IBM India and IBM Global Services. IBM India's product portfolio includes the IBM PC, Aptiva home computer , ThinkPad portables, RS/6000, AS/400e, S/390 and Netfinity servers, network computers, printers, networking and storage products. IBM's software offerings include DB2, Lotus, Tivoli, MQ Series and a range of Internet software like WebSphere and SecureWay. India is also home to two select IBM centers - the IBM Solutions Research Center at New Delhi and the Solutions Partnership Center (SPC) at Bangalore. The SRC (only the eighth of its kind across the globe) is an extended arm of IBM Research activities. As part of IBM's global research infrastructure, the SRC participates in path breaking research projects for IBM worldwide. The Solutions Partnership Center at Bangalore is a part of IBM's developer relations focus for India. The SPC is a showcase of IBM technology and a testing and porting lab for application software developers.

The current pay package is around Rs. 20,000. IBM is on spree of increasing its male/female ratio in its workforce hence female candidates are being given a slight advantage over their male counterparts.

For more information about this company visit their homesite at www.ibm.com <http://www.ibm.com/>

IBM Global Sample Test Paper

1. In 1978, a kg of paper was sold at Rs25/-. If the paper rate increases at 1.5% more than the inflation rate which is 6.5% a year, then what wil be the cost of a kg of paper after 2 years? (a) 29.12 (b) 29.72 (c) 30.12 (d) 32.65 (e) none of these 2. In A,B,C are having some marbles with each of them. A has given B and C the same number of marbles each of them already have. Then, B gave C and A the same number of marbles they already have. Then C gave A and B the same number of marbles they already have. At the end A,B,and C have equal number of marbles. (i) If x,y,z are the marbles initially with A,B,C respectively. Then the number of marbles B have at the end (a) 2(x-y-z) (b) 4(x-y-z) (c) 2(3y-x-z) (d) x + y-z Ans. (c) (ii) If the total number of marbles are 72, then the number of marbles with A at the starting (a) 20 (b) 30 (c) 32 (d) 39 Ans. (d) 3. If a car starts from A towards B with some velocity. Due to some problem in the engine after travelling 30km, the car goes with 4/5 th of its actual velocity The car reaches B 45 min later to the actual time. If the car engine fails ofter travelling 45km, the car reaches the destination B 36min late to the actual time What is the initial velocity of car and what is the distance between A and B in km Ans. 20 & 130. 4. A person has Rs 100/- in his pocket, he can as 25 pencils or 15 books.

He kept 15% of the money for travelling expenses and purchased 5 pencils. So how many books he can purchase with the remaining money. 5. Ten questions on analogies. eg: chief : tribe :: governer : state epaulette : shoulder :: tiara : head guttural : throat :: gastric : stomach inept : clever :: languid : active knife : butcher :: hammer : carpenter :: 6. The values of shares (in Rs).of A, B and C from January to June are as follows. Month January February March April May June A 30 35 45 40 55 50 B 60 65 75 75 75 75 C 80 85 65 82 85 80

i) During this period which share has undergone maximium fluctuation? ii) In which month it is possible to buy B and C selling A? iii) In which month the share values are very low? iv) By purchasing one share of A and 4 each of B and C in the beginning of the period, when shoudl these be sold to get maximum profit? 7. In a computer institute 9 languages can be taught. The module is of 6 months duration and of the six languages only one can be taught each month . In addition to that BASIC is always taught and should be in first month itself WORD PERFECT is to be taught in the preceeding week of WORD STAR. FORTRAN can not be taught until COBAL is taught prior to that BINO, FIFO can never be taught in single module

languages are BASIC, WORD STAR, WORD PERFECT, FORTRAN, COBAL, BINO, FIFO, LOTUS, C i) If word star is in 3rd month , what could be in 6th month. ii) If COBAL is in the 2nd month and BINO in 6th month. FORTRAN will be taught in which month. 8. In a class, except 18 all are above 50 years. 15 are below 50 years of age. How many people are there (a) 30 (b) 33 (c) 36

(d) none of these. Ans. (d) 9. A square plate of some size is cut at four corners. Equal squares of the same size are cut and is formed as open box. If this open box carries 128 ml of oil. What is the size of the side of the plate? (a) 17 (b) 14 (c) 13 (d) None of these 10. In a square, all the mid points are joined. The inner square is shaded. If the area of the square is A, what is the area of the shaded area? 11. Two questions on basic angles i.e given a circle, a few chords or diameter is drawn etc. 12. If the follwoing statements are given @(a,b)= (a+b)/2 /(a,b)= a/b *(a,b)= ab

If a=1, b=2 then find i) /(a,(@(a,b),*(a,b))) ii) */(a,@(*(a,b))) 13. If the follwoing statements are given (x#y) = x + y- xy (x*y) = (x + y)/2

i) Find the values of x, y will satisfy this equation (x#y)#(x*y) < (x#y) ii) Find the values of x, y will satisfy this equation (a*b)#(b*c)< (a#b)*(b*c) 14. Export PS1 results in(PS1 pwd) a) primary prompt being your current directory b) primary prompt and secondary prompts being the current directory c) primary prompt prompt being your home directory d) primary prompt and secondary prompts being the home directory e) None of the above. 15. If you type in the command nohup sort employees > list 2 > error out & and log off ,the next time you log in, the output will be

a) in a file called list and the error will de typed in a file error out b) there will be no file called list or error out c) error will be logged in a file called list and o/p will be in error out d) you will not be allowed to log in e) none of the above 16. In UNIX a files i-node ......? Ans. Is a data structure that defines all specifications of a file like the file size, number of lines to a file, permissions etc. 17. The UNIX shell .... a) does not come with the rest of the system b) forms the interface between the user and the kernal c) does not give any scope for programming d) deos not allow calling one program from with in another e) all of the above Ans. (b) 18. enum number { a=-1, b= 4,c,d,e} What is the value of e ? (a) 7 (b) 4 (c) 5 (d) 15 (e) 3 19. The very first process created by the kernal that runs till the kernal process is halts is a) init b) getty c) both (a) and (b) d) none of these Ans. (a) 20. Output of the following program is main() {int i=0; for(i=0;i<20;i++) {switch(i) case 0:i+=5; case 1:i+=2; case 5:i+=5; default i+=4; break;}

printf("%d,",i); } } a) 0,5,9,13,17 b) 5,9,13,17 c) 12,17,22 d) 16,21 e) Syntax error Ans. (d) 21. What is the ouptut in the following program main() {char c=-64; int i=-32 unsigned int u =-16; if(c>i) {printf("pass1,"); if(c<u) printf("pass2"); else printf("Fail2"); } else printf("Fail1); if(i<u) printf("pass2"); else printf("Fail2") } a) Pass1,Pass2 b) Pass1,Fail2 c) Fail1,Pass2 d) Fail1,Fail2 e) None of these Ans. (c) 22. In the process table entry for the kernel process, the process id value is (a) 0 (b) 1 (c) 2 (d) 255 (e) it does not have a process table entry Ans. (a)

23. Which of the following API is used to hide a window a) ShowWindow b) EnableWindow c) MoveWindow d) SetWindowPlacement e) None of the above Ans. (a) 24. What will the following program do? void main() { int i; char a[]="String"; char *p="New Sring"; char *Temp; Temp=a; a=malloc(strlen(p) + 1); strcpy(a,p); //Line number:9// p = malloc(strlen(Temp) + 1); strcpy(p,Temp); printf("(%s, %s)",a,p); free(p); free(a); } //Line number 15// a) Swap contents of p & a and print:(New string, string) b) Generate compilation error in line number 8 c) Generate compilation error in line number 5 d) Generate compilation error in line number 7 e) Generate compilation error in line number 1 Ans. (b) 25. In the following code segment what will be the result of the function, value of x , value of y {unsigned int x=-1; int y; y = ~0; if(x == y) printf("same"); else printf("not same"); } a) same, MAXINT, -1

b) not same, MAXINT, -MAXINT c) same , MAXUNIT, -1 d) same, MAXUNIT, MAXUNIT e) not same, MAXINT, MAXUNIT Ans. (a) 26. PATH = /bin : /usr : /yourhome The file /bin/calender has the following line in it cal 10 1997 The file /yourhome/calender has the following line in it cal 5 1997 If the current directory is /yourhome and calender is executed a) The calendar for May 1997 will be printed on screen b) The calendar for Oct 1997 will be printed on screen c) The calendar for the current month( whatever it is) will be printed d) Nothing will get printed on screen e) An error massage will be printed 27. What will be the result of the following program ? char *gxxx() {static char xxx[1024]; return xxx; } main() {char *g="string"; strcpy(gxxx(),g); g = gxxx(); strcpy(g,"oldstring"); printf("The string is : %s",gxxx()); } a) The string is : string b) The string is :Oldstring c) Run time error/Core dump d) Syntax error during compilation e) None of these Ans. (b) 28. What will be result of the following program? void myalloc(char *x, int n) {x= (char *)malloc(n*sizeof(char)); memset(x,\0,n*sizeof(char));

} main() {char *g="String"; myalloc(g,20); strcpy(g,"Oldstring"); printf("The string is %s",g); } a) The string is : String b) Run time error/Core dump c) The string is : Oldstring d) Syntax error during compilation e) None of these 29. Which of the following function is used to repaint a window immediately a) Sendmessage(hWnd,WM_PAINt,......) b) InvalidateRect(.......) c) MoveWindow d) WM_COPY e) None 30. Which function is the entry point for a DLL in MS Windows 3.1 a) Main b) Winmain c) Dllmain d) Libmain e) None Ans. (b) 31. The standard source for standard input, standard output and standard error is a) the terminal b) /dev/null c) /usr/you/input, /usr/you/output/, /usr/you/error respectively d) None Ans. (a) 32. What will be the result of the following program? main() {char p[]="String"; int x=0; if(p=="String") {printf("Pass 1"); if(p[sizeof(p)-2]=='g')

printf("Pass 2"); else printf("Fail 2"); } else { printf("Fail 1"); if(p[sizeof(p)-2]=='g') printf("Pass 2"); else printf("Fail 2"); } } a) Pass 1, Pass 2 b) Fail 1, Fail 2 c) Pass 1, Fail 2 d) Fail 1, Pass 2 e) syntax error during compilation 33. Which of the choices is true for the mentioned declaration ? const char *p; and char * const p; a) You can't change the character in both b) First : You can't change the characterr & Second : You can;t change the pointer c) You can't change the pointer in both d) First : You can't change the pointer & Second : You can't chanage the character e) None 34. The redirection operators > and >> a) do the same function b) differ : > overwrites, while >> appends c) differ : > is used for input while >> is used for output d) differ : > write to any file while >> write only to standard output e) None of these Ans. (b) 35. The command grep first second third /usr/you/myfile a) prints lines containing the words first, second or third from the file /usr/you/myfile b) searches for lines containing the pattern first in the files second, third, and /usr/you/myfile and prints them c) searches the files /usr/you/myfiel and third for lines containing the words first or second and prints them

d) replaces the word first with the word second in the files third and /usr/you/myfile e) None of the above Ans. (b) --End-IBM__________________________________________________________________________ _________

COMPANY NAME : IBM -----------------------------------------------------------DATE OF TEST : -----------------------------------------------------------PLACE OF TEST: -----------------------------------------------------------MODE :

-----------------------------------------------------------DURATION :

______________________________________________________________________________ _____

1. In 1978, a kg of paper was sold at Rs25/-. If the paper rate increases at 1.5% more than the inflation rate which is 6.5% a year, then what wil be the cost of a kg of paper after 2 years? (a) (b) (c) (d) (e) none of these 2. In A,B,C are having some marbles with each of them. A has given B and C the same number of marbles each of them already have. Then, B gave C and A the same number of marbles they already have. Then C gave A and B the same number of marbles they already have. At the end A,B,and C have equal number of marbles. (i) If x,y,z are the marbles initially with A,B,C respectively. Then the number of marbles B have at the end (a) 2(x-y-z) (b) 4(x-y-z) (c) 2(3y-x-z) (d) x + y-z Ans. (c) (ii) If the total number of marbles are 72, then the number of marbles with A at the starting IBM : Global Sample Paper (a) 20 (b) 30 (c) 32 (d) 39 Ans. (d) 29.12 29.72 30.12 32.65

3. If a car starts from A towards B with some velocity. Due to some problem in the engine after travelling 30km, the car goes with 4/5 th of its actual velocity The car reaches B 45 min later to the actual time. If the car engine fails ofter travelling 45km, the car reaches the destination B 36min late to the actual time What is the initial velocity of car and what is the distance between A and B in km Ans. 20 & 130.

4. A person has Rs 100/- in his pocket, he can as 25 pencils or 15 books.

Month January February March April May June

A B C 30 60 80 35 65 85 45 75 65 40 75 82 55 75 85 50 75 80

i) During this period which share has undergone maximium fluctuation? ii) In which month it is possible to buy B and C selling A? iii) In which month the share values are very low? iv) By purchasing one share of A and 4 each of B and C in the beginning of the period, when shoudl these be sold to get maximum profit?

7. In a computer institute 9 languages can be taught. The module is of 6 months duration and of the six languages only one can be taught each month . In addition to that BASIC is always taught and should be in first month itself * WORD PERFECT is to be taught in the preceeding week of WORD STAR. * FORTRAN can not be taught until COBAL is taught prior to that * BINO, FIFO can never be taught in single module languages are BASIC, WORD STAR, WORD PERFECT, FORTRAN, COBAL, BINO, FIFO, LOTUS, C i) If word star is in 3rd month , what could be in 6th month. ii) If COBAL is in the 2nd month and BINO in 6th month. FORTRAN will be taught in which month.

8. In a class, except 18 all are above 50 years. 15 are below 50 years of age. How many people are there (a) 30 (b) 33 (c) 36 (d) none of these. Ans. (d)

9. A square plate of some size is cut at four corners. Equal squares of the same size are cut and is formed as open box. If this open box carries 128 ml of oil. What is the size of the side of the plate? (a) 17 (b) 14 (c) 13 (d) None of these

10. In a square, all the mid points are joined. The inner square is shaded. If the area of the square is A, what is the area of the shaded area? 11. Two questions on basic angles i.e given a circle, a few chords or diameter is

______________________________________________________________________________ _____

You have downloaded this Paper from "CHETANA-JOBS" Yahoo Group -------------------------------------------------------------------To directly subscribe through e-mail, just send a blank mail to : CHETANA-JOBS-subscribe@yahoogroups.com -------------------------------------------------------------------To unsubscribe from this group, send a blank email to: CHETANA-JOBS-unsubscribe@yahoogroups.com -------------------------------------------------------------------To learn more about the CHETANA-JOBS group, please visit: http://groups.yahoo.com/group/CHETANA-JOBS

1.The Java interpreter is used for the execution of the source code. True False Ans: a. 2) On successful compilation a file with the class extension is created. a) True b) False Ans: a. 3) The Java source code can be created in a Notepad editor.

a) True b) False Ans: a. 4) The Java Program is enclosed in a class definition. a) True b) False Ans: a. 5) What declarations are required for every Java application? Ans: A class and the main( ) method declarations. 6) What are the two parts in executing a Java program and their purposes? Ans: Two parts in executing a Java program are: Java Compiler and Java Interpreter. The Java Compiler is used for compilation and the Java Interpreter is used for execution of the application. 7) What are the three OOPs principles and define them? Ans : Encapsulation, Inheritance and Polymorphism are the three OOPs Principles. Encapsulation: Is the Mechanism that binds together code and the data it manipulates, and keeps both safe from outside interference and misuse. Inheritance: Is the process by which one object acquires the properties of another object. Polymorphism: Is a feature that allows one interface to be used for a general class of actions.

8) What is a compilation unit? Ans : Java source code file. 9) What output is displayed as the result of executing the following statement? System.out.println("// Looks like a comment."); // Looks like a comment The statement results in a compilation error Looks like a comment No output is displayed Ans : a. 10) In order for a source code file, containing the public class Test, to successfully compile, which of the following must be true? It must have a package statement It must be named Test.java It must import java.lang It must declare a public class named Test Ans : b 11) What are identifiers and what is naming convention? Ans : Identifiers are used for class names, method names and variable names. An identifier may be any descriptive sequence of upper case & lower case letters,numbers or underscore or dollar sign and must not begin with numbers. 12) What is the return type of programs main( ) method? Ans : void 13) What is the argument type of programs main( ) method? Ans : string array. 14) Which characters are as first characters of an identifier? Ans : A Z, a z, _ ,$

15) What are different comments? Ans : 1) // -- single line comment 2) /* -*/ multiple line comment 3) /** -*/ documentation 16) What is the difference between constructor method and method? Ans : Constructor will be automatically invoked when an object is created. Whereas method has to be call explicitly. 17) What is the use of bin and lib in JDK? Ans : Bin contains all tools such as javac, applet viewer, awt tool etc., whereas Lib contains all packages and variables.

Data types,variables and Arrays 1) What is meant by variable? Ans: Variables are locations in memory that can hold values. Before assigning any value to a variable, it must be declared. 2) What are the kinds of variables in Java? What are their uses? Ans: Java has three kinds of variables namely, the instance variable, the local variable and the class variable. Local variables are used inside blocks as counters or in methods as temporary variables and are used to store information needed by a single method. Instance variables are used to define attributes or the state of a particular object and are used to store information needed by multiple methods in the objects. Class variables are global to a class and to all the instances of the class and are useful for communicating between different objects of all the same class or keeping track of global states.

3) How are the variables declared? Ans: Variables can be declared anywhere in the method definition and can be initialized during their declaration.They are commonly declared before usage at the beginning of the definition. Variables with the same data type can be declared together. Local variables must be given a value before usage. 4) What are variable types? Ans: Variable types can be any data type that java supports, which includes the eight primitive data types, the name of a class or interface and an array. 5) How do you assign values to variables? Ans: Values are assigned to variables using the assignment operator =. 6) What is a literal? How many types of literals are there? Ans: A literal represents a value of a certain type where the type describes how that value behaves. There are different types of literals namely number literals, character literals, boolean literals, string literals,etc. 7) What is an array? Ans: An array is an object that stores a list of items. 8) How do you declare an array? Ans: Array variable indicates the type of object that the array holds. Ex: int arr[]; 9) Java supports multidimensional arrays. a)True b)False Ans: a. 10) An array of arrays can be created. a)True b)False

Ans: a. 11) What is a string? Ans: A combination of characters is called as string. 12) Strings are instances of the class String. a)True b)False Ans: a. 13) When a string literal is used in the program, Java automatically creates instances of the string class. a)True b)False Ans: a. 14) Which operator is to create and concatenate string? Ans: Addition operator(+). 15) Which of the following declare an array of string objects? String[ ] s; String [ ]s: String[ s]: String s[ ]: Ans : a, b and d 16) What is the value of a[3] as the result of the following array declaration? 1 2 3 4

Ans : d 17) Which of the following are primitive types? byte String integer Float Ans : a. 18) What is the range of the char type? 0 to 216 0 to 215 0 to 216-1 0 to 215-1 Ans. d 19) What are primitive data types? Ans : byte, short, int, long float, double boolean char 20) What are default values of different primitive types? Ans : int - 0 short - 0 byte - 0 long - 0 l float - 0.0 f double - 0.0 d

boolean - false char - null 21) Converting of primitive types to objects can be explicitly. a)True b)False Ans: b. 22) How do we change the values of the elements of the array? Ans : The array subscript expression can be used to change the values of the elements of the array. 23) What is final varaible? Ans : If a variable is declared as final variable, then you can not change its value. It becomes constant. 24) What is static variable? Ans : Static variables are shared by all instances of a class.

Operators 1) What are operators and what are the various types of operators available in Java? Ans: Operators are special symbols used in expressions. The following are the types of operators: Arithmetic operators, Assignment operators, Increment & Decrement operators, Logical operators, Biwise operators,

Comparison/Relational operators and Conditional operators 2) The ++ operator is used for incrementing and the -- operator is used for decrementing. a)True b)False Ans: a. 3) Comparison/Logical operators are used for testing and magnitude. a)True b)False Ans: a. 4) Character literals are stored as unicode characters. a)True b)False Ans: a. 5) What are the Logical operators? Ans: OR(|), AND(&), XOR(^) AND NOT(~). 6) What is the % operator? Ans : % operator is the modulo operator or reminder operator. It returns the reminder of dividing the first operand by second operand. 7) What is the value of 111 % 13? 3 5 7 9

Ans : c. 8) Is &&= a valid operator? Ans : No. 9) Can a double value be cast to a byte? Ans : Yes 10) Can a byte object be cast to a double value ? Ans : No. An object cannot be cast to a primitive value. 11) What are order of precedence and associativity? Ans : Order of precedence the order in which operators are evaluated in expressions. Associativity determines whether an expression is evaluated left-right or right-left. 12) Which Java operator is right associativity? Ans : = operator. 13) What is the difference between prefix and postfix of -- and ++ operators? Ans : The prefix form returns the increment or decrement operation and returns the value of the increment or decrement operation. The postfix form returns the current value of all of the expression and then performs the increment or decrement operation on that value. 14) What is the result of expression 5.45 + "3,2"? The double value 8.6 The string ""8.6" The long value 8. The String "5.453.2" Ans : d 15) What are the values of x and y ? x = 5; y = ++x;

Ans : x = 6; y = 6 16) What are the values of x and z? x = 5; z = x++; Ans : x = 6; z = 5

Control Statements 1) What are the programming constructs? Ans: a) Sequential b) Selection -- if and switch statements c) Iteration -- for loop, while loop and do-while loop 2) class conditional { public static void main(String args[]) { int i = 20; int j = 55; int z = 0; z = i < j ? i : j; // ternary operator System.out.println("The value assigned is " + z); } } What is output of the above program?

Ans: The value assigned is 20 3) The switch statement does not require a break. a)True b)False Ans: b. 4) The conditional operator is otherwise known as the ternary operator. a)True b)False Ans: a. 5) The while loop repeats a set of code while the condition is false. a)True b)False Ans: b. 6) The do-while loop repeats a set of code atleast once before the condition is tested. a)True b)False Ans: a. 7) What are difference between break and continue? Ans: The break keyword halts the execution of the current loop and forces control out of the loop. The continue is similar to break, except that instead of halting the execution of the loop, it starts the next iteration.

8) The for loop repeats a set of statements a certain number of times until a condition is matched. a)True

b)False Ans: a. 9) Can a for statement loop indefintely? Ans : Yes. 10) What is the difference between while statement and a do statement/ Ans : A while statement checks at the beginning of a loop to see whether the next loop iteration should occur. A do statement checks at the end of a loop to see whether the next iteration of a loop should occur. The do statement will always execute the body of a loop at least once.

Introduction to Classes and Methods 1) Which is used to get the value of the instance variables? Ans: Dot notation. 2) The new operator creates a single instance named class and returns a reference to that object. a)True b)False Ans: a. 3) A class is a template for multiple objects with similar features. a)True b)False Ans: a. 4) What is mean by garbage collection? Ans: When an object is no longer referred to by any variable, Java automatically reclaims memory used by that object. This is known as garbage collection.

5) What are methods and how are they defined? Ans: Methods are functions that operate on instances of classes in which they are defined.Objects can communicate with each other using methods and can call methods in other classes. Method definition has four parts. They are name of the method, type of object or primitive type the method returns, a list of parameters and the body of the method. A method's signature is a combination of the first three parts mentioned above. 6) What is calling method? Ans: Calling methods are similar to calling or referring to an instance variable. These methods are accessed using dot notation. Ex: obj.methodname(param1,param2) 7) Which method is used to determine the class of an object? Ans: getClass( ) method can be used to find out what class the belongs to. This class is defined in the object class and is available to all objects. 8) All the classes in java.lang package are automatically imported when a program is compiled. a)True b)False Ans: a. 9) How can class be imported to a program? Ans: To import a class, the import keyword should be used as shown.; import classname; 10) How can class be imported from a package to a program? Ans: import java . packagename . classname (or) import java.package name.*; 11) What is a constructor? Ans: A constructor is a special kind of method that determines how an object is initialized when created.

12) Which keyword is used to create an instance of a class? Ans: new. 13) Which method is used to garbage collect an object? Ans: finalize (). 14) Constructors can be overloaded like regular methods. a)True b)False Ans: a. 15) What is casting? Ans: Casting is bused to convert the value of one type to another.

16) Casting between primitive types allows conversion of one primitive type to another. a)True b)False Ans: a. 17) Casting occurs commonly between numeric types. a)True b)False Ans: a. 18) Boolean values can be cast into any other primitive type. a)True b)False Ans: b.

19) Casting does not affect the original object or value. a)True b)False Ans: a. 20) Which cast must be used to convert a larger value into a smaller one? Ans: Explicit cast. 21) Which cast must be used to cast an object to another class? Ans: Specific cast. 22) Which of the following features are common to both Java & C++? A.The class declaration b.The access modifiers c.The encapsulation of data & methods with in objects d.The use of pointers Ans: a,b,c. 23) Which of the following statements accurately describe the use of access modifiers within a class definition? a.They can be applied to both data & methods b.They must precede a class's data variables or methods c.They can follow a class's data variables or methods d.They can appear in any order e.They must be applied to data variables first and then to methods Ans: a,b,d. 24) Suppose a given instance variable has been declared private. Can this instance variable be manipulated by methods out side its class? a.yes

b.no Ans: b. 25) Which of the following statements can be used to describe a public method? a.It is accessible to all other classes in the hierarchy b.It is accessablde only to subclasses of its parent class c.It represents the public interface of its class d.The only way to gain access to this method is by calling one of the public class methods Ans: a,c. 26) Which of the following types of class members can be part of the internal part of a class? a.Public instance variables b.Private instance variables c.Public methods d.Private methods Ans: b,d. 27) You would use the ____ operator to create a single instance of a named class. a.new b.dot Ans: a. 28) Which of the following statements correctly describes the relation between an object and the instance variable it stores? a.Each new object has its own distinctive set of instance variables b.Each object has a copy of the instance variables of its class c.the instance variable of each object are seperate from the variables of other objects d.The instance variables of each object are stored together with the variables of other objects

Ans: a,b,c. 29) If no input parameters are specified in a method declaration then the declaration will include __. a.an empty set of parantheses b.the term void Ans: a. 30) What are the functions of the dot(.) operator? a.It enables you to access instance variables of any objects within a class b.It enables you to store values in instance variables of an object c.It is used to call object methods d.It is to create a new object Ans: a,b,c. 31) Which of the following can be referenced by this variable? a.The instance variables of a class only b.The methods of a class only c.The instance variables and methods of a class Ans: c. 32) The this reference is used in conjunction with ___methods. a.static b.non-static Ans: b. 33) Which of the following operators are used in conjunction with the this and super references? a.The new operator b.The instanceof operator c.The dot operator

Ans: c. 34) A constructor is automatically called when an object is instantiated a. true b. false Ans: a. 35) When may a constructor be called without specifying arguments? a. When the default constructor is not called b. When the name of the constructor differs from that of the class c. When there are no constructors for the class Ans: c. 36) Each class in java can have a finalizer method a. true b.false Ans: a. 37) When an object is referenced, does this mean that it has been identified by the finalizer method for garbage collection? a.yes b.no Ans: b. 38) Because finalize () belongs to the java.lang.Object class, it is present in all ___. a.objects b.classes c.methods Ans: b. 39) Identify the true statements about finalization.

a.A class may have only one finalize method b.Finalizers are mostly used with simple classes c.Finalizer overloading is not allowed Ans: a,c. 40) When you write finalize() method for your class, you are overriding a finalizer inherited from a super class. a.true b.false Ans: a. 41) Java memory management mechanism garbage collects objects which are no longer referenced a true b.false Ans: a. 42) are objects referenced by a variable candidates for garbage collection when the variable goes out of scope? a yes b. no Ans: a. 43) Java's garbage collector runs as a ___ priority thread waiting for __priority threads to relinquish the processor. a.high b.low Ans: a,b. 44) The garbage collector will run immediately when the system is out of memory a.true

b.false Ans: a. 45) You can explicitly drop a object reference by setting the value of a variable whose data type is a reference type to ___ Ans: null 46) When might your program wish to run the garbage collecter? a. before it enters a compute-intense section of code b. before it enters a memory-intense section of code c. before objects are finalized d. when it knows there will be some idle time Ans: a,b,d 47) For externalizable objects the class is solely responsible for the external format of its contents a.true b.false Ans: a 48) When an object is stored, are all of the objects that are reachable from that object stored as well? a.true b.false Ans: a 49) The default__ of objects protects private and trancient data, and supports the __ of the classes a.evolution b.encoding Ans: b,a. 50) Which are keywords in Java?

a) NULL b) sizeof c) friend d) extends e) synchronized Ans : d and e 51) When must the main class and the file name coincide? Ans :When class is declared public. 52) What are different modifiers? Ans : public, private, protected, default, static, trancient, volatile, final, abstract. 53) What are access modifiers? Ans : public, private, protected, default. 54) What is meant by "Passing by value" and " Passing by reference"? Ans : objects pass by referrence Methods - pass by value 55) Is a class a subclass of itself? Ans : A class is a subclass itself.

56) What modifiers may be used with top-level class? Ans : public, abstract, final. 57) What is an example of polymorphism? Inner class Anonymous classes Method overloading Method overriding

Ans : c

Packages and interface 1) What are packages ? what is use of packages ? Ans :The package statement defines a name space in which classes are stored.If you omit the package, the classes are put into the default package. Signature... package pkg; Use: * It specifies to which package the classes defined in a file belongs to. * Package is both naming and a visibility control mechanism. 2) What is difference between importing "java.applet.Applet" and "java.applet.*;" ? Ans :"java.applet.Applet" will import only the class Applet from the package java.applet Where as "java.applet.*" will import all the classes from java.applet package. 3) What do you understand by package access specifier? Ans : public: Anything declared as public can be accessed from anywhere private: Anything declared in the private cant be seen outside of its class. default: It is visible to subclasses as well as to other classes in the same package. 4) What is interface? What is use of interface? Ans : It is similar to class which may contain methods signature only but not bodies. Methods declared in interface are abstract methods. We can implement many interfaces on a class which support the multiple inheritance. 5) Is it is necessary to implement all methods in an interface? Ans : Yes. All the methods have to be implemented. 6) Which is the default access modifier for an interface method? Ans : public. 7) Can we define a variable in an interface ?and what type it should be ?

Ans : Yes we can define a variable in an interface. They are implicitly final and static. 8) What is difference between interface and an abstract class? Ans : All the methods declared inside an Interface are abstract. Where as abstract class must have at least one abstract method and others may be concrete or abstract. In Interface we need not use the keyword abstract for the methods. 9) By default, all program import the java.lang package. True/False Ans : True 10) Java compiler stores the .class files in the path specified in CLASSPATH environmental variable. True/False Ans : False

11) User-defined package can also be imported just like the standard packages. True/False Ans : True 12) When a program does not want to handle exception, the ______class is used. Ans : Throws 13) The main subclass of the Exception class is _______ class. Ans : RuntimeException 14) Only subclasses of ______class may be caught or thrown. Ans : Throwable 15) Any user-defined exception class is a subclass of the _____ class. Ans : Exception 16) The catch clause of the user-defined exception class should ______ its

Base class catch clause. Ans : Exception 17) A _______ is used to separate the hierarchy of the class while declaring an Import statement. Ans : Package

18) All standard classes of Java are included within a package called _____. Ans : java.lang 19) All the classes in a package can be simultaneously imported using ____. Ans : * 20) Can you define a variable inside an Interface. If no, why? If yes, how? Ans.: YES. final and static 21) How many concrete classes can you have inside an interface? Ans.: None 22) Can you extend an interface? Ans.: Yes 23) Is it necessary to implement all the methods of an interface while implementing the interface? Ans.: No 24) If you do not implement all the methods of an interface while implementing , what specifier should you use for the class ? Ans.: abstract 25) How do you achieve multiple inheritance in Java? Ans: Using interfaces. 26) How to declare an interface example? Ans : access class classname implements interface.

27) Can you achieve multiple interface through interface? a)True b) false Ans : a. 28) Can variables be declared in an interface ? If so, what are the modifiers? Ans : Yes. final and static are the modifiers can be declared in an interface. 29) What are the possible access modifiers when implementing interface methods? Ans : public. 30) Can anonymous classes be implemented an interface? Ans : Yes. 31) Interfaces cant be extended. a)True b)False Ans : b. 32) Name interfaces without a method? Ans : Serializable, Cloneble & Remote. 33) Is it possible to use few methods of an interface in a class ? If so, how? Ans : Yes. Declare the class as abstract.

Exception Handling 1) What is the difference between throw and throws ?And its application? Ans : Exceptions that are thrown by java runtime systems can be handled by Try and catch blocks. With throw exception we can handle the exceptions thrown by the program itself. If a method is capable of causing an exception that it does not

handle, it must specify this behavior so the callers of the method can guard against that exception. 2) What is the difference between Exception and error in java? Ans : Exception and Error are the subclasses of the Throwable class. Exception class is used for exceptional conditions that user program should catch. With exception class we can subclass to create our own custom exception. Error defines exceptions that are not excepted to be caught by you program. Example is Stack Overflow. 3) What is Resource leak? Ans : Freeing up other resources that might have been allocated at the beginning of a method. 4)What is the finally block? Ans : Finally block will execute whether or not an exception is thrown. If an exception is thrown, the finally block will execute even if no catch statement match the exception. Any time a method is about to return to the caller from inside try/catch block, via an uncaught exception or an explicit return statement, the finally clause is also execute. 5) Can we have catch block with out try block? If so when? Ans : No. Try/Catch or Try/finally form a unit. 6) What is the difference between the following statements? Catch (Exception e), Catch (Error err), Catch (Throwable t) Ans :

7) What will happen to the Exception object after exception handling? Ans : It will go for Garbage Collector. And frees the memory.

8) How many Exceptions we can define in throws clause? Ans : We can define multiple exceptions in throws clause. Signature is.. type method-name (parameter-list) throws exception-list

9) The finally block is executed when an exception is thrown, even if no catch matches it. True/False Ans : True 10) The subclass exception should precede the base class exception when used within the catch clause. True/False Ans : True 11) Exceptions can be caught or rethrown to a calling method. True/False Ans : True 12) The statements following the throw keyword in a program are not executed. True/False Ans : True 13) The toString ( ) method in the user-defined exception class is overridden. True/False Ans : True

MULTI THREADING 1) What are the two types of multitasking? Ans : 1.process-based 2.Thread-based 2) What are the two ways to create the thread? Ans : 1.by implementing Runnable 2.by extending Thread 3) What is the signature of the constructor of a thread class? Ans : Thread(Runnable threadob,String threadName) 4) What are all the methods available in the Runnable Interface? Ans : run() 5) What is the data type for the method isAlive() and this method is available in which class? Ans : boolean, Thread 6) What are all the methods available in the Thread class? Ans : 1.isAlive() 2.join()

3.resume() 4.suspend() 5.stop() 6.start() 7.sleep() 8.destroy() 7) What are all the methods used for Inter Thread communication and what is the class in which these methods are defined? Ans :1. wait(),notify() & notifyall() 2. Object class 8) What is the mechanisam defind by java for the Resources to be used by only one Thread at a time? Ans : Synchronisation 9) What is the procedure to own the moniter by many threads? Ans : not possible 10) What is the unit for 1000 in the below statement? ob.sleep(1000) Ans : long milliseconds 11) What is the data type for the parameter of the sleep() method? Ans : long 12) What are all the values for the following level? max-priority min-priority normal-priority Ans : 10,1,5 13) What is the method available for setting the priority?

Ans : setPriority() 14) What is the default thread at the time of starting the program? Ans : main thread 15) The word synchronized can be used with only a method. True/ False Ans : False 16) Which priority Thread can prompt the lower primary Thread? Ans : Higher Priority 17) How many threads at a time can access a monitor? Ans : one 18) What are all the four states associated in the thread? Ans : 1. new 2. runnable 3. blocked 4. dead 19) The suspend()method is used to teriminate a thread? True /False Ans : False 20) The run() method should necessary exists in clases created as subclass of thread? True /False Ans : True 21) When two threads are waiting on each other and can't proceed the programe is said to be in a deadlock? True/False Ans : True 22) Which method waits for the thread to die ? Ans : join() method

23) Which of the following is true? 1) wait(),notify(),notifyall() are defined as final & can be called only from with in a synchronized method 2) Among wait(),notify(),notifyall() the wait() method only throws IOException 3) wait(),notify(),notifyall() & sleep() are methods of object class 1 2 3 1&2 1,2 & 3 Ans : D 24) Garbage collector thread belongs to which priority? Ans : low-priority 25) What is meant by timeslicing or time sharing? Ans : Timeslicing is the method of allocating CPU time to individual threads in a priority schedule. 26) What is meant by daemon thread? In java runtime, what is it's role? Ans : Daemon thread is a low priority thread which runs intermittently in the background doing the garbage collection operation for the java runtime system.

Inheritance 1) What is the difference between superclass & subclass? Ans : A super class is a class that is inherited whereas subclass is a class that does the inheriting.

2) Which keyword is used to inherit a class? Ans : extends 3) Subclasses methods can access superclass members/ attributes at all times? True/False Ans : False

4) When can subclasses not access superclass members? Ans : When superclass is declared as private. 5) Which class does begin Java class hierarchy? Ans : Object class 6) Object class is a superclass of all other classes? True/False Ans : True 7) Java supports multiple inheritance? True/False Ans : False 8) What is inheritance? Ans : Deriving an object from an existing class. In the other words, Inheritance is the process of inheriting all the features from a class 9) What are the advantages of inheritance? Ans : Reusability of code and accessibility of variables and methods of the superclass by subclasses. 10) Which method is used to call the constructors of the superclass from the subclass? Ans : super(argument) 11) Which is used to execute any method of the superclass from the subclass? Ans : super.method-name(arguments)

12) Which methods are used to destroy the objects created by the constructor methods? Ans : finalize() 13) What are abstract classes? Ans : Abstract classes are those for which instances cant be created. 14) What must a class do to implement an interface? Ans: It must provide all of the methods in the interface and identify the interface in its implements clause. 15) Which methods in the Object class are declared as final? Ans : getClass(), notify(), notifyAll(), and wait() 16) Final methods can be overridden. True/False Ans : False 17) Declaration of methods as final results in faster execution of the program? True/False Ans: True 18) Final variables should be declared in the beginning? True/False Ans : True 19) Can we declare variable inside a method as final variables? Why? Ans : Cannot because, local variable cannot be declared as final variables. 20) Can an abstract class may be final? Ans : An abstract class may not be declared as final. 21) Does a class inherit the constructors of it's super class? Ans: A class does not inherit constructors from any of it's super classes. 22) What restrictions are placed on method overloading?

Ans: Two methods may not have the same name and argument list but different return types. 23) What restrictions are placed on method overriding? Ans : Overridden methods must have the same name , argument list , and return type. The overriding method may not limit the access of the method it overridees.The overriding method may not throw any exceptions that may not be thrown by the overridden method. 24) What modifiers may be used with an inner class that is a member of an outer class? Ans : a (non-local) inner class may be declared as public, protected, private, static, final or abstract. 25) How this() is used with constructors? Ans: this() is used to invoke a constructor of the same class 26) How super() used with constructors? Ans : super() is used to invoke a super class constructor 27) Which of the following statements correctly describes an interface? a)It's a concrete class b)It's a superclass c)It's a type of abstract class Ans: c 28) An interface contains __ methods a)Non-abstract b)Implemented c)unimplemented Ans:c

STRING HANDLING Which package does define String and StringBuffer classes? Ans : java.lang package. Which method can be used to obtain the length of the String? Ans : length( ) method. How do you concatenate Strings? Ans : By using " + " operator. Which method can be used to compare two strings for equality? Ans : equals( ) method. Which method can be used to perform a comparison between strings that ignores case differences? Ans : equalsIgnoreCase( ) method. What is the use of valueOf( ) method? Ans : valueOf( ) method converts data from its internal format into a human-readable form. What are the uses of toLowerCase( ) and toUpperCase( ) methods? Ans : The method toLowerCase( ) converts all the characters in a string from uppercase to lowercase. The method toUpperCase( ) converts all the characters in a string from lowercase to uppercase. Which method can be used to find out the total allocated capacity of a StrinBuffer?

Ans : capacity( ) method. Which method can be used to set the length of the buffer within a StringBuffer object? Ans : setLength( ). What is the difference between String and StringBuffer? Ans : String objects are constants, whereas StringBuffer objects are not. String class supports constant strings, whereas StringBuffer class supports growable, modifiable strings. What are wrapper classes? Ans : Wrapper classes are classes that allow primitive types to be accessed as objects. Which of the following is not a wrapper class? String Integer Boolean Character Ans : a. What is the output of the following program? public class Question { public static void main(String args[]) { String s1 = "abc"; String s2 = "def"; String s3 = s1.concat(s2.toUpperCase( ) ); System.out.println(s1+s2+s3); } } abcdefabcdef

abcabcDEFDEF abcdefabcDEF None of the above ANS : c. Which of the following methods are methods of the String class? delete( ) append( ) reverse( ) replace( ) Ans : d. Which of the following methods cause the String object referenced by s to be changed? s.concat( ) s.toUpperCase( ) s.replace( ) s.valueOf( ) Ans : a and b. String is a wrapper class? True False Ans : b. 17) If you run the code below, what gets printed out? String s=new String("Bicycle");

int iBegin=1;

char iEnd=3;

System.out.println(s.substring(iBegin,iEnd)); Bic ic c) icy d) error: no method matching substring(int,char) Ans : b. 18) Given the following declarations String s1=new String("Hello")

String s2=new String("there");

String s3=new String(); Which of the following are legal operations? s3=s1 + s2; s3=s1 - s2; c) s3=s1 & s2 d) s3=s1 && s2 Ans : a. 19) Which of the following statements are true? The String class is implemented as a char array, elements are addressed using the stringname[] convention b) Strings are a primitive type in Java that overloads the + operator for concatenation c) Strings are a primitive type in Java and the StringBuffer is used as the matching wrapper type d) The size of a string can be retrieved using the length property. Ans : b.

EXPLORING JAVA.LANG java.lang package is automatically imported into all programs. True False Ans : a What are the interfaces defined by java.lang? Ans : Cloneable, Comparable and Runnable. What are the constants defined by both Flaot and Double classes? Ans : MAX_VALUE, MIN_VALUE, NaN, POSITIVE_INFINITY, NEGATIVE_INFINITY and TYPE. What are the constants defined by Byte, Short, Integer and Long? Ans : MAX_VALUE, MIN_VALUE and TYPE. What are the constants defined by both Float and Double classes? Ans : MAX_RADIX, MIN_RADIX, MAX_VALUE,

MIN_VALUE and TYPE. What is the purpose of the Runtime class? Ans : The purpose of the Runtime class is to provide access to the Java runtime system. What is the purpose of the System class? Ans : The purpose of the System class is to provide access to system resources. Which class is extended by all other classes? Ans : Object class is extended by all other classes. Which class can be used to obtain design information about an object? Ans : The Class class can be used to obtain information about an objects design. Which method is used to calculate the absolute value of a number? Ans : abs( ) method. What are E and PI? Ans : E is the base of the natural logarithm and PI is the mathematical value pi. Which of the following classes is used to perform basic console I/O? System SecurityManager Math Runtime Ans : a. Which of the following are true? The Class class is the superclass of the Object class. The Object class is final. The Class class can be used to load other classes. The ClassLoader class can be used to load other classes.

Ans : c and d. Which of the following methods are methods of the Math class? absolute( ) log( ) cosine( ) sine( ) Ans : b. Which of the following are true about the Error and Exception classes? Both classes extend Throwable. The Error class is final and the Exception class is not. The Exception class is final and the Error is not. Both classes implement Throwable. Ans : a. Which of the following are true? The Void class extends the Class class. The Float class extends the Double class. The System class extends the Runtime class. The Integer class extends the Number class. Ans : d.

17) Which of the following will output -4.0 System.out.println(Math.floor(-4.7)); System.out.println(Math.round(-4.7));

System.out.println(Math.ceil(-4.7)); d) System.out.println(Math.Min(-4.7)); Ans : c. 18) Which of the following are valid statements a) public class MyCalc extends Math b) Math.max(s); c) Math.round(9.99,1); d) Math.mod(4,10); e) None of the above. Ans : e. 19) What will happen if you attempt to compile and run the following code? Integer ten=new Integer(10);

Long nine=new Long (9);

System.out.println(ten + nine);

int i=1;

System.out.println(i + ten); 19 followed by 20 19 followed by 11 Error: Can't convert java lang Integer d) 10 followed by 1 Ans : c.

INPUT / OUTPUT : EXPLORING JAVA.IO What is meant by Stream and what are the types of Streams and classes of the Streams? Ans : A Stream is an abstraction that either produces or consumes information. There are two types of Streams. They are: Byte Streams : Byte Streams provide a convenient means for handling input and output of bytes. Character Streams : Character Streams provide a convenient means for handling input and output of characters. Byte Stream classes : Byte Streams are defined by using two abstract classes. They are:InputStream and OutputStream. Character Stream classes : Character Streams are defined by using two abstract classes. They are : Reader and Writer. Which of the following statements are true? UTF characters are all 8-bits. UTF characters are all 16-bits. UTF characters are all 24-bits. Unicode characters are all 16-bits. Bytecode characters are all 16-bits. Ans : d. Which of the following statements are true? When you construct an instance of File, if you do not use the filenaming semantics of the local machine, the constructor will throw an IOException. When you construct an instance of File, if the corresponding file does not exist on the local file system, one will be created. When an instance of File is garbage collected, the corresponding file on the local file system is deleted. None of the above. Ans : a,b and c.

The File class contains a method that changes the current working directory. True False Ans : b. It is possible to use the File class to list the contents of the current working directory. True False Ans : a. Readers have methods that can read and return floats and doubles. True False Ans : b. You execute the code below in an empty directory. What is the result? File f1 = new File("dirname"); File f2 = new File(f1, "filename"); A new directory called dirname is created in the current working directory. A new directory called dirname is created in the current working directory. A new file called filename is created in directory dirname. A new directory called dirname and a new file called filename are created, both in the current working directory. A new file called filename is created in the current working directory. No directory is created, and no file is created. Ans : e. What is the difference between the Reader/Writer class hierarchy and the InputStream/OutputStream class hierarchy?

Ans : The Reader/Writer class hierarchy is character-oriented and the InputStream/OutputStream class hierarchy is byte-oriented. What is an I/O filter? Ans : An I/O filter is an object that reads from one stream and writes to another, usually altering the data in some way as it is passed from one stream to another. What is the purpose of the File class? Ans : The File class is used to create objects that provide access to the files and directories of a local file system. What interface must an object implement before it can be written to a stream as an object? Ans : An object must implement the Serializable or Externalizable interface before it can be written to a stream as an object. What is the difference between the File and RandomAccessFile classes? Ans : The File class encapsulates the files and directories of the local file system. The RandomAccessFile class provides the methods needed to directly access data contained in any part of a file. What class allows you to read objects directly from a stream? Ans : The ObjectInputStream class supports the reading of objects from input streams. What value does read( ) return when it has reached the end of a file? Ans : The read( ) method returns 1 when it has reached the end of a file. What value does readLine( ) return when it has reached the end of a file? Ans : The readLine( ) method returns null when it has reached the end of a file. How many bits are used to represent Unicode, ASCII, UTF-16 and UTF-8 characters? Ans : Unicode requires 16-bits and ASCII requires 8-bits. Although the ASCII character set uses only 1-bits, it is usually represented as 8-bits. UTF-8 represents characters using 8, 16 and 18bit patterns. UTF-16 uses 16-bit and larger bit patterns. Which of the following are true? The InputStream and OutputStream classes are byte-oriented.

The ObjectInputStream and ObjectOutputStream do not support serialized object input and output. The Reader and Writer classes are character-oriented. The Reader and Writer classes are the preferred solution to serialized object output. Ans : a and c. Which of the following are true about I/O filters? Filters are supported on input, but not on output. Filters are supported by the InputStream/OutputStream class hierarchy, but not by the Reader/Writer class hierarchy. Filters read from one stream and write to another. A filter may alter data that is read from one stream and written to another. Ans : c and d. Which of the following are true? Any Unicode character is represented using 16-bits. 7-bits are needed to represent any ASCII character. UTF-8 characters are represented using only 8-bits. UTF-16 characters are represented using only 16-bits. Ans : a and b. Which of the following are true? The Serializable interface is used to identify objects that may be written to an output stream. The Externalizable interface is implemented by classes that control the way in which their objects are serialized. The Serializable interface extends the Externalizable interface. The Externalizable interface extends the Serializable interface. Ans : a, b and d. Which of the following are true about the File class?

A File object can be used to change the current working directory. A File object can be used to access the files in the current directory. When a File object is created, a corresponding directory or file is created in the local file system. File objects are used to access files and directories on the local file system. File objects can be garbage collected. When a File object is garbage collected, the corresponding file or directory is deleted. Ans : b, d and e. How do you create a Reader object from an InputStream object? Use the static createReader( ) method of InputStream class. Use the static createReader( ) method of Reader class. Create an InputStreamReader object, passing the InputStream object as an argument to the InputStreamReader constructor. Create an OutputStreamReader object, passing the InputStream object as an argument to the OutputStreamReader constructor. Ans : c. Which of the following are true? Writer classes can be used to write characters to output streams using different character encodings. Writer classes can be used to write Unicode characters to output streams. Writer classes have methods that support the writing of the values of any Java primitive type to output streams. Writer classes have methods that support the writing of objects to output streams. Ans : a and b. The isFile( ) method returns a boolean value depending on whether the file object is a file or a directory. True.

False. Ans : a. Reading or writing can be done even after closing the input/output source. True. False. Ans : b.

The ________ method helps in clearing the buffer. Ans : flush( ). The System.err method is used to print error message. True. False. Ans : a. What is meant by StreamTokenizer? Ans : StreamTokenizer breaks up InputStream into tokens that are delimited by sets of characters. It has the constructor : StreamTokenizer(Reader inStream). Here inStream must be some form of Reader. What is Serialization and deserialization? Ans : Serialization is the process of writing the state of an object to a byte stream. Deserialization is the process of restoring these objects. 30) Which of the following can you perform using the File class? a) Change the current directory b) Return the name of the parent directory c) Delete a file d) Find if a file contains text or binary information Ans : b and c.

31)How can you change the current working directory using an instance of the File class called FileName? FileName.chdir("DirName"). FileName.cd("DirName"). FileName.cwd("DirName"). The File class does not support directly changing the current directory. Ans : d.

EVENT HANDLING The event delegation model, introduced in release 1.1 of the JDK, is fully compatible with the event model. True False Ans : b. A component subclass that has executed enableEvents( ) to enable processing of a certain kind of event cannot also use an adapter as a listener for the same kind of event. True False Ans : b. What is the highest-level event class of the event-delegation model? Ans : The java.util.eventObject class is the highest-level class in the event-delegation hierarchy.

What interface is extended by AWT event listeners? Ans : All AWT event listeners extend the java.util.EventListener interface. What class is the top of the AWT event hierarchy? Ans : The java.awt.AWTEvent class is the highest-level class in the AWT event class hierarchy. What event results from the clicking of a button? Ans : The ActionEvent event is generated as the result of the clicking of a button. What is the relationship between an event-listener interface and an event-adapter class? Ans : An event-listener interface defines the methods that must be implemented by an event handler for a particular kind of event. An event adapter provides a default implementation of an event-listener interface. In which package are most of the AWT events that support the event-delegation model defined? Ans : Most of the AWTrelated events of the event-delegation model are defined in the java.awt.event package. The AWTEvent class is defined in the java.awt package. What is the advantage of the event-delegation model over the earlier event-inheritance model? Ans : The event-delegation has two advantages over the event-inheritance model. They are : It enables event handling by objects other than the ones that generate the events. This allows a clean separation between a components design and its use. It performs much better in applications where many events are generated. This performance improvement is due to the fact that the event-delegation model does not have to repeatedly process unhandled events, as is the case of the event-inheritance model. What is the purpose of the enableEvents( ) method? Ans :The enableEvents( ) method is used to enable an event for a particular object. Which of the following are true? The event-inheritance model has replaced the event-delegation model.

The event-inheritance model is more efficient than the event-delegation model. The event-delegation model uses event listeners to define the methods of event-handling classes. The event-delegation model uses the handleEvent( ) method to support event handling. Ans : c. Which of the following is the highest class in the event-delegation model? java.util.EventListener java.util.EventObject java.awt.AWTEvent java.awt.event.AWTEvent Ans : b. When two or more objects are added as listeners for the same event, which listener is first invoked to handle the event? The first object that was added as listener. The last object that was added as listener. There is no way to determine which listener will be invoked first. It is impossible to have more than one listener for a given event. Ans : c. Which of the following components generate action events? Buttons Labels Check boxes Windows Ans : a. Which of the following are true? A TextField object may generate an ActionEvent.

A TextArea object may generate an ActionEvent. A Button object may generate an ActionEvent. A MenuItem object may generate an ActionEvent. Ans : a,c and d. Which of the following are true? The MouseListener interface defines methods for handling mouse clicks. The MouseMotionListener interface defines methods for handling mouse clicks. The MouseClickListener interface defines methods for handling mouse clicks. The ActionListener interface defines methods for handling the clicking of a button. Ans : a and d. Suppose that you want to have an object eh handle the TextEvent of a TextArea object t. How should you add eh as the event handler for t? t.addTextListener(eh); eh.addTextListener(t); addTextListener(eh.t); addTextListener(t,eh); Ans : a. What is the preferred way to handle an objects events in Java 2? Override the objects handleEvent( ) method. Add one or more event listeners to handle the events. Have the object override its processEvent( ) methods. Have the object override its dispatchEvent( ) methods. Ans : b. Which of the following are true? A component may handle its own events by adding itself as an event listener.

A component may handle its own events by overriding its event-dispatching method. A component may not handle oits own events. A component may handle its own events only if it implements the handleEvent( ) method. Ans : a and b.

APPLETS What is an Applet? Should applets have constructors?

Ans : Applet is a dynamic and interactive program that runs inside a Web page displayed by a Java capable browser. We dont have the concept of Constructors in Applets. How do we read number information from my applets parameters, given that Applets getParameter() method returns a string? Ans : Use the parseInt() method in the Integer Class, the Float(String) constructor in the Class Float, or the Double(String) constructor in the class Double. How can I arrange for different applets on a web page to communicate with each other? Ans : Name your applets inside the Applet tag and invoke AppletContexts getApplet() method in your applet code to obtain references to the other applets on the page. How do I select a URL from my Applet and send the browser to that page? Ans : Ask the applet for its applet context and invoke showDocument() on that context object. Eg. URL targetURL; String URLString AppletContext context = getAppletContext(); try{ targetUR L = new URL(URLString); } catch (Malformed URLException e){ // Code for recover from the exception } context. showDocument (targetURL); Can applets on different pages communicate with each other? Ans : No. Not Directly. The applets will exchange the information at one meeting place either on the local file system or at remote system. How do Applets differ from Applications? Ans : Appln: Stand Alone

Applet: Needs no explicit installation on local m/c. Appln: Execution starts with main() method. Applet: Execution starts with init() method. Appln: May or may not be a GUI Applet: Must run within a GUI (Using AWT) How do I determine the width and height of my application? Ans : Use the getSize() method, which the Applet class inherits from the Component class in the Java.awt package. The getSize() method returns the size of the applet as a Dimension object, from which you extract separate width, height fields. Eg. Dimension dim = getSize (); int appletwidth = dim.width (); 8) What is AppletStub Interface? Ans : The applet stub interface provides the means by which an applet and the browser communicate. Your code will not typically implement this interface. It is essential to have both the .java file and the .html file of an applet in the same directory. True. False. Ans : b. The <PARAM> tag contains two attributes namely _________ and _______. Ans : Name , value.

Passing values to parameters is done in the _________ file of an applet. Ans : .html. 12) What tags are mandatory when creating HTML to display an applet

name, height, width code, name codebase, height, width d) code, height, width Ans : d. Applets getParameter( ) method can be used to get parameter values. True. False. Ans : a. What are the Applets Life Cycle methods? Explain them? Ans : init( ) method - Can be called when an applet is first loaded. start( ) method - Can be called each time an applet is started. paint( ) method - Can be called when the applet is minimized or refreshed. stop( ) method - Can be called when the browser moves off the applets page. destroy( ) method - Can be called when the browser is finished with the applet. What are the Applets information methods? Ans : getAppletInfo( ) method : Returns a string describing the applet, its author ,copy right information, etc. getParameterInfo( ) method : Returns an array of string describing the applets parameters. All Applets are subclasses of Applet. True. False. Ans : a. All Applets must import java.applet and java.awt. True.

False. Ans : a. What are the steps involved in Applet development? Ans : a) Edit a Java source file, b) Compile your program and c) Execute the appletviewer, specifying the name of your applets source file. Applets are executed by the console based Java run-time interpreter. True. False. Ans : b. Which classes and interfaces does Applet class consist? Ans : Applet class consists of a single class, the Applet class and three interfaces: AppletContext, AppletStub and AudioClip. What is the sequence for calling the methods by AWT for applets? Ans : When an applet begins, the AWT calls the following methods, in this sequence. init( ) start( ) paint( ) When an applet is terminated, the following sequence of method cals takes place : stop( ) destroy( ) Which method is used to output a string to an applet? Ans : drawString ( ) method. Every color is created from an RGB value. True.

False Ans : a.

AWT : WINDOWS, GRAPHICS AND FONTS How would you set the color of a graphics context called g to cyan? g.setColor(Color.cyan); g.setCurrentColor(cyan); g.setColor("Color.cyan"); g.setColor("cyan); g.setColor(new Color(cyan)); Ans : a. The code below draws a line. What color is the line? g.setColor(Color.red.green.yellow.red.cyan); g.drawLine(0, 0, 100,100); Red Green Yellow Cyan Black Ans : d. What does the following code draw? g.setColor(Color.black); g.drawLine(10, 10, 10, 50); g.setColor(Color.RED);

g.drawRect(100, 100, 150, 150); A red vertical line that is 40 pixels long and a red square with sides of 150 pixels A black vertical line that is 40 pixels long and a red square with sides of 150 pixels A black vertical line that is 50 pixels long and a red square with sides of 150 pixels A red vertical line that is 50 pixels long and a red square with sides of 150 pixels A black vertical line that is 40 pixels long and a red square with sides of 100 pixel Ans : b. Which of the statements below are true? A polyline is always filled. b) A polyline can not be filled. c) A polygon is always filled. d) A polygon is always closed e) A polygon may be filled or not filled Ans : b, d and e. What code would you use to construct a 24-point bold serif font? new Font(Font.SERIF, 24,Font.BOLD); new Font("SERIF", 24, BOLD"); new Font("BOLD ", 24,Font.SERIF); new Font("SERIF", Font.BOLD,24); new Font(Font.SERIF, "BOLD", 24); Ans : d. What does the following paint( ) method draw? Public void paint(Graphics g) { g.drawString("question #6",10,0); }

The string "question #6", with its top-left corner at 10,0 A little squiggle coming down from the top of the component, a little way in from the left edge Ans : b.

What does the following paint( ) method draw? Public void paint(Graphics g) { g.drawString("question #6",10,0); } A circle at (100, 100) with radius of 44 A circle at (100, 44) with radius of 100 A circle at (100, 44) with radius of 44 The code does not compile Ans : d. 8)What is relationship between the Canvas class and the Graphics class? Ans : A Canvas object provides access to a Graphics object via its paint( ) method. What are the Component subclasses that support painting. Ans : The Canvas, Frame, Panel and Applet classes support painting. What is the difference between the paint( ) and repaint( ) method? Ans : The paint( ) method supports painting via a Graphics object. The repaint( ) method is used to cause paint( ) to be invoked by the AWT painting method. What is the difference between the Font and FontMetrics classes? Ans : The FontMetrics class is used to define implementation-specific properties, such as ascent and descent, of a Font object. Which of the following are passed as an argument to the paint( ) method?

A Canvas object A Graphics object An Image object A paint object Ans : b. Which of the following methods are invoked by the AWT to support paint and repaint operations? paint( ) repaint( ) draw( ) redraw( ) Ans : a. Which of the following classes have a paint( ) method? Canvas Image Frame Graphics Ans : a and c. Which of the following are methods of the Graphics class? drawRect( ) drawImage( ) drawPoint( ) drawString( ) Ans : a, b and d. Which Font attributes are available through the FontMetrics class?

ascent leading case height Ans : a, b and d. Which of the following are true? The AWT automatically causes a window to be repainted when a portion of a window has been minimized and then maximized. The AWT automatically causes a window to be repainted when a portion of a window has been covered and then uncovered. The AWT automatically causes a window to be repainted when application data is changed. The AWT does not support repainting operations. Ans : a and b. Which method is used to size a graphics object to fit the current size of the window? Ans : getSize( ) method. What are the methods to be used to set foreground and background colors? Ans : setForeground( ) and setBackground( ) methods. 19) You have created a simple Frame and overridden the paint method as follows public void paint(Graphics g){

g.drawString("Dolly",50,10);

} What will be the result when you attempt to compile and run the program? The string "Dolly" will be displayed at the centre of the frame

b) An error at compilation complaining at the signature of the paint method c) The lower part of the word Dolly will be seen at the top of the form, with the top hidden. d) The string "Dolly" will be shown at the bottom of the form Ans : c. 20) Where g is a graphics instance what will the following code draw on the screen. g.fillArc(45,90,50,50,90,180); a) An arc bounded by a box of height 45, width 90 with a centre point of 50,50, starting at an angle of 90 degrees traversing through 180 degrees counter clockwise. b) An arc bounded by a box of height 50, width 50, with a centre point of 45,90 starting at an angle of 90 degrees traversing through 180 degrees clockwise. c) An arc bounded by a box of height 50, width 50, with a top left at coordinates of 45, 90, starting at 90 degrees and traversing through 180 degrees counter clockwise. d) An arc starting at 45 degrees, traversing through 90 degrees clockwise bounded by a box of height 50, width 50 with a centre point of 90, 180. Ans : c. 21) Given the following code import java.awt.*; public class SetF extends Frame{ public static void main(String argv[]){ SetF s = new SetF(); s.setSize(300,200); s.setVisible(true); } } How could you set the frame surface color to pink a)s.setBackground(Color.pink); b)s.setColor(PINK); c)s.Background(pink); d)s.color=Color.pink Ans : a.

AWT: CONTROLS, LAYOUT MANAGERS AND MENUS What is meant by Controls and what are different types of controls? Ans : Controls are componenets that allow a user to interact with your application. The AWT supports the following types of controls: Labels Push buttons Check boxes Choice lists Lists Scroll bars Text components These controls are subclasses of Component. You want to construct a text area that is 80 character-widths wide and 10 character-heights tall. What code do you use? new TextArea(80, 10) new TextArea(10, 80) Ans: b. A text field has a variable-width font. It is constructed by calling new TextField("iiiii"). What happens if you change the contents of the text field to "wwwww"? (Bear in mind that is one of the narrowest characters, and w is one of the widest.) The text field becomes wider. The text field becomes narrower. The text field stays the same width; to see the entire contents you will have to scroll by using the and keys.

The text field stays the same width; to see the entire contents you will have to scroll by using the text fields horizontal scroll bar. Ans : c. The CheckboxGroup class is a subclass of the Component class. True False Ans : b. 5) What are the immediate super classes of the following classes? a) Container class b) MenuComponent class c) Dialog class d) Applet class e) Menu class Ans : a) Container - Component b) MenuComponent - Object c) Dialog - Window d) Applet - Panel e) Menu - MenuItem 6) What are the SubClass of Textcomponent Class? Ans : TextField and TextArea 7) Which method of the component class is used to set the position and the size of a component? Ans : setBounds() 8) Which TextComponent method is used to set a TextComponent to the read-only state? Ans : setEditable() 9) How can the Checkbox class be used to create a radio button?

Ans : By associating Checkbox objects with a CheckboxGroup. 10) What Checkbox method allows you to tell if a Checkbox is checked? Ans : getState() 11) Which Component method is used to access a component's immediate Container? getVisible() getImmediate getParent() getContainer Ans : c. 12) What methods are used to get and set the text label displayed by a Button object? Ans : getLabel( ) and setLabel( ) 13) What is the difference between a Choice and a List? Ans : A Choice is displayed in a compact form that requires you to pull it down to see the list of available choices. Only one item may be selected from a Choice. A List may be displayed in such a way that several List items are visible. A List supports the selection of one or more List items. 14) Which Container method is used to cause a container to be laid out and redisplayed? Ans : validate( ) 15) What is the difference between a Scollbar and a Scrollpane? Ans : A Scrollbar is a Component, but not a Container. A Scrollpane is a Container and handles its own events and performs its own scrolling. 16) Which Component subclass is used for drawing and painting? Ans : Canvas. 17) Which of the following are direct or indirect subclasses of Component? Button

Label CheckboxMenuItem Toolbar Frame Ans : a, b and e. 18) Which of the following are direct or indirect subclasses of Container? Frame TextArea MenuBar FileDialog Applet Ans : a,d and e. 19) Which method is used to set the text of a Label object? setText( ) setLabel( ) setTextLabel( ) setLabelText( ) Ans : a. 20) Which constructor creates a TextArea with 10 rows and 20 columns? new TextArea(10, 20) new TextArea(20, 10) new TextArea(new Rows(10), new columns(20)) new TextArea(200) Ans : a. (Usage is TextArea(rows, columns)

21) Which of the following creates a List with 5 visible items and multiple selection enabled? new List(5, true) new List(true, 5) new List(5, false) new List(false,5) Ans : a. [Usage is List(rows, multipleMode)] 22) Which are true about the Container class? The validate( ) method is used to cause a Container to be laid out and redisplayed. The add( ) method is used to add a Component to a Container. The getBorder( ) method returns information about a Containers insets. The getComponent( ) method is used to access a Component that is contained in a Container. Ans : a, b and d. 23) Suppose a Panel is added to a Frame and a Button is added to the Panel. If the Frames font is set to 12-point TimesRoman, the Panels font is set to 10-point TimesRoman, and the Buttons font is not set, what font will be used to dispaly the Buttons label? 12-point TimesRoman 11-point TimesRoman 10-point TimesRoman 9-point TimesRoman Ans : c. A Frames background color is set to Color.Yellow, and a Buttons background color is to Color.Blue. Suppose the Button is added to a Panel, which is added to the Frame. What background color will be used with the Panel? Colr.Yellow Color.Blue Color.Green

Color.White Ans : a. 25) Which method will cause a Frame to be displayed? show( ) setVisible( ) display( ) displayFrame( ) Ans : a and b. 26) All the componenet classes and container classes are derived from _________ class. Ans : Object. 27) Which method of the container class can be used to add components to a Panel. Ans : add ( ) method. 28) What are the subclasses of the Container class? Ans : The Container class has three major subclasses. They are : Window Panel ScrollPane 29) The Choice component allows multiple selection. True. False. Ans : b. 30) The List component does not generate any events. True. False. Ans : b.

31) Which components are used to get text input from the user. Ans : TextField and TextArea. 32) Which object is needed to group Checkboxes to make them exclusive? Ans : CheckboxGroup. 33) Which of the following components allow multiple selections? Non-exclusive Checkboxes. Radio buttons. Choice. List. Ans : a and d. 34) What are the types of Checkboxes and what is the difference between them? Ans : Java supports two types of Checkboxes. They are : Exclusive and Non-exclusive. In case of exclusive Checkboxes, only one among a group of items can be selected at a time. I f an item from the group is selected, the checkbox currently checked is deselected and the new selection is highlighted. The exclusive Checkboxes are also called as Radio buttons. The non-exclusive checkboxes are not grouped together and each one can be selected independent of the other. 35) What is a Layout Manager and what are the different Layout Managers available in java.awt and what is the default Layout manager for the panal and the panal subclasses? Ans: A layout Manager is an object that is used to organize components in a container. The different layouts available in java.awt are : FlowLayout, BorderLayout, CardLayout, GridLayout and GridBag Layout. The default Layout Manager of Panal and Panal sub classes is FlowLayout". 36) Can I exert control over the size and placement of components in my interface? Ans : Yes. myPanal.setLayout(null); myPanal.setbounds(20,20,200,200);

37) Can I add the same component to more than one container? Ans : No. Adding a component to a container automatically removes it from any previous parent(container). 38) How do I specify where a window is to be placed? Ans : Use setBounds, setSize, or setLocation methods to implement this. setBounds(int x, int y, int width, int height) setBounds(Rectangle r) setSize(int width, int height) setSize(Dimension d) setLocation(int x, int y) setLocation(Point p)

39) How can we create a borderless window? Ans : Create an instance of the Window class, give it a size, and show it on the screen. eg. Frame aFrame = ...... Window aWindow = new Window(aFrame); aWindow.setLayout(new FlowLayout()); aWindow.add(new Button("Press Me")); aWindow.getBounds(50,50,200,200); aWindow.show();

40) Can I create a non-resizable windows? If so, how? Ans: Yes. By using setResizable() method in class Frame. 41) What is the default Layout Manager for the Window and Window subclasses (Frame,Dialog)? Ans : BorderLayout().

42) How are the elements of different layouts organized? Ans : FlowLayout : The elements of a FlowLayout are organized in a top to bottom, left to right fashion. BorderLayout : The elements of a BorderLayout are organized at the borders (North, South, East and West) and the center of a container. CardLayout : The elements of a CardLayout are stacked, one on top of the other, like a deck of cards. GridLayout : The elements of a GridLayout are of equal size and are laid out using the square of a grid. GridBagLayout : The elements of a GridBagLayout are organized according to a grid.However, the elements are of different sizes and may occupy more than one row or column of the grid. In addition, the rows and columns may have different sizes. 43) Which containers use a BorderLayout as their default layout? Ans : The Window, Frame and Dialog classes use a BorderLayout as their default layout.

44) Which containers use a FlowLayout as their default layout? Ans : The Panel and the Applet classes use the FlowLayout as their default layout. 45) What is the preferred size of a component? Ans : The preferred size of a component size that will allow the component to display normally. 46) Which method is method to set the layout of a container? startLayout( ) initLayout( ) layoutContainer( ) setLayout( ) Ans : d.

47) Which method returns the preferred size of a component? getPreferredSize( ) getPreferred( ) getRequiredSize( ) getLayout( ) Ans : a.

48) Which layout should you use to organize the components of a container in a tabular form? CardLayout BorederLayout FlowLayout GridLayout Ans : d. An application has a frame that uses a Border layout manager. Why is it probably not a good idea to put a vertical scroll bar at North in the frame? The scroll bars height would be its preferred height, which is not likely to be enough. The scroll bars width would be the entire width of the frame, which would be much wider than necessary. Both a and b. Neither a nor b. There is no problem with the layout as described. Ans : c.

What is the default layouts for a applet, a frame and a panel? Ans : For an applet and a panel, Flow layout is the default layout, whereas Border layout is default layout for a frame. If a frame uses a Grid layout manager and does not contain any panels, then all the components within the frame are the same width and height. True False. Ans : a. If a frame uses its default layout manager and does not contain any panels, then all the components within the frame are the same width and height. True False. Ans : b. With a Border layout manager, the component at Center gets all the space that is left over, after the components at North and South have been considered. True False Ans : b. An Applet has its Layout Manager set to the default of FlowLayout. What code would be the correct to change to another Layout Manager? setLayoutManager(new GridLayout()); setLayout(new GridLayout(2,2)); c) setGridLayout(2,2,)) d setBorderLayout(); Ans : b. 55) How do you indicate where a component will be positioned using Flowlayout? a) North, South,East,West b) Assign a row/column grid reference

c) Pass a X/Y percentage parameter to the add method d) Do nothing, the FlowLayout will position the component Ans :d.

56) How do you change the current layout manager for a container? a) Use the setLayout method b) Once created you cannot change the current layout manager of a component c) Use the setLayoutManager method d) Use the updateLayout method Ans :a. 57)When using the GridBagLayout manager, each new component requires a new instance of the GridBagConstraints class. Is this statement true or false? a) true b) false Ans : b. 58) Which of the following statements are true? a)The default layout manager for an Applet is FlowLayout b) The default layout manager for an application is FlowLayout c) A layout manager must be assigned to an Applet before the setSize method is called d) The FlowLayout manager attempts to honor the preferred size of any components Ans : a and d. 59) Which method does display the messages whenever there is an item selection or deselection of the CheckboxMenuItem menu? Ans : itemStateChanged method. 60) Which is a dual state menu item? Ans : CheckboxMenuItem. 61) Which method can be used to enable/diable a checkbox menu item?

Ans : setState(boolean). Which of the following may a menu contain? A separator A check box A menu A button A panel Ans : a and c. Which of the following may contain a menu bar? A panel A frame An applet A menu bar A menu Ans : b 64) What is the difference between a MenuItem and a CheckboxMenuItem? Ans : The CheckboxMenuItem class extends the MenuItem class to support a menu item that may be checked or unchecked.

65) Which of the following are true? A Dialog can have a MenuBar. MenuItem extends Menu. A MenuItem can be added to a Menu. A Menu can be added to a Menu. Ans : c and d.

olour is used to indicate instance me d ethods in the standard "javadoc" form mat Which co documen ntation: 1) blue 2) red e 3) purple 4) orange e Answer : 2 explain In JDK 1 the variab 1.1 bels, method and const ds tructors are c colour coded to simplify d ytheir identifica ation. endExpla ain What is t correct ordering for the import, c the o class and pa ackage decla arations whe found in a en single file e? 1) packag import, class ge, c 2) class, import, pack kage t, c 3) import package, class 4) packag class, im ge, mport Answer : 1 explain This is m explanatio for questi 2 my on ion endExpla ain Which methods can be legally ap b pplied to a st tring object? ? (Multiple e) 1) equals s(String)

2) equals(Object) 3) trim() 4) round() 5) toString() Answer : 1,2,3,5 What is the parameter specification for the public static void main method? (multiple) 1) String args [] 2) String [] args 3) Strings args [] 4) String args Answer : 1,2 What does the zeroth element of the string array passed to the public static void main method contain? (multiple) 1) The name of the program 2) The number of arguments 3) The first argument if one is present Answer : 3 Which of the following are Java keywords? (multiple) 1) goto 2) malloc 3) extends 4) FALSE

Answer : 3 What will be the result of compiling the following code: public class Test { public static void main (String args []) { int age; age = age + 1; System.out.println("The age is " + age); } } 1) Compiles and runs with no output 2) Compiles and runs printing out The age is 1 3) Compiles but generates a runtime error 4) Does not compile 5) Compiles but generates a compile time error Answer : 4 Which of these is the correct format to use to create the literal char value a? (multiple) 1) 'a' 2) "a" 3) new Character(a) 4) \000a Answer : 1 What is the legal range of a byte integral type? 1) 0 - 65, 535 2) (-128) - 127

3) (-32,768) - 32,767 4) (-256) - 255 Answer : 2 Which of the following is illegal: 1) int i = 32; 2) float f = 45.0; 3) double d = 45.0; Answer 2 What will be the result of compiling the following code: public class Test { static int age; public static void main (String args []) { age = age + 1; System.out.println("The age is " + age); } } 1) Compiles and runs with no output 2) Compiles and runs printing out The age is 1 3) Compiles but generates a runtime error 4) Does not compile 5) Compiles but generates a compile time error Answer : 2 Which of the following are correct? (multiple) 1) 128 >> 1 gives 64

2) 128 >>> 1 gives 64 3) 128 >> 1 gives -64 4) 128 >>> 1 gives -64 Answer : 1 Which of the following return true? (multiple) 1) "john" == new String("john") 2) "john".equals("john") 3) "john" = "john" 4) "john".equals(new Button("john")) Answer : 2 Which of the following do not lead to a runtime error? (multiple) 1) "john" + " was " + " here" 2) "john" + 3 3) 3 + 5 4) 5 + 5.5 answer 1,2,3,4 Which of the following are so called "short circuit" logical operators? (multiple) 1) & 2) || 3) && 4) | Answer : 2,3

Which of the following are acceptable? (multiple) 1) Object o = new Button("A"); 2) Boolean flag = true; 3) Panel p = new Frame(); 4) Frame f = new Panel(); 5) Panel p = new Applet(); Answer : 1,5 What is the result of compiling and running the following code: public class Test { static int total = 10; public static void main (String args []) { new Test(); } public Test () { System.out.println("In test"); System.out.println(this); int temp = this.total; if (temp > 5) { System.out.println(temp); } } } (multiple) 1) The class will not compile

2) The compiler reports and error at line 2 3) The compiler reports an error at line 9 4) The value 10 is one of the elements printed to the standard output 5) The class compiles but generates a runtime error Answer : 4 Which of the following is correct: 1) String temp [] = new String {"j" "a" "z"}; 2) String temp [] = { "j " " b" "c"}; 3) String temp = {"a", "b", "c"}; 4) String temp [] = {"a", "b", "c"}; Answer 4 What is the correct declaration of an abstract method that is intended to be public: 1) public abstract void add(); 2) public abstract void add() {} 3) public abstract add(); 4) public virtual add(); Answer : 1 Under what situations do you obtain a default constructor? 1) When you define any class 2) When the class has no other constructors 3) When you define at least one constructor Answer : 2 Which of the following can be used to define a constructor for this class, given the following code: public class Test {

... } 1) public void Test() {...} 2) public Test() {...} 3) public static Test() {...} 4) public static void Test() {...} Answer : 2 Which of the following are acceptable to the Java compiler: (multiple) 1) if (2 == 3) System.out.println("Hi"); 2) if (2 = 3) System.out.println("Hi"); 3) if (true) System.out.println("Hi"); 4) if (2 != 3) System.out.println("Hi"); 5) if (aString.equals("hello")) System.out.println("Hi"); Answer : 1,3,4,5 Assuming a method contains code which may raise an Exception (but not a RuntimeException), what is the correct way for a method to indicate that it expects the caller to handle that exception: 1) throw Exception 2) throws Exception 3) new Exception 4) Don't need to specify anything Answer : 2 What is the result of executing the following code, using the parameters 4 and 0: public void divide(int a, int b) { try {

int c = a / b; } catch (Exception e) { System.out.print("Exception "); } finally { System.out.println("Finally"); } 1) Prints out: Exception Finally 2) Prints out: Finally 3) Prints out: Exception 4) No output Answer : 1 Which of the following is a legal return type of a method overloading the following method: public void add(int a) {...} 1) void 2) int 3) Can be anything Answer : 3 Which of the following statements is correct for a method which is overriding the following method: public void add(int a) {...} 1) the overriding method must return void 2) the overriding method must return int 3) the overriding method can return whatever it likes Answer : 1 Given the following classes defined in separate files, what will be the effect of compiling and running this class Test?

class Vehicle { public void drive() { System.out.println("Vehicle: drive"); } } class Car extends Vehicle { public void drive() { System.out.println("Car: drive"); } } public class Test { public static void main (String args []) { Vehicle v; Car c; v = new Vehicle(); c = new Car(); v.drive(); c.drive(); v = c; v.drive(); } } 1) Generates a Compiler error on the statement v= c; 2) Generates runtime error on the statement v= c; 3) Prints out:

Vehicle: drive Car: drive Car: drive 4) Prints out: Vehicle: drive Car: drive Vehicle: drive Answer : 3 Where in a constructor, can you place a call to a constructor defined in the super class? 1) Anywhere 2) The first statement in the constructor 3) The last statement in the constructor 4) You can't call super in a constructor Answer : 2 Which variables can an inner class access from the class which encapsulates it? (multiple) 1) All static variables 2) All final variables 3) All instance variables 4) Only final instance variables 5) Only final static variables Answer : 1,2,3 What class must an inner class extend: 1) The top level class 2) The Object class

3) Any class or interface 4) It must extend an interface Answer 3 In the following code, which is the earliest statement, where the object originally held in e, may be garbage collected: 1. public class Test { 2. public static void main (String args []) { 3. Employee e = new Employee("Bob", 48); 4. e.calculatePay(); 5. System.out.println(e.printDetails()); 6. e = null; 7. e = new Employee("Denise", 36); 8. e.calculatePay(); 9. System.out.println(e.printDetails()); 10. } 11. } 1) Line 10 2) Line 11 3) Line 7 4) Line 8 5) Never Answer : 3 What is the name of the interface that can be used to define a class that can execute within its own thread? 1) Runnable 2) Run

3) Threadable 4) Thread 5) Executable Answer : 1 What is the name of the method used to schedule a thread for execution? 1) init(); 2) start(); 3) run(); 4) resume(); 5) sleep(); Answer : 2 Which methods may cause a thread to stop executing? (multiple) 1) sleep(); 2) stop(); 3) yield(); 4) wait(); 5) notify(); 6) notifyAll() 7) synchronized() Answer : 1,2,3,4 Which of the following would create a text field able to display 10 characters (assuming a fixed size font) displaying the initial string "hello": 1) new TextField("hello", 10); 2) new TextField("hello");

3) new textField(10); 4) new TextField(); Answer : 1 Which of the following methods are defined on the Graphics class: (multiple) 1) drawLine(int, int, int, int) 2) drawImage(Image, int, int, ImageObserver) 3) drawString(String, int, int) 4) add(Component); 5) setVisible(boolean); 6) setLayout(Object); Answer : 1,2,3 Which of the following layout managers honours the preferred size of a component: (multiple) 1) CardLayout 2) FlowLayout 3) BorderLayout 4) GridLayout Answer : 2 Given the following code what is the effect of a being 5: public class Test { public void add(int a) { loop: for (int i = 1; i < 3; i++){ for (int j = 1; j < 3; j++) { if (a == 5) {

break loop; } System.out.println(i * j); } } } } 1) Generate a runtime error 2) Throw an ArrayIndexOutOfBoundsException 3) Print the values: 1, 2, 2, 4 4) Produces no output Answer : 4 What is the effect of issuing a wait() method on an object 1) If a notify() method has already been sent to that object then it has no effect 2) The object issuing the call to wait() will halt until another object sends a notify() or notifyAll() method 3) An exception will be raised 4) The object issuing the call to wait() will be automatically synchronized with any other objects using the receiving object. Answer : 2 The layout of a container can be altered using which of the following methods: (multiple) 1) setLayout(aLayoutManager); 2) addLayout(aLayoutManager); 3) layout(aLayoutManager); 4) setLayoutManager(aLayoutManager);

Answer : 1 Using a FlowLayout manager, which is the correct way to add elements to a container: 1) add(component); 2) add("Center", component); 3) add(x, y, component); 4) set(component); Answer : 1 Given that a Button can generate an ActionEvent which listener would you expect to have to implement, in a class which would handle this event? 1) FocusListener 2) ComponentListener 3) WindowListener 4) ActionListener 5) ItemListener Answer : 4 Which of the following, are valid return types, for listener methods: 1) boolean 2) the type of event handled 3) void 4) Component Answer : 3 Assuming we have a class which implements the ActionListener interface, which method should be used to register this with a Button? 1) addListener(*); 2) addActionListener(*); 3) addButtonListener(*);

4) setListener(*); Answer : 2 In order to cause the paint(Graphics) method to execute, which of the following is the most appropriate method to call: 1) paint() 2) repaint() 3) paint(Graphics) 4) update(Graphics) 5) None - you should never cause paint(Graphics) to execute Answer : 2 Which of the following illustrates the correct way to pass a parameter into an applet: 1) <applet code=Test.class age=33 width=100 height=100> 2) <param name=age value=33> 3) <applet code=Test.class name=age value=33 width=100 height=100> 4) <applet Test 33> Answer : 2 Which of the following correctly illustrate how an InputStreamReader can be created: (multiple) 1) new InputStreamReader(new FileInputStream("data")); 2) new InputStreamReader(new FileReader("data")); 3) new InputStreamReader(new BufferedReader("data")); 4) new InputStreamReader("data"); 5) new InputStreamReader(System.in); Answer : 1,5 What is the permanent effect on the file system of writing data to a new FileWriter("report"), given the file report already exists?

1) The data is appended to the file 2) The file is replaced with a new file 3) An exception is raised as the file already exists 4) The data is written to random locations within the file Answer : 2 What is the effect of adding the sixth element to a vector created in the following manner: new Vector(5, 10); 1) An IndexOutOfBounds exception is raised. 2) The vector grows in size to a capacity of 10 elements 3) The vector grows in size to a capacity of 15 elements 4) Nothing, the vector will have grown when the fifth element was added Answer : 3 What is the result of executing the following code when the value of x is 2: switch (x) { case 1: System.out.println(1); case 2: case 3: System.out.println(3); case 4: System.out.println(4); } 1) Nothing is printed out 2) The value 3 is printed out 3) The values 3 and 4 are printed out

4) The values 1, 3 and 4 are printed out Answer : 3 What is the result of compiling and running the Second class? Consider the following example: class First { public First (String s) { System.out.println(s); } } public class Second extends First { public static void main(String args []) { new Second(); } } 1) Nothing happens 2) A string is printed to the standard out 3) An instance of the class First is generated 4) An instance of the class Second is created 5) An exception is raised at runtime stating that there is no null parameter constructor in class First. 6) The class second will not compile as there is no null parameter constructor in the class First Answer : 6 What is the result of executing the following fragment of code: boolean flag = false; if (flag = true) {

System.out.println("true"); } else { System.out.println("false"); } 1) true is printed to standard out 2) false is printed to standard out 3) An exception is raised 4) Nothing happens Answer : 1 Consider the following classes. What is the result of compiling and running this class? public class Test { public static void test() { this.print(); } public static void print() { System.out.println("Test"); } public static void main(String args []) { test(); } } (multiple) 1) The string Test is printed to the standard out. 2) A runtime exception is raised stating that an object has not been created. 3) Nothing is printed to the standard output.

4) An exception is raised stating that the method test cannot be found. 5) An exception is raised stating that the variable this can only be used within an instance. 6) The class fails to compile stating that the variable this is undefined. Answer : 6 Examine the following class definition: public class Test { public static void test() { print(); } public static void print() { System.out.println("Test"); } public void print() { System.out.println("Another Test"); } } What is the result of compiling this class: 1) A successful compilation. 2) A warning stating that the class has no main method. 3) An error stating that there is a duplicated method. 4) An error stating that the method test() will call one or other of the print() methods. Answer : 3 What is the result of compiling and executing the following Java class: public class ThreadTest extends Thread { public void run() {

System.out.println("In run"); suspend(); resume(); System.out.println("Leaving run"); } public static void main(String args []) { (new ThreadTest()).start(); } } 1) Compilation will fail in the method main. 2) Compilation will fail in the method run. 3) A warning will be generated for method run. 4) The string "In run" will be printed to standard out. 5) Both strings will be printed to standard out. 6) Nothing will happen. Answer : 4 Given the following sequence of Java statements, Which of the following options are true: 1. StringBuffer sb = new StringBuffer("abc"); 2. String s = new String("abc"); 3. sb.append("def"); 4. s.append("def"); 5. sb.insert(1, "zzz"); 6. s.concat(sb); 7. s.trim(); (multiple)

1) The compiler would generate an error for line 1. 2) The compiler would generate an error for line 2. 3) The compiler would generate an error for line 3. 4) The compiler would generate an error for line 4. 5) The compiler would generate an error for line 5. 6) The compiler would generate an error for line 6. 7) The compiler would generate an error for line 7. Answer : 4,6 What is the result of executing the following Java class: import java.awt.*; public class FrameTest extends Frame { public FrameTest() { add (new Button("First")); add (new Button("Second")); add (new Button("Third")); pack(); setVisible(true); } public static void main(String args []) { new FrameTest(); } } 1) Nothing happens. 2) Three buttons are displayed across a window. 3) A runtime exception is generated (no layout manager specified).

4) Only the "first" button is displayed. 5) Only the "second" button is displayed. 6) Only the "third" button is displayed. Answer : 6 Consider the following tags and attributes of tags, which can be used with the <AAPLET> and </APPLET> tags? 1. CODEBASE 2. ALT 3. NAME 4. CLASS 5. JAVAC 6. HORIZONTALSPACE 7. VERTICALSPACE 8. WIDTH 9. PARAM 10. JAR (multiple) 1) line 1, 2, 3 2) line 2, 5, 6, 7 3) line 3, 4, 5 4) line 8, 9, 10 5) line 8, 9 Answer : 1,5 Which of the following is a legal way to construct a RandomAccessFile: 1) RandomAccessFile("data", "r");

2) RandomAccessFile("r", "data"); 3) RandomAccessFile("data", "read"); 4) RandomAccessFile("read", "data"); Answer : 1 Carefully examine the following code, When will the string "Hi there" be printed? public class StaticTest { static { System.out.println("Hi there"); } public void print() { System.out.println("Hello"); } public static void main(String args []) { StaticTest st1 = new StaticTest(); st1.print(); StaticTest st2 = new StaticTest(); st2.print(); } } 1) Never. 2) Each time a new instance is created. 3) Once when the class is first loaded into the Java virtual machine. 4) Only when the static method is called explicitly. Answer : 3 What is the result of the following program:

public class Test { public static void main (String args []) { boolean a = false; if (a = true) System.out.println("Hello"); else System.out.println("Goodbye"); } } 1) Program produces no output but terminates correctly. 2) Program does not terminate. 3) Prints out "Hello" 4) Prints out "Goodbye" Answer : 3 Examine the following code, it includes an inner class, what is the result: public final class Test4 { class Inner { void test() { if (Test4.this.flag); { sample(); } } } private boolean flag = true; public void sample() {

System.out.println("Sample"); } public Test4() { (new Inner()).test(); } public static void main(String args []) { new Test4(); } } 1) Prints out "Sample" 2) Program produces no output but terminates correctly. 3) Program does not terminate. 4) The program will not compile Answer : 1 Carefully examine the following class: public class Test5 { public static void main (String args []) { /* This is the start of a comment if (true) { Test5 = new test5(); System.out.println("Done the test"); } /* This is another comment */ System.out.println ("The end"); }

} 1) Prints out "Done the test" and nothing else. 2) Program produces no output but terminates correctly. 3) Program does not terminate. 4) The program will not compile. 5) The program generates a runtime exception. 6) The program prints out "The end" and nothing else. 7) The program prints out "Done the test" and "The end" Answer : 6 What is the result of compiling and running the following applet: import java.applet.Applet; import java.awt.*; public class Sample extends Applet { private String text = "Hello World"; public void init() { add(new Label(text)); } public Sample (String string) { text = string; } } It is accessed form the following HTML page: <html> <title>Sample Applet</title> <body>

<applet code="Sample.class" width=200 height=200></applet> </body> </html> 1) Prints "Hello World". 2) Generates a runtime error. 3) Does nothing. 4) Generates a compile time error. Answer : 2 What is the effect of compiling and (if possible) running this class: public class Calc { public static void main (String args []) { int total = 0; for (int i = 0, j = 10; total > 30; ++i, --j) { System.out.println(" i = " + i + " : j = " + j); total += (i + j); } System.out.println("Total " + total); } } 1) Produce a runtime error 2) Produce a compile time error 3) Print out "Total 0" 4) Generate the following as output: i = 0 : j = 10 i=1:j=9

i=2:j=8 Total 30 Answer : 3

Utility Package 1) What is the Vector class? ANSWER : The Vector class provides the capability to implement a growable array of objects. 2) What is the Set interface? ANSWER : The Set interface provides methods for accessing the elements of a finite mathematical set.Sets do not allow duplicate elements. 3) What is Dictionary class? ANSWER : The Dictionary class is the abstarct super class of Hashtable and Properties class.Dictionary provides the abstarct functions used to store and retrieve objects by keyvalue.This class allows any object to be used as a key or value. 4) What is the Hashtable class? ANSWER : The Hashtable class implements a hash table data structure. A hash table indexes and stores objects in a dictionary using hash codes as the objects' keys. Hash codes are integer values that identify objects. 5) What is the Properties class? Answer : The properties class is a subclass of Hashtable that can be read from or written to a stream.It also provides the capability to specify a set of default values to be used if a specified key is not found in the table. We have two methods load() and save(). 6) What changes are needed to make the following prg to compile?

import java.util.*; class Ques{ public static void main (String args[]) { String s1 = "abc"; String s2 = "def"; Vector v = new Vector(); v.add(s1); v.add(s2); String s3 = v.elementAt(0) + v.elementAt(1); System.out.println(s3); } } ANSWER : Declare Ques as public B) Cast v.elementAt(0) to a String C) Cast v.elementAt(1) to an Object. D) Import java.lang ANSWER : B) Cast v.elementAt(0) to a String

8) What is the output of the prg. import java.util.*; class Ques{ public static void main (String args[]) { String s1 = "abc";

String s2 = "def"; Stack stack = new Stack(); stack.push(s1); stack.push(s2); try{ String s3 = (String) stack.pop() + (String) stack.pop() ; System.out.println(s3); }catch (EmptyStackException ex){} } } ANSWER : abcdef B) defabc C) abcabc D) defdef ANSWER : B) defabc 9) Which of the following may have duplicate elements? ANSWER : Collection B) List C) Map D) Set ANSWER : A and B Neither a Map nor a Set may have duplicate elements. 10) Can null value be added to a List? ANSWER : Yes.A Null value may be added to any List. 11) What is the output of the following prg. import java.util.*; class Ques{ public static void main (String args[]) { HashSet set = new HashSet(); String s1 = "abc"; String s2 = "def"; String s3 = "";

set.add(s1); set.add(s2); set.add(s1); set.add(s2); Iterator i = set.iterator(); while(i.hasNext()) { s3 += (String) i.next(); } System.out.println(s3); } } A) abcdefabcdef B) defabcdefabc C) fedcbafedcba D) defabc ANSWER : D) defabc. Sets may not have duplicate elements. 12) Which of the following java.util classes support internationalization? A) Locale B) ResourceBundle C) Country D) Language ANSWER : A and B . Country and Language are not java.util classes. 13) What is the ResourceBundle? The ResourceBundle class also supports internationalization. ResourceBundle subclasses are used to store locale-specific resources that can be loaded by a program to tailor the program's appearence to the paticular locale in which it is being run. Resource Bundles provide the capability to isolate a program's locale-specific resources in a standard and modular manner. 14) How are Observer Interface and Observable class, in java.util package, used? ANSWER : Objects that subclass the Observable class maintain a list of Observers. When an Observable object is updated it invokes the update() method of each of its observers to notify the

observers that it has changed state. The Observer interface is implemented by objects that observe Observable objects. 15) Which java.util classes and interfaces support event handling? ANSWER : The EventObject class and the EventListener interface support event processing. 16) Does java provide standard iterator functions for inspecting a collection of objects? ANSWER : The Enumeration interface in the java.util package provides a framework for stepping once through a collection of objects. We have two methods in that interface. public interface Enumeration { boolean hasMoreElements(); Object nextElement(); } 17) The Math.random method is too limited for my needs- How can I generate random numbers more flexibly? ANSWER : The random method in Math class provide quick, convienient access to random numbers, but more power and flexibility use the Random class in the java.util package. double doubleval = Math.random(); The Random class provide methods returning float, int, double, and long values. nextFloat() // type float; 0.0 <= value < 1.0 nextDouble() // type double; 0.0 <= value < 1.0 nextInt() // type int; Integer.MIN_VALUE <= value <= Integer.MAX_VALUE nextLong() // type long; Long.MIN_VALUE <= value <= Long.MAX_VALUE nextGaussian() // type double; has Gaussian("normal") distribution with mean 0.0 and standard deviation 1.0) Eg. Random r = new Random(); float floatval = r.nextFloat();

18) How can we get all public methods of an object dynamically? ANSWER : By using getMethods(). It return an array of method objects corresponding to the public methods of this class. getFields() returns an array of Filed objects corresponding to the public Fields(variables) of this class. getConstructors() returns an array of constructor objects corresponding to the public constructors of this class.

JDBC 1) What are the steps involved in establishing a connection? ANSWER : This involves two steps: (1) loading the driver and (2) making the connection. 2) How can you load the drivers? ANSWER : Loading the driver or drivers you want to use is very simple and involves just one line of code. If, for example, you want to use the JDBC-ODBC Bridge driver, the following code will load it: Eg. Class.forName("sun.jdbc.odbc.JdbcOdbcDriver"); Your driver documentation will give you the class name to use. For instance, if the class name is jdbc.DriverXYZ , you would load the driver with the following line of code: Eg. Class.forName("jdbc.DriverXYZ"); 3) What Class.forName will do while loading drivers? ANSWER : It is used to create an instance of a driver and register it with the DriverManager. When you have loaded a driver, it is available for making a connection with a DBMS. 4) How can you make the connection?

ANSWER : In establishing a connection is to have the appropriate driver connect to the DBMS. The following line of code illustrates the general idea: Eg. String url = "jdbc:odbc:Fred"; Connection con = DriverManager.getConnection(url, "Fernanda", "J8"); 5) How can you create JDBC statements? ANSWER : A Statement object is what sends your SQL statement to the DBMS. You simply create a Statement object and then execute it, supplying the appropriate execute method with the SQL statement you want to send. For a SELECT statement, the method to use is executeQuery. For statements that create or modify tables, the method to use is executeUpdate. Eg. It takes an instance of an active connection to create a Statement object. In the following example, we use our Connection object con to create the Statement object stmt : Statement stmt = con.createStatement(); 6) How can you retrieve data from the ResultSet? ANSWER : Step 1. JDBC returns results in a ResultSet object, so we need to declare an instance of the class ResultSet to hold our results. The following code demonstrates declaring the ResultSet object rs. Eg. ResultSet rs = stmt.executeQuery("SELECT COF_NAME, PRICE FROM COFFEES"); Step2. String s = rs.getString("COF_NAME"); The method getString is invoked on the ResultSet object rs , so getString will retrieve (get) the value stored in the column COF_NAME in the current row of rs 7) What are the different types of Statements? ANSWER : 1.Statement (use createStatement method) 2. Prepared Statement (Use prepareStatement method) and 3. Callable Statement (Use prepareCall) 8) How can you use PreparedStatement?

ANSWER : This special type of statement is derived from the more general class, Statement.If you want to execute a Statement object many times, it will normally reduce execution time to use a PreparedStatement object instead. The advantage to this is that in most cases, this SQL statement will be sent to the DBMS right away, where it will be compiled. As a result, the PreparedStatement object contains not just an SQL statement, but an SQL statement that has been precompiled. This means that when the PreparedStatement is executed, the DBMS can just run the PreparedStatement 's SQL statement without having to compile it first. Eg. PreparedStatement updateSales = con.prepareStatement("UPDATE COFFEES SET SALES = ? WHERE COF_NAME LIKE ?"); 9) What setAutoCommit does? ANSWER : When a connection is created, it is in auto-commit mode. This means that each individual SQL statement is treated as a transaction and will be automatically committed right after it is executed. The way to allow two or more statements to be grouped into a transaction is to disable auto-commit mode Eg. con.setAutoCommit(false); Once auto-commit mode is disabled, no SQL statements will be committed until you call the method commit explicitly. Eg. con.setAutoCommit(false); PreparedStatement updateSales = con.prepareStatement( "UPDATE COFFEES SET SALES = ? WHERE COF_NAME LIKE ?"); updateSales.setInt(1, 50); updateSales.setString(2, "Colombian"); updateSales.executeUpdate(); PreparedStatement updateTotal = con.prepareStatement("UPDATE COFFEES SET TOTAL = TOTAL + ? WHERE COF_NAME LIKE ?"); updateTotal.setInt(1, 50);

updateTotal.setString(2, "Colombian"); updateTotal.executeUpdate(); con.commit(); con.setAutoCommit(true); 10) How to call a Strored Procedure from JDBC? ANSWER : The first step is to create a CallableStatement object. As with Statement an and PreparedStatement objects, this is done with an open Connection object. A CallableStatement object contains a call to a stored procedure; Eg. CallableStatement cs = con.prepareCall("{call SHOW_SUPPLIERS}"); ResultSet rs = cs.executeQuery(); 11) How to Retrieve Warnings? ANSWER : SQLWarning objects are a subclass of SQLException that deal with database access warnings. Warnings do not stop the execution of an application, as exceptions do; they simply alert the user that something did not happen as planned. A warning can be reported on a Connection object, a Statement object (including PreparedStatement and CallableStatement objects), or a ResultSet object. Each of these classes has a getWarnings method, which you must invoke in order to see the first warning reported on the calling object Eg. SQLWarning warning = stmt.getWarnings(); if (warning != null) { System.out.println("\n---Warning---\n"); while (warning != null) { System.out.println("Message: " + warning.getMessage()); System.out.println("SQLState: " + warning.getSQLState()); System.out.print("Vendor error code: ");

System.out.println(warning.getErrorCode()); System.out.println(""); warning = warning.getNextWarning(); } } 12) How can you Move the Cursor in Scrollable Result Sets ? ANSWER : One of the new features in the JDBC 2.0 API is the ability to move a result set's cursor backward as well as forward. There are also methods that let you move the cursor to a particular row and check the position of the cursor. Eg. Statement stmt = con.createStatement(ResultSet.TYPE_SCROLL_SENSITIVE, ResultSet.CONCUR_READ_ONLY); ResultSet srs = stmt.executeQuery("SELECT COF_NAME, PRICE FROM COFFEES"); The first argument is one of three constants added to the ResultSet API to indicate the type of a ResultSet object: TYPE_FORWARD_ONLY, TYPE_SCROLL_INSENSITIVE , and TYPE_SCROLL_SENSITIVE . The second argument is one of two ResultSet constants for specifying whether a result set is read-only or updatable: CONCUR_READ_ONLY and CONCUR_UPDATABLE . The point to remember here is that if you specify a type, you must also specify whether it is read-only or updatable. Also, you must specify the type first, and because both parameters are of type int , the compiler will not complain if you switch the order. Specifying the constant TYPE_FORWARD_ONLY creates a nonscrollable result set, that is, one in which the cursor moves only forward. If you do not specify any constants for the type and updatability of a ResultSet object, you will automatically get one that is TYPE_FORWARD_ONLY and CONCUR_READ_ONLY 13) Whats the difference between TYPE_SCROLL_INSENSITIVE , and TYPE_SCROLL_SENSITIVE? ANSWER : You will get a scrollable ResultSet object if you specify one of these ResultSet constants.The difference between the two has to do with whether a result set reflects changes that are made to it while it is open and whether certain methods can be called to detect these changes. Generally speaking, a result set that is TYPE_SCROLL_INSENSITIVE does not reflect

changes made while it is still open and one that is TYPE_SCROLL_SENSITIVE does. All three types of result sets will make changes visible if they are closed and then reopened Eg. Statement stmt = con.createStatement(ResultSet.TYPE_SCROLL_INSENSITIVE, ResultSet.CONCUR_READ_ONLY); ResultSet srs = stmt.executeQuery("SELECT COF_NAME, PRICE FROM COFFEES"); srs.afterLast(); while (srs.previous()) { String name = srs.getString("COF_NAME"); float price = srs.getFloat("PRICE"); System.out.println(name + " " + price); } 14) How to Make Updates to Updatable Result Sets? ANSWER : Another new feature in the JDBC 2.0 API is the ability to update rows in a result set using methods in the Java programming language rather than having to send an SQL command. But before you can take advantage of this capability, you need to create a ResultSet object that is updatable. In order to do this, you supply the ResultSet constant CONCUR_UPDATABLE to the createStatement method. Eg. Connection con = DriverManager.getConnection("jdbc:mySubprotocol:mySubName"); Statement stmt = con.createStatement(ResultSet.TYPE_SCROLL_SENSITIVE, ResultSet.CONCUR_UPDATABLE); ResultSet uprs = stmt.executeQuery("SELECT COF_NAME, PRICE FROM COFFEES");

Networking Concepts 1) The API doesn't list any constructors for InetAddress- How do I create an InetAddress instance?

ANSWER : In case of InetAddress the three methods getLocalHost, getByName, getByAllName can be used to create instances. E.g. InetAddress add1; InetAddress add2; try{ add1 = InetAddress.getByName("java.sun.com"); add2 = InetAddress.getByName("199.22.22.22"); }catch(UnknownHostException e){} 2) Is it possible to get the Local host IP? ANSWER : Yes. Use InetAddress's getLocalHost method. 3) What's the Factory Method? ANSWER : Factory methods are merely a convention whereby static methods in a class return an instance of that class. The InetAddress class has no visible constructors. To create an InetAddress object, you have to use one of the available factory methods. In InetAddress the three methods getLocalHost, getByName, getByAllName can be used to create instances of InetAddress. 4) Whats the difference between TCP and UDP? ANSWER : These two protocols differ in the way they carry out the action of communicating. A TCP protocol establishes a two way connection between a pair of computers, while the UDP protocol is a one-way message sender. The common analogy is that TCP is like making a phone call and carrying on a two-way communication, while UDP is like mailing a letter. 5) What is the Proxy Server? ANSWER : A proxy server speaks the client side of a protocol to another server. This is often required when clients have certain restrictions on which servers they can connect to. And when several users are hitting a popular web site, a proxy server can get the contents of the web server's popular pages once, saving expensive internetwork transfers while providing faster access to those pages to the clients. Also, we can get multiple connections for a single server. 6) What are the seven layers of OSI model?

ANSWER : Application, Presentation, Session, Transport, Network, DataLink, Physical Layer. What Transport Layer does? ANSWER : It ensures that the mail gets to its destination. If a packet fails to get its destination, it handles the process of notifying the sender and requesting that another packet be sent. 8) What is DHCP? ANSWER : Dynamic Host Configuration Protocol, a piece of the TCP/IP protocol suite that handles the automatic assignment of IP addresses to clients. 9) What is SMTP? ANSWER : Simple Mail Transmission Protocol, the TCP/IP Standard for Internet mails. SMTP exchanges mail between servers; contrast this with POP, which transmits mail between a server and a client. 10) In OSI N/w architecture, the dialogue control and token management are responsibilities of... Answer : Network b) Session c) Application d) DataLink ANSWER : b) Session Layer. 11) In OSI N/W Architecture, the routing is performed by ______ Answer : Network b) Session c) Application d) DataLink ANSWER : Answer : Network Layer. Networking

What is the difference between URL instance and URLConnection instance? ANSWER : A URL instance represents the location of a resource, and a URLConnection instance represents a link for accessing or communicating with the resource at the location. 2) How do I make a connection to URL? ANSWER : You obtain a URL instance and then invoke openConnection on it. URLConnection is an abstract class, which means you can't directly create instances of it using a constructor. We have to invoke openConnection method on a URL instance, to get the right kind of connection for your URL.

Eg. URL url; URLConnection connection; try{ url = new URL("..."); conection = url.openConnection(); }catch (MalFormedURLException e) { }

3) What Is a Socket? A socket is one end-point of a two-way communication link between two programs running on the network. A socket is bound to a port number so that the TCP layer can identify the application that data is destined to be sent.Socket classes are used to represent the connection between a client program and a server program. The java.net package provides two classes-Socket and ServerSocket--which implement the client side of the connection and the server side of the connection, respectively. What information is needed to create a TCP Socket? ANSWER : The Local Systems IP Address and Port Number. And the Remote System's IPAddress and Port Number. 5) What are the two important TCP Socket classes? ANSWER : Socket and ServerSocket. ServerSocket is used for normal two-way socket communication. Socket class allows us to read and write through the sockets. getInputStream() and getOutputStream() are the two methods available in Socket class. When MalformedURLException and UnknownHostException throws? ANSWER : When the specified URL is not connected then the URL throw MalformedURLException and If InetAddress methods getByName and getLocalHost are unabletoresolve the host name they throwan UnknownHostException. Servlets

1) What is the servlet?

ANSWER : Servlets are modules that extend request/response-oriented servers, such as Javaenabled web servers. For example, a servlet might be responsible for taking data in an HTML order-entry form and applying the business logic used to update a company's order database. Servlets are to servers what applets are to browsers. Unlike applets, however, servlets have no graphical user interface. 2) Whats the advantages using servlets than using CGI? ANSWER : Servlets provide a way to generate dynamic documents that is both easier to write and faster to run. Servlets also address the problem of doing server-side programming with platform-specific APIs: they are developed with the Java Servlet API, a standard Java extension. 3) What are the uses of Servlets? ANSWER : A servlet can handle multiple requests concurrently, and can synchronize requests. This allows servlets to support systems such as on-line conferencing. Servlets can forward requests to other servers and servlets.Thus servlets can be used to balance load among several servers that mirror the same content, and to partition a single logical service over several servers, according to task type or organizational boundaries. 4) Which pakage provides interfaces and classes for writing servlets? ANSWER : javax 5) Whats the Servlet Interfcae? ANSWER : The central abstraction in the Servlet API is the Servlet interface. All servlets implement this interface, either directly or, more commonly, by extending a class that implements it such as HttpServlet. Servlets-->Generic Servlet-->HttpServlet-->MyServlet. The Servlet interface declares, but does not implement, methods that manage the servlet and its communications with clients. Servlet writers provide some or all of these methods when developing a servlet. 6) When a servlet accepts a call from a client, it receives two objects- What are they? ANSWER : ServeltRequest: Which encapsulates the communication from the client to the server. ServletResponse: Whcih encapsulates the communication from the servlet back to the client. ServletRequest and ServletResponse are interfaces defined by the javax.servlet package. 7) What information that the ServletRequest interface allows the servlet access to?

ANSWER : Information such as the names of the parameters passed in by the client, the protocol (scheme) being used by the client, and the names of the remote host that made the request and the server that received it. The input stream, ServletInputStream.Servlets use the input stream to get data from clients that use application protocols such as the HTTP POST and PUT methods. 8) What information that the ServletResponse interface gives the servlet methods for replying to the client? ANSWER : It Allows the servlet to set the content length and MIME type of the reply. Provides an output stream, ServletOutputStream and a Writer through which the servlet can send the reply data. 9) What is the servlet Lifecycle? ANSWER : Each servlet has the same life cycle: A server loads and initializes the servlet (init()) The servlet handles zero or more client requests (service()) The server removes the servlet (destroy()) (some servers do this step only when they shut down) 10) How HTTP Servlet handles client requests? ANSWER : An HTTP Servlet handles client requests through its service method. The service method supports standard HTTP client requests by dispatching each request to a method designed to handle that request. 1

Encapsulation : Encapsulation is the mechanism that binds together code and the data it manipulates and keeps both safe from outside interference and misuse. Inheritance: Inheritance is the process by which one object acquires the properties of another object. Polymorphism:

Polymorphism is a feature that allows one interface to be used for a general class of actions. The specific action is determined by the exact nature of actions. Code Blocks: Two or more statements which is allowed to be grouped into blocks of code is otherwise called as Code Blocks.This is done by enclosing the statements between opening and closing curly braces. Floating-point numbers: Floating-point numbers which is also known as real numbers, are used when evaluating expressions that require fractional precision. Unicode: Unicode defines a fully international character set that can represent all of the characters found in all human languages. It is a unification of dozens of character sets, such as Latin, Greek, Arabic and many more. Booleans: Java has a simple type called boolean, for logical values. It can have only on of two possible values, true or false. Casting: A cast is simply an explicit type conversion. To create a conversion between two incompatible types, you must use a cast. Arrays: An array is a group of like-typed variables that are referred to by a common name. Arrays offer a convenient means of grouping related information. Arrays of any type can be created and may have one or more dimension. Relational Operators: The relational operators determine the relationship that one operand has to the other. They determine the equality and ordering. 11.Short-Circuit Logical Operators: The secondary versions of the Boolean AND and OR operators are known as shortcircuit logical operators. It is represented by || and &&..

12. Switch: The switch statement is Javas multiway branch statement. It provides an easy way to dispatch execution to different parts of your code based on the value of an experession. 13. Jump Statements: Jump statements are the statements which transfer control to another part of your program. Java Supports three jump statements: break, continue, and return. 14. Instance Variables: The data, or variable, defined within a class are called instance variable.

Mphasis-BFL Software Sample Paper Interview Profile of the company * Written Test The written test consists of the following sections: 1. Computer Awareness Section -- Consists of 45 questions of MCQ type. There is negative marking of one-fourth mark. A correct answer is worth one mark. 2. Quantitative Section -- Consists of 20 questions of MCQ type. There is negative marking of one-fourth mark. A correct answer is worth one mark. It is advisable to refer Baron's GRE Guide for this section. 3.Analytical Ability Section -- Consists of 20 questions of MCQ type. There is negative marking of one-fourth mark. A correct answer is worth one mark. It is advisable to refer Baron's GRE Guide for this section. Click here to see the sample test. <BFL1.htm> Back To The Top * Interview The information on the interview is pretty sketchy but it may consist of both technical grilling and HR interview. We would suggest that you take a look at the Interview section. <../Intsec.htm> to get a better idea and view some useful tips for taking interviews. Back To The Top * Profile

Prior to the merger, Mphasis was a California based firm working on their e-Business initiatives. BFL Software was a development house leveraging the Indian offshore model. The Mphasis-BFL combine works towards helping migration towards e-Business through optimization of legacy systems. With 18 offices worldwide, it has emerged as a global player in the IT industry. They have offices in Bangalore, Pune COMPUTER AWARENESS TEST 1.In the command scanf, h is used for Ans. Short int

2.A process is defined as Ans. Program in execution

3.A thread is Ans. Detachable unit of executable code)

4.What is the advantage of Win NT over Win 95 Ans. Robust and secure

5.How is memory management done in Win95 Ans. Through paging and segmentation

6.What is meant by polymorphism Ans. Redfinition of a base class method in a derived class

7.What is the essential feature of inheritance Ans. All properties of existing class are derived

8.What does the protocol FTP do

Ans. Transfer a file b/w stations with user authentification

9.In the transport layer ,TCP is what type of protocol Ans. Connection oriented

10.Why is a gateway used Ans. To connect incompatible networks

11.How is linked list implemented Ans. By referential structures

12.What method is used in

ORACLE ********************************************** *********

section 2:

1. what is sparse matrix?give (at least) two methods for implemetation rather than two dimentional array.

2. what are cheap locks/latches?. 3. what is two phase locking?. Name two locks. 4. What are volatile variables in C? What is their significance ? 5. will these two work in same manner #define intp int * typedef int * intp; 6. what are binary trees? what is its use?

section 3 :

A) write header file containing functions used, etc (C), problem is to maitain a Queue. user has to give size and type of Queue. This problem is like this I don't remember exactly. B). C++ 1. What is polymorphism?

2. What is Inheritance? 3. Mention four Object Oriented Programming Languages? 4. Mention basic concepts of OOP 5. What are messages in OOP? 6. What is garbage collection? 7. what is object? 8. what is a class?

section 4: 1. expand the following: a.SEI b. ISO 2. what are different levels of SEI? 3. What is significance of ISO? 4. Expand the following: a. WWW b. HTTP c. HTML

d. TCP/IP 5. what is Black box testing? 6. explain the following: 1. white box testing 2. black box testing 3. boundary testing 4. stress 5. negative 6. system 7. unit 8. module 9. destructive Operating Systems
Following are a few basic questions that cover the essentials of OS:

1. Explain the concept of Reentrancy. It is a useful, memory-saving technique for multiprogrammed timesharing systems. A Reentrant Procedure is one in which multiple users can share a single copy of a program during the same period. Reentrancy has 2 key aspects: The program code cannot modify itself, and the local data for each user process must be stored separately. Thus, the permanent part is the code, and the temporary part is the pointer back to the calling program and local variables used by that program. Each execution instance is

called activation. It executes the code in the permanent part, but has its own copy of local variables/parameters. The temporary part associated with each activation is the activation record. Generally, the activation record is kept on the stack. Note: A reentrant procedure can be interrupted and called by an interrupting program, and still execute correctly on returning to the procedure.

2. Explain Belady's Anomaly. Also called FIFO anomaly. Usually, on increasing the number of frames allocated to a process' virtual memory, the process execution is faster, because fewer page faults occur. Sometimes, the reverse happens, i.e., the execution time increases even when more frames are allocated to the process. This is Belady's Anomaly. This is true for certain page reference patterns.

3. What is a binary semaphore? What is its use? A binary semaphore is one, which takes only 0 and 1 as values. They are used to implement mutual exclusion and synchronize concurrent processes.

4. What is thrashing? It is a phenomenon in virtual memory schemes when the processor spends most of its time swapping pages, rather than executing instructions. This is due to an inordinate number of page faults.

5. List the Coffman's conditions that lead to a deadlock. Mutual Exclusion: Only one process may use a critical resource at a time. Hold & Wait: A process may be allocated some resources while waiting for others. No Pre-emption: No resource can be forcible removed from a process holding it. Circular Wait: A closed chain of processes exist such that each process holds at least one resource needed by another process in the chain.

6. What are short-, long- and medium-term scheduling? Long term scheduler determines which programs are admitted to the system for processing. It controls the degree of multiprogramming. Once admitted, a job becomes a process. Medium term scheduling is part of the swapping function. This relates to processes that are in a blocked or suspended state. They are swapped out of real-memory until they are ready to execute. The swapping-in decision is based on memory-management criteria. Short term scheduler, also know as a dispatcher executes most frequently, and makes the finestgrained decision of which process should execute next. This scheduler is invoked whenever an event occurs. It may lead to interruption of one process by preemption.

7. What are turnaround time and response time? Turnaround time is the interval between the submission of a job and its completion. Response time is the interval between submission of a request, and the first response to that request.

8. What are the typical elements of a process image? User data: Modifiable part of user space. May include program data, user stack area, and programs that may be modified. User program: The instructions to be executed. System Stack: Each process has one or more LIFO stacks associated with it. Used to store parameters and calling addresses for procedure and system calls. Process control Block (PCB): Info needed by the OS to control processes. 9. What is the Translation Lookaside Buffer (TLB)? In a cached system, the base addresses of the last few referenced pages is maintained in registers called the TLB that aids in faster lookup. TLB contains those page-table entries that have been most recently used. Normally, each virtual memory reference causes 2 physical memory accesses-- one to fetch appropriate page-table entry, and one to fetch the desired data. Using TLB in-between, this is reduced to just one physical memory access in cases of TLB-hit.

10. What is the resident set and working set of a process? Resident set is that portion of the process image that is actually in real-memory at a particular instant. Working set is that subset of resident set that is actually needed for execution. (Relate this to the variable-window size method for swapping techniques.)

11. When is a system in safe state? The set of dispatchable processes is in a safe state if there exists at least one temporal order in which all processes can be run to completion without resulting in a deadlock.

12. What is cycle stealing? We encounter cycle stealing in the context of Direct Memory Access (DMA). Either the DMA controller can use the data bus when the CPU does not need it, or it may force the CPU to temporarily suspend operation. The latter technique is called cycle stealing. Note that cycle stealing can be done only at specific break points in an instruction cycle.

13. What is meant by arm-stickiness? If one or a few processes have a high access rate to data on one track of a storage disk, then they may monopolize the device by repeated requests to that track. This generally happens with most common

device scheduling algorithms (LIFO, SSTF, C-SCAN, etc). High-density multisurface disks are more likely to be affected by this than low density ones.

14. What are the stipulations of C2 level security? C2 level security provides for: Discretionary Access Control Identification and Authentication Auditing Resource reuse 15. What is busy waiting? The repeated execution of a loop of code while waiting for an event to occur is called busywaiting. The CPU is not engaged in any real productive activity during this period, and the process does not progress toward completion.

16. Explain the popular multiprocessor thread-scheduling strategies. Load Sharing: Processes are not assigned to a particular processor. A global queue of threads is maintained. Each processor, when idle, selects a thread from this queue. Note that load balancing refers to a scheme where work is allocated to processors on a more permanent basis. Gang Scheduling: A set of related threads is scheduled to run on a set of processors at the same time, on a 1-to-1 basis. Closely related threads / processes may be scheduled this way to reduce synchronization blocking, and minimize process switching. Group scheduling predated this strategy. Dedicated processor assignment: Provides implicit scheduling defined by assignment of threads to processors. For the duration of program execution, each program is allocated a set of processors equal in number to the number of threads in the program. Processors are chosen from the available pool. Dynamic scheduling: The number of thread in a program can be altered during the course of execution. 17. When does the condition 'rendezvous' arise? In message passing, it is the condition in which, both, the sender and receiver are blocked until the message is delivered.

18. What is a trap and trapdoor? Trapdoor is a secret undocumented entry point into a program used to grant access without normal methods of access authentication. A trap is a software interrupt, usually the result of an error condition.

19. What are local and global page replacements?

Local replacement means that an incoming page is brought in only to the relevant process' address space. Global replacement policy allows any page frame from any process to be replaced. The latter is applicable to variable partitions model only.

20. Define latency, transfer and seek time with respect to disk I/O. Seek time is the time required to move the disk arm to the required track. Rotational delay or latency is the time it takes for the beginning of the required sector to reach the head. Sum of seek time (if any) and latency is the access time. Time taken to actually transfer a span of data is transfer time.

21. Describe the Buddy system of memory allocation. Free memory is maintained in linked lists, each of equal sized blocks. Any such block is of size 2^k. When some memory is required by a process, the block size of next higher order is chosen, and broken into two. Note that the two such pieces differ in address only in their kth bit. Such pieces are called buddies. When any used block is freed, the OS checks to see if its buddy is also free. If so, it is rejoined, and put into the original free-block linked-list.

22. What is time-stamping? It is a technique proposed by Lamport, used to order events in a distributed system without the use of clocks. This scheme is intended to order events consisting of the transmission of messages. Each system 'i' in the network maintains a counter Ci. Every time a system transmits a message, it increments its counter by 1 and attaches the time-stamp Ti to the message. When a message is received, the receiving system 'j' sets its counter Cj to 1 more than the maximum of its current value and the incoming time-stamp Ti. At each site, the ordering of messages is determined by the following rules: For messages x from site i and y from site j, x precedes y if one of the following conditions holds....(a) if Ti<Tj or (b) if Ti=Tj and i<j.

23. How are the wait/signal operations for monitor different from those for semaphores? If a process in a monitor signal and no task is waiting on the condition variable, the signal is lost. So this allows easier program design. Whereas in semaphores, every operation affects the value of the semaphore, so the wait and signal operations should be perfectly balanced in the program.

24. In the context of memory management, what are placement and replacement algorithms? Placement algorithms determine where in available real-memory to load a program. Common methods are first-fit, next-fit, best-fit. Replacement algorithms are used when memory is full, and one process (or part of a process) needs to be swapped out to accommodate a new program. The replacement algorithm determines which are the partitions to be swapped out.

25. In loading programs into memory, what is the difference between load-time dynamic linking and runtime dynamic linking? For load-time dynamic linking: Load module to be loaded is read into memory. Any reference to a target external module causes that module to be loaded and the references are updated to a relative address from the start base address of the application module. With run-time dynamic loading: Some of the linking is postponed until actual reference during execution. Then the correct module is loaded and linked.

26. What are demand- and pre-paging? With demand paging, a page is brought into memory only when a location on that page is actually referenced during execution. With pre-paging, pages other than the one demanded by a page fault are brought in. The selection of such pages is done based on common access patterns, especially for secondary memory devices.

27. Paging a memory management function, while multiprogramming a processor management function, are the two interdependent? Yes.

28. What is page cannibalizing? Page swapping or page replacements are called page cannibalizing.

29. What has triggered the need for multitasking in PCs? Increased speed and memory capacity of microprocessors together with the support fir virtual memory and Growth of client server computing 30. What are the four layers that Windows NT have in order to achieve independence? Hardware abstraction layer Kernel Subsystems System Services. 31. What is SMP? To achieve maximum efficiency and reliability a mode of operation known as symmetric multiprocessing is used. In essence, with SMP any process or threads can be assigned to any processor.

32. What are the key object oriented concepts used by Windows NT? Encapsulation Object class and instance 33. Is Windows NT a full blown object oriented operating system? Give reasons. No Windows NT is not so, because its not implemented in object oriented language and the data structures reside within one executive component and are not represented as objects and it does not support object oriented capabilities .

34. What is a drawback of MVT? It does not have the features like ability to support multiple processors virtual storage source level debugging 35. What is process spawning? When the OS at the explicit request of another process creates a process, this action is called process spawning.

36. How many jobs can be run concurrently on MVT? 15 jobs

37. List out some reasons for process termination. Normal completion Time limit exceeded Memory unavailable Bounds violation Protection error Arithmetic error Time overrun I/O failure Invalid instruction Privileged instruction Data misuse Operator or OS intervention Parent termination. 38. What are the reasons for process suspension? swapping interactive user request timing

parent process request 39. What is process migration? It is the transfer of sufficient amount of the state of process from one machine to the target machine

40. What is mutant? In Windows NT a mutant provides kernel mode or user mode mutual exclusion with the notion of ownership.

41. What is an idle thread? The special thread a dispatcher will execute when no ready thread is found.

42. What is FtDisk? It is a fault tolerance disk driver for Windows NT.

43. What are the possible threads a thread can have? Ready Standby Running Waiting Transition Terminated. 44. What are rings in Windows NT? Windows NT uses protection mechanism called rings provides by the process to implement separation between the user mode and kernel mode.

45. What is Executive in Windows NT? In Windows NT, executive refers to the operating system code that runs in kernel mode.

46. What are the sub-components of I/O manager in Windows NT? Network redirector/ Server Cache manager. File systems Network driver Device driver

47. What are DDks? Name an operating system that includes this feature. DDks are device driver kits, which are equivalent to SDKs for writing device drivers. Windows NT includes DDks.

48. What level of security does Windows NT meets? C2 level security.

SUN Microsystems
Profile of the company <SUN.htm> *

Written Test

We have pretty sketchy information on the exact pattern of the SUN written test. There is a technical section which is pretty tough. Question based on C, UNIX, Computer Networks, Data Structures and Operating Systems can be expected. * Interview The interview questions were mainly on data structures, computer architecture ( very imp) , operating systems and computer networks. Please refer to the Interview section. <../Intsec.htm> for more details. *

Profile

Since its inception in 1982, a singular vision - The Network Is The Computer(tm) - has propelled Sun Microsystems, Inc., to its position as a leading provider of industrial-strength hardware, software and services that power the Internet and allow companies worldwide to dot-com their businesses. With US$ 14.2 billion in annual revenues, Sun can be found in more than 170 countries. America Online acquires Netscape; Sun and AOL to accelerate the growth of ecommerce and develop next-generation Internet devices in a historic three-year alliance. Sun Microsystems, Inc. is a worldwide provider of products, services and support solutions for building and maintaining network computing environments. The Company sells scalable computer systems, high-speed microprocessors and high performance software for operating network computing equipment and storage products. The Company also provides support, education and professional services. The Company's products are used for many demanding commercial and technical applications in various industries including telecommunications, manufacturing, financial services, education, retail, government, energy and healthcare. In India, Sun Microsystems has been in the market for over a decade through its business partners and has been present directly for over three years. In this period Sun servers and workstation products have had a tremendous acceptance in the market. IDC rates Sun as the No. 1 vendor in India for the mid-range servers as well as Unix workstations. The company, which has changed its baseline from `The network is the computer' to `We are the dot in the .com' owes most of its 70 per cent growth over the previous year to the booming

dotcom business. It has established its state-of-the-art industrial and allied facility in Bangalore. Sun and its partners constitute a 400-strong team that supports an installed base of more than 15,000 systems. Some of Sun's customers in India include Texas Instruments, Veritas, Lucent Technologies, ICICI, VSNL, Silicon Automation Systems, Reliance Industries, IIT (Delhi, Kanpur and Kharagpur), Motorola, and Oracle. For more information about this company visit their homesite at www.sun.com <http://www.sun.com/>

SUN Sample Test Paper

1. For the following program. struct XXX {int a; float b; char *s; }X; If optimization :X not used in compiler then unused bits_________________. Give your assumption_______________. 2. Give the output of the following program struct XXX {int a:6; float b:4; char s; }structure; size of (structure); 3.Class used for the multiple inheritence in JAVA_________________ (a) anonymous class (b) inner class (c) abstreet class (d) none 4. XDR fixes in which part of OS1 stack. 5. LDAP is____________service protocol. 6. Given definition for a function which returns a array of pointers with argument of int*. 7. Give a function declaration with no arguments which refers a two dimensional array

8. Pick up the correct function declaration. 1. void *[] name(); 2. void int[][] name(); 3. void ** name(); 4. none of the above. 9. Give the difference between monolithic and microlithic kernal: a. monolithic large b. microlithic used in embedded systems. c. none. 10. rPC coresponds to_______________in OSI stack. 11. Find the no.of page faults using LRU stack. eg.3 4 4 6 7 8 1 2 .. .. 12.The inorder representation of a tree 41523 and preorder is 211513 Draw it? 13. When does a stack member will be initialised (a) when object is created (b) when object is initialised. (c) doesnot depend on object. (d) none. 14. Number of CPU in a multiprocess is contrassed by (a) RISC nohere of CPU (b) memory (c) both (a) and (b) (d) None of the above 15. Give the output of the following program main() {char *s; s="hot java"; strcpy(s,"solarrs java") } 16. Give the output of the following program main() {printf("hot java"); fork() exit(0); }

(i). When redirected to a screen what will be printed. (ii). When redirected to file what will be printed. 17. Give the output of the following program main() {int ret; ret=fork();ret=fork();ret=fork();ret=fork(); if(!ret) printf("sun"); else printf("solaris"); 18. Give the output of the following program main() {char *p='a'; int *i=100/*p; } what will be the value of *i= 1 19. Which data structure gives efficient search 1 B-tree 2 binary tree 3 array 4 linked list 20. Find the error in the following program struct point {struct point *next; int data; } x; main() {int i; for(x=p;x!=0;) x=x->next,x++; freelist(x); } freelist(x) {free(x); return }

21. Mutex and _________are similar locking mechanisms. 22. A complex question on pointers and functions. 23. SNMP and SMIP transport layer protocols for TCP/IP&OSI. 24 UNIX: difference between select and poll --End-RAMCO 'C' QUESTION PAPER

1). --------------------------------------------------------------

main() { char *p1="Name"; char *p2; p2=(char *)malloc(20); while(*p2++=*p1++); printf("%s\n",p2); }

Ans : An empty String

2).

main() { int x=20,y=35; x = y++ + x++; y = ++y + ++x; printf("%d %d\n",x,y); }

Ans 57 94

3).

main() { int x=5; printf("%d %d %d\n",x,x<<2,x>>2); }

Ans 5 20 1

4). #define swap1(a,b) a=a+b;b=a-b;a=a-b; main() { int x=5,y=10; swap1(x,y); printf("%d %d\n",x,y); swap2(x,y); printf("%d %d\n",x,y); }

int swap2(int a,int b) { int temp; temp=a; b=a; a=temp; return; }

Ans

10 5 10 5

5).

main() { char *ptr = "Ramco Systems"; (*ptr)++; printf("%s\n",ptr); ptr++; printf("%s\n",ptr); } Ans Samco Systems amco Systems

6).

#include<stdio.h> main() { char s1[]="Ramco"; char s2[]="Systems"; s1=s2; printf("%s",s1); }

Ans Compilation error giving it cannot be an modifible 'lvalue'

7).

#include<stdio.h> main() { char *p1; char *p2; p1=(char *) malloc(25); p2=(char *) malloc(25); strcpy(p1,"Ramco"); strcpy(p2,"Systems"); strcat(p1,p2); printf("%s",p1); }

Ans : RamcoSystems

8).

[1]. The following variable is available in file1.c

static int average_float;

Ans

all the functions in the file1.c can access the variable

9).

Ans :

[2]. extern int x;

Check the answer

10). [3]. Another Problem with

# define TRUE 0

some code

while(TRUE) { some code

This won't go into the loop as TRUE is defined as 0 Ans NONE OF THE ABOVE i.e D

11). Ans : [4]. A question in structures where the memebers are dd,mm,yy.

mm:dd:yy 09:07:97

12).

Ans : [5]. Another structure question

1 Rajiv System Analyst

13).

Answer

INFILE.DAT is copied to OUTFILE.DAT

14).

A question with argc and argv .

Input will be

c:\TEMP.EXE Ramco Systems India

Output will be

India: I n d i a

Systems: S y s t e m s Ramco: R a m c o

Answer is choice d

15).

Structure swap

Ramco India Ramco Systems Corporation Ramco ... Limited .

After swapping the result will be

First two will be swapped.

Ramco Systems Corporation Ramco India Ramco ... Limited .

16).

int x; main() { int x=0; { int x=10; x++; change_value(x); x++; Modify_value(); printf("First output: %d\n",x); } x++; change_value(x); printf("Second Output : %d\n",x); Modify_value(); printf("Third Output : %d\n",x); }

Modify_value() {

return (x+=10); }

change_value() { return(x+=1); }

Ans : 12

17).

main() { int x=10,y=15; x=x++;

y=++y; printf("%d %d\n",x,y); }

Ans : 11

16

18).

main() { int a=0; if(a=0) printf("Ramco Systems\n"); printf("Ramco Systems\n"); }

Ans : Ony one time "Ramco Systems" will be printed

siemens Information Systems Sample Test

1. Which of following operator can't be overloaded. a) == b) ++ c) ?! d) <=

2. For the following C program #include<iostream.h> main() {printf("Hello World");} The program prints Hello World without changing main() ,the output should be intialisation Hello World Desruct The changes should be a) IOstream operator<<(iostream os, char*s) os<<'intialisation'<<(Hello World)<<Destruct b) c) d) none of the above

3. CDPATH shell variable is in(c-shell)

4. The term stickily bit is related to a) Kernel b) Undeletable file c) Both (a) and (b) d) None

5. Semaphore variable is different from ordinary variable by

6. For the following C program: swap(int x,y) { int temp; temp=x; x=y; y=temp;} main() {int x=2;y=3; swap(x,y);} After calling swap, what are the values x & y?

7. Static variable will be visible in a) Function. in which they are defined b) Module in which they are defined

c) All the program d) None

8. Unix system is a) Multi processing b) Multi processing, multiuser c) Multi processing, multiuser, multitasking d) Multiuser, multitasking

9. X.25 protocol encapsulates the follwing layers a) Network b) Datalink c) Physical d) All of the above e) None of the above

10. TCP/IP can work on a) Ethernet b) Tokenring c) (a) & (b) d) None

11. A node has the IP address 138.50.10.7 and 138.50.10.9. But it is transmitting data from node1 to node 2only. The reason may be

a) A node cannot have more than one address b) class A should have second octet different c) class B should have second octed different d) All of the above

12. The OSI layer from bottom to top

13. For an application which exceeds 64k the memory model should be a) Medium b) Huge c) Large d) None

14. The condition required for dead lock in unix system is

15. Set-user-id is related to (in unix)

16. Bourne shell has a) History record****other choices not given

17. Which of the following is not true about C++ a) Code removably b) Encapsulation of data and code c) Program easy maintenance d) Program runs faster

18. For the following C program struct base {int a,b; base(); int virtual function1();} struct derv1:base {int b,c,d; derv1() int virtual function1();} struct derv2 : base {int a,e; } base::base() {a=2;b=3; } derv1::derv1() {b=5; c=10;d=11;} base::function1() {return(100); } derv1::function1() { return(200); }

main() base ba; derv1 d1,d2; printf("%d %d",d1.a,d1.b) Output of the program is: a) a=2;b=3; b) a=3; b=2; c) a=5; b=10; d) none

19. For the above program answer the following q's main() base da; derv1 d1; derv2 d2; printf("%d %d %d",da.function1(),d1.function1(),d2.function1()); Output is: a) 100,200,200; b) 200,100,200; c) 200,200,100; d) None of the above

20. For the following C program struct { int x;

int y; }abc; x cannot be accessed by the following 1)abc-->x; 2)abc[0]-->x; 3)abc.x; 4)(abc)-->x;

a )1, 2, 3 b) 2 & 3 c) 1 & 2 d) 1, 3, 4

21. Automatic variables are destroyed after fn. ends because a) Stored in swap b) Stored in stack and poped out after fn. returns c) Stored in data area d) Stored in disk

22. Relation between x-application and x-server (x-win)

23. What is UIL(user interface language) (x-win)

24)Which of the following is right in ms-windows

a) Application has single qvalue system has multiple qvalue b) Application has multiple qvalue system has single qvalue c) Application has multipleqvalue system has multiple qvalue d) None

25. Widget in x-windows is

26. Gadget in x_windows is

27. Variable DESTDIR in make program is accessed as a) $(DESTDIR) b) ${DESTDIR} c) DESTDIR

28. The keystroke mouse entrie are interpreted in ms windows as a) Interrupt b) Message c) Event d) None of the above

29. Link between program and outside world (ms -win) a) Device driver and hardware disk b) Application and device driver c) Application and hardware device d) None

30. Ms -windows is a)multitasking b)multiuser c) bothof the above d) none of the above

31. Dynamic scoping is

32. After logout the process still runs in the background by giving the command

33. Which process dies out but still waits a) Exit b) Wakeup c) Zombie d) Sleep

34. In dynamic memory allocation we use a) Doubly linked list b) Circularly linked c) B trees d) L trees e) None

35. To find the key of search the data structure is a) Hash key b) Trees c) Linked lists d) Records

36. Which of the following is true a) Bridge connects dissimiler LANand protocol insensitive b) Router connects dissimiler LANand protocol insensitive c) Gateway connects dissimiler LANand protocol insensitive d) None of the above

37. Read types of tree traversals.

38. Read about SQL/Databases

39.A DBMS table is given along with simple SQL statements. Find the output.

40. Simple programs on pointers in c

SQL

1. Which is the subset of SQL commands used to manipulate Oracle Database structures, including tables?

Data Definition Language (DDL)

2. What operator performs pattern matching? LIKE operator

3. What operator tests column for the absence of data? IS NULL operator

4. Which command executes the contents of a specified file? START <filename> or @<filename>

5. What is the parameter substitution symbol used with INSERT INTO command? &

6. Which command displays the SQL command in the SQL buffer, and then executes it? RUN

7. What are the wildcards used for pattern matching? _ for single character substitution and % for multi-character substitution

8. State true or false. EXISTS, SOME, ANY are operators in SQL. True

9. State true or false. !=, <>, ^= all denote the same operation. True

10. What are the privileges that can be granted on a table by a user to others? Insert, update, delete, select, references, index, execute, alter, all

11. What command is used to get back the privileges offered by the GRANT command? REVOKE

12. Which system tables contain information on privileges granted and privileges obtained? USER_TAB_PRIVS_MADE, USER_TAB_PRIVS_RECD

13. Which system table contains information on constraints on all the tables created? USER_CONSTRAINTS

14.

TRUNCATE TABLE EMP; DELETE FROM EMP;

Will the outputs of the above two commands differ? Both will result in deleting all the rows in the table EMP.

15. What is the difference between TRUNCATE and DELETE commands? TRUNCATE is a DDL command whereas DELETE is a DML command. Hence DELETE operation can be rolled back, but TRUNCATE operation cannot be rolled back. WHERE clause can be used with DELETE and not with TRUNCATE.

16. What command is used to create a table by copying the structure of another table? Answer : CREATE TABLE .. AS SELECT command Explanation : To copy only the structure, the WHERE clause of the SELECT command should contain a FALSE statement as in the following. CREATE TABLE NEWTABLE AS SELECT * FROM EXISTINGTABLE WHERE 1=2; If the WHERE condition is true, then all the rows or rows satisfying the condition will be copied to the new table.

17. What will be the output of the following query? SELECT REPLACE(TRANSLATE(LTRIM(RTRIM('!! '**'),'*','TROUBLE') FROM DUAL; TROUBLETHETROUBLE

ATHEN

!!','!'),

'!'),

'AN',

18. What will be the output of the following query? SELECT DECODE(TRANSLATE('A','1234567890','1111111111'), '1','YES', 'NO' ); Answer : NO Explanation : The query checks whether a given string is a numerical digit.

19. What does the following query do? SELECT SAL + NVL(COMM,0) FROM EMP; This displays the total salary of all employees. The null values in the commission column will be replaced by 0 and added to salary.

20. Which date function is used to find the difference between two dates? MONTHS_BETWEEN

21. Why does the following command give a compilation error? DROP TABLE &TABLE_NAME; Variable names should start with an alphabet. Here the table name starts with an '&' symbol.

22. What is the advantage of specifying WITH GRANT OPTION in the GRANT command? The privilege receiver can further grant the privileges he/she has obtained from the owner to any other user.

23. What is the use of the DROP option in the ALTER TABLE command? It is used to drop constraints specified on the table.

24. What is the value of comm and sal after executing the following query if the initial value of sal is 10000? UPDATE EMP SET SAL = SAL + 1000, COMM = SAL*0.1; sal = 11000, comm = 1000

25. What is the use of DESC in SQL? Answer : DESC has two purposes. It is used to describe a schema as well as to retrieve rows from table in descending order. Explanation : The query SELECT * FROM EMP ORDER BY ENAME DESC will display the output sorted on ENAME in descending order.

26. What is the use of CASCADE CONSTRAINTS? When this clause is used with the DROP command, a parent table can be dropped even when a child table exists.

27. Which function is used to find the largest integer less than or equal to a specific value? FLOOR

28. What is the output of the following query? SELECT TRUNC(1234.5678,-2) FROM DUAL; 1200

SQL QUERIES I. SCHEMAS

Table 1 : STUDIES

PNAME (VARCHAR), SPLACE (VARCHAR), COURSE (VARCHAR), CCOST (NUMBER)

Table 2 : SOFTWARE

PNAME (VARCHAR), TITLE (VARCHAR), DEVIN (VARCHAR), SCOST (NUMBER), DCOST (NUMBER), SOLD (NUMBER)

Table 3 : PROGRAMMER

PNAME (VARCHAR), DOB (DATE), DOJ (DATE), SEX (CHAR), PROF1 (VARCHAR), PROF2 (VARCHAR), SAL (NUMBER)

LEGEND :

PNAME Programmer Name, SPLACE Study Place, CCOST Course Cost, DEVIN Developed in, SCOST Software Cost, DCOST Development Cost, PROF1 Proficiency 1

QUERIES :

1. Find out the selling cost average for packages developed in Oracle. 2. Display the names, ages and experience of all programmers. 3. Display the names of those who have done the PGDCA course. 4. What is the highest number of copies sold by a package? 5. Display the names and date of birth of all programmers born in April. 6. Display the lowest course fee. 7. How many programmers have done the DCA course. 8. How much revenue has been earned through the sale of packages developed in C. 9. Display the details of software developed by Rakesh. 10. How many programmers studied at Pentafour. 11. Display the details of packages whose sales crossed the 5000 mark. 12. Find out the number of copies which should be sold in order to recover the development cost of each package. 13. Display the details of packages for which the development cost has been recovered. 14. What is the price of costliest software developed in VB? 15. How many packages were developed in Oracle ? 16. How many programmers studied at PRAGATHI? 17. How many programmers paid 10000 to 15000 for the course? 18. What is the average course fee? 19. Display the details of programmers knowing C. 20. How many programmers know either C or Pascal? 21. How many programmers dont know C and C++? 22. How old is the oldest male programmer? 23. What is the average age of female programmers? 24. Calculate the experience in years for each programmer and display along with their names in descending order. 25. Who are the programmers who celebrate their birthdays during the current month? 26. How many female programmers are there? 27. What are the languages known by the male programmers? 28. What is the average salary? 29. How many people draw 5000 to 7500? 30. Display the details of those who dont know C, C++ or Pascal. 31. Display the costliest package developed by each programmer. 32. Produce the following output for all the male programmers Programmer Mr. Arvind has 15 years of experience

KEYS: 1. SELECT AVG(SCOST) FROM SOFTWARE WHERE DEVIN = 'ORACLE';

2. SELECT PNAME,TRUNC(MONTHS_BETWEEN(SYSDATE,DOB)/12) "AGE", TRUNC(MONTHS_BETWEEN(SYSDATE,DOJ)/12) "EXPERIENCE" FROM PROGRAMMER; 3. SELECT PNAME FROM STUDIES WHERE COURSE = 'PGDCA'; 4. SELECT MAX(SOLD) FROM SOFTWARE; 5. SELECT PNAME, DOB FROM PROGRAMMER WHERE DOB LIKE '%APR%'; 6. SELECT MIN(CCOST) FROM STUDIES; 7. SELECT COUNT(*) FROM STUDIES WHERE COURSE = 'DCA'; 8. SELECT SUM(SCOST*SOLD-DCOST) FROM SOFTWARE GROUP BY DEVIN HAVING DEVIN = 'C'; 9. SELECT * FROM SOFTWARE WHERE PNAME = 'RAKESH'; 10. SELECT * FROM STUDIES WHERE SPLACE = 'PENTAFOUR'; 11. SELECT * FROM SOFTWARE WHERE SCOST*SOLD-DCOST > 5000; 12. SELECT CEIL(DCOST/SCOST) FROM SOFTWARE; 13. SELECT * FROM SOFTWARE WHERE SCOST*SOLD >= DCOST; 14. SELECT MAX(SCOST) FROM SOFTWARE GROUP BY DEVIN HAVING DEVIN = 'VB'; 15. SELECT COUNT(*) FROM SOFTWARE WHERE DEVIN = 'ORACLE'; 16. SELECT COUNT(*) FROM STUDIES WHERE SPLACE = 'PRAGATHI'; 17. SELECT COUNT(*) FROM STUDIES WHERE CCOST BETWEEN 10000 AND 15000; 18. SELECT AVG(CCOST) FROM STUDIES; 19. SELECT * FROM PROGRAMMER WHERE PROF1 = 'C' OR PROF2 = 'C'; 20. SELECT * FROM PROGRAMMER WHERE PROF1 IN ('C','PASCAL') OR PROF2 IN ('C','PASCAL'); 21. SELECT * FROM PROGRAMMER WHERE PROF1 NOT IN ('C','C++') AND PROF2 NOT IN ('C','C++'); 22. SELECT TRUNC(MAX(MONTHS_BETWEEN(SYSDATE,DOB)/12)) FROM PROGRAMMER WHERE SEX = 'M'; 23. SELECT TRUNC(AVG(MONTHS_BETWEEN(SYSDATE,DOB)/12)) FROM PROGRAMMER WHERE SEX = 'F'; 24. SELECT PNAME, TRUNC(MONTHS_BETWEEN(SYSDATE,DOJ)/12) FROM PROGRAMMER ORDER BY PNAME DESC; 25. SELECT PNAME FROM PROGRAMMER WHERE TO_CHAR(DOB,'MON') = TO_CHAR(SYSDATE,'MON'); 26. SELECT COUNT(*) FROM PROGRAMMER WHERE SEX = 'F'; 27. SELECT DISTINCT(PROF1) FROM PROGRAMMER WHERE SEX = 'M'; 28. SELECT AVG(SAL) FROM PROGRAMMER; 29. SELECT COUNT(*) FROM PROGRAMMER WHERE SAL BETWEEN 5000 AND 7500; 30. SELECT * FROM PROGRAMMER WHERE PROF1 NOT IN ('C','C++','PASCAL') AND PROF2 NOT IN ('C','C++','PASCAL'); 31. SELECT PNAME,TITLE,SCOST FROM SOFTWARE WHERE SCOST IN (SELECT MAX(SCOST) FROM SOFTWARE GROUP BY PNAME); 32.SELECT 'Mr.' || PNAME || ' - has ' || TRUNC(MONTHS_BETWEEN(SYSDATE,DOJ)/12) || ' years of experience' Programmer FROM PROGRAMMER WHERE SEX = 'M' UNION SELECT 'Ms.' || PNAME || ' - has ' || TRUNC (MONTHS_BETWEEN

(SYSDATE,DOJ)/12) || ' years of experience' Programmer FROM PROGRAMMER WHERE SEX = 'F';

II . SCHEMA :

Table 1 : DEPT

DEPTNO (NOT NULL , NUMBER(2)), DNAME (VARCHAR2(14)), LOC (VARCHAR2(13)

Table 2 : EMP

EMPNO (NOT NULL , NUMBER(4)), ENAME (VARCHAR2(10)), JOB (VARCHAR2(9)), MGR (NUMBER(4)), HIREDATE (DATE), SAL (NUMBER(7,2)), COMM (NUMBER(7,2)), DEPTNO (NUMBER(2))

MGR is the empno of the employee whom the employee reports to. DEPTNO is a foreign key. QUERIES

1. List all the employees who have at least one person reporting to them. 2. List the employee details if and only if more than 10 employees are present in department no 10. 3. List the name of the employees with their immediate higher authority. 4. List all the employees who do not manage any one. 5. List the employee details whose salary is greater than the lowest salary of an employee belonging to deptno 20. 6. List the details of the employee earning more than the highest paid manager. 7. List the highest salary paid for each job. 8. Find the most recently hired employee in each department.

9. In which year did most people join the company? Display the year and the number of employees. 10. Which department has the highest annual remuneration bill? 11. Write a query to display a * against the row of the most recently hired employee. 12. Write a correlated sub-query to list out the employees who earn more than the average salary of their department. 13. Find the nth maximum salary. 14. Select the duplicate records (Records, which are inserted, that already exist) in the EMP table. 15. Write a query to list the length of service of the employees (of the form n years and m months). KEYS:

1. SELECT DISTINCT(A.ENAME) FROM EMP A, EMP B WHERE A.EMPNO = B.MGR; or SELECT ENAME FROM EMP WHERE EMPNO IN (SELECT MGR FROM EMP); 2. SELECT * FROM EMP WHERE DEPTNO IN (SELECT DEPTNO FROM EMP GROUP BY DEPTNO HAVING COUNT(EMPNO)>10 AND DEPTNO=10); 3. SELECT A.ENAME "EMPLOYEE", B.ENAME "REPORTS TO" FROM EMP A, EMP B WHERE A.MGR=B.EMPNO; 4. SELECT * FROM EMP WHERE EMPNO IN ( SELECT EMPNO FROM EMP MINUS SELECT MGR FROM EMP); 5. SELECT * FROM EMP WHERE SAL > ( SELECT MIN(SAL) FROM EMP GROUP BY DEPTNO HAVING DEPTNO=20); 6. SELECT * FROM EMP WHERE SAL > ( SELECT MAX(SAL) FROM EMP GROUP BY JOB HAVING JOB = 'MANAGER' ); 7. SELECT JOB, MAX(SAL) FROM EMP GROUP BY JOB; 8. SELECT * FROM EMP WHERE (DEPTNO, HIREDATE) IN (SELECT DEPTNO, MAX(HIREDATE) FROM EMP GROUP BY DEPTNO); 9. SELECT TO_CHAR(HIREDATE,'YYYY') "YEAR", COUNT(EMPNO) "NO. OF EMPLOYEES" FROM EMP GROUP BY TO_CHAR(HIREDATE,'YYYY') HAVING COUNT(EMPNO) = (SELECT MAX(COUNT(EMPNO)) FROM EMP GROUP BY TO_CHAR(HIREDATE,'YYYY')); 10. SELECT DEPTNO, LPAD(SUM(12*(SAL+NVL(COMM,0))),15) "COMPENSATION" FROM EMP GROUP BY DEPTNO HAVING SUM( 12*(SAL+NVL(COMM,0))) = (SELECT MAX(SUM(12*(SAL+NVL(COMM,0)))) FROM EMP GROUP BY DEPTNO); 11. SELECT ENAME, HIREDATE, LPAD('*',8) "RECENTLY HIRED" FROM EMP WHERE HIREDATE = (SELECT MAX(HIREDATE) FROM EMP) UNION SELECT ENAME NAME, HIREDATE, LPAD(' ',15) "RECENTLY HIRED" FROM EMP WHERE HIREDATE != (SELECT MAX(HIREDATE) FROM EMP); 12. SELECT ENAME,SAL FROM EMP E WHERE SAL > (SELECT AVG(SAL) FROM EMP F WHERE E.DEPTNO = F.DEPTNO); 13. SELECT ENAME, SAL FROM EMP A WHERE &N = (SELECT COUNT (DISTINCT(SAL)) FROM EMP B WHERE A.SAL<=B.SAL);

14. SELECT * FROM EMP A WHERE A.EMPNO IN (SELECT EMPNO FROM EMP GROUP BY EMPNO HAVING COUNT(EMPNO)>1) AND A.ROWID!=MIN (ROWID)); 15. SELECT ENAME "EMPLOYEE",TO_CHAR(TRUNC(MONTHS_BETWEEN(SYSDATE,HIREDATE)/12))||' YEARS '|| TO_CHAR(TRUNC(MOD(MONTHS_BETWEEN (SYSDATE, HIREDATE),12)))||' MONTHS ' "LENGTH OF SERVICE" FROM EMP;

section 3:: 1.Max value of SIGNED int a. b. c. d. 2.One questin is given, long one, to find the answer U should be femiliar with the operation as follows int *num={10,1,5,22,90}; main() { int *p,*q; int i; p=num; q=num+2; i=*p++; print the value of i, and q-p, and some other operations are there. } how the values will change?? 3. One pointer diff is given like this:

int *(*p[10])(char *, char*) asked to find the meaning. 4. char *a[4]={"jaya","mahe","chandra","buchi"}; what is the value of sizeof(a)/sizeof(char *) a. 4 b.bytes for char c-- d.-( we don't know the answer) 5. void fn(int *a, int *b) { int *t; t=a; a=b; b=t; } main() { int a=2; int b=3; fn(&a,&b); print the values os a and b; } what is the output--- out put won't swap, the same values remain. a. error at runtime b. compilation error

c.2 3 d. 3 2 6. #define scanf "%s is a string" main() { printf(scanf,scanf); } what is the output. ANS : %s is string is string 7. i=2+3,4>3,1; printf("%d"i); ans is 5 only. 8. char *p="abc"; char *q="abc123"; while(*p=*q) { print("%c %c",*p,*q); } a. aabbcc b. aabbcc123 c. abcabc123 d. infinate loop ( this may be correct)

9. printf("%u",-1) what is the value? a. -1 b. 1 c. 65336 d. --

(maxint value-1 I think, check for the answer) 10. #define void int int i=300; void main(void) { int i=200; { int i=100; print the value of i; } print the value of i } what is the output?

may be 100 200 11. int x=2; x=x<<2; printf("%d ",x);

ANS=8; 12. int a[]={0,0X4,4,9}; /*some values are given*/ int i=2; printf("%d %d",a[i],i[a]); what is the value??? (may be error) 13. some other program is given , I can't remember it U can get it afterwads, the answer is 3 3, so U can check this in the exam. itself. I'll send the remaining two afterwars whenever I get them. OK !

TataConsultancyServicesCSample Test

Thistestconsistsof50questions.TheSetCodeforthispaperisD. 1.TheClanguageterminatoris (a)semicolon (b)colon (c)period (d)exclamationmark 2.WhatisfalseaboutthefollowingAcompoundstatementis

(a)Asetofsimplestatments (b)Demarcatedoneithersidebycurlybrackets (c)Canbeusedinplaceofsimplestatement (d)ACfunctionisnotacompoundstatement. 3.WhatistrueaboutthefollowingCFunctions (a)Neednotreturnanyvalue (b)Shouldalwaysreturnaninteger (c)Shouldalwaysreturnafloat (d)Shouldalwaysreturnmorethanonevalue 4.Mainmustbewrittenas (a)Thefirstfunctionintheprogram (b)Secondfunctionintheprogram (c)Lastfunctionintheprogram (d)Anywhereintheprogram 5.Whichofthefollowingaboutautomaticvariableswithinafunctioniscorrect? (a)Itstypemustbedeclaredbeforeusingthevariable (b)Ttheyarelocal (c)Theyarenotinitialisedtozero (d)Theyareglobal 6.Writeonestatementequivalenttothefollowingtwostatements x=sqr(a); return(x); Choosefromoneofthealternatives (a)return(sqr(a)); (b)printf("sqr(a)"); (c)return(a*a*a); (d)printf("%d",sqr(a));

 7.WhichofthefollowingabouttheCcommentsisincorrect? (a)Ccommentscangoovermultiplelines (b)Commentscanstartanywhereintheline (c)Alinecancontaincommentswithoutanylanguagestatements (d)Commentscanoccurwithincomments 8.Whatisthevalueofyinthefollowingcode? x=7; y=0; if(x=6)y=7; elsey=1; (a)7 (b)0 (c)1 (d)6 9.Readthefunctionconv()givenbelow conv(intt){ intu; u=5/9*(t32); return(u); } Whatisreturned (a)15 (b)0 (c)16.1 (d)29 10.Whichofthefollowingrepresentstruestatementeitherxisintherangeof10and50oryiszero (a)x>=10&&x<=50||y==0 (b)x<50 (c)y!=10&&x>=50 (d)Noneofthese

 11.Whichofthefollowingisnotaninfiniteloop? (a)while(1)\{....} (b)for(;;) { ... } (c)x=0; do{ /*xunalteredwithintheloop*/ .....} while(x==0); (d)#defineTRUE0 ... while(TRUE){ ....} 12.Whatdoesthefollowingfunctionprint? func(inti) {if(i%2)return0; elsereturn1;} main() { int=3; i=func(i); i=func(i); printf("%d",i); } (a)3 (b)1 (c)0 (d)2 13.HowdoestheCcompilerinterpretthefollowingtwostatements

p=p+x; q=q+y; (a)p=p+x; q=q+y (b)p=p+xq=q+y (c)p=p+xq; q=q+y (d)p=p+x/q=q+y Forquestions14,15,16,17usethefollowingalternatives a.int b.char c.string d.float 14.'9' 15."1e02" 16.10e05 17.15 18.Readthefolllowingcode #defineMAX100 #defineMIN100 .... .... if(x>MAX) x=1; elseif(x<MIN) x=1; x=50; iftheinitialvalueofx=200,whatisthevalueafterexecutingthiscode?

(a)200 (b)1 (c)1 (d)50 19.Amemoryof20bytesisallocatedtoastringdeclaredaschar*s thenthefollowingtwostatementsareexecuted: s="Entrance" l=strlen(s); whatisthevalueofl? (a)20 (b)8 (c)9 (d)21 20.Giventhepieceofcode inta[50]; int*pa; pa=a; Toaccessthe6thelementofthearraywhichofthefollowingisincorrect? (a)*(a+5) (b)a[5] (c)pa[5] (d)*(*pa+5} 21.Considerthefollowingstructure: structnumnam{ intno; charname[25]; } structnumnamn1[]={{12,"Fred"},{15,"Martin"},{8,"Peter"},{11,Nicholas"}}; .....

..... printf("%d%d",n1[2],no,(*(n1+2),no)+1); Whatdoestheabovestatementprint? (a)8,9 (b)9,9 (c)8,8 (d)8,unpredictablevalue 22.Identifytheincorrectexpression (a)a=b=3=4; (b)a=b=c=d=0; (c)floata=intb=3.5; (d)inta;floatb;a=b=3.5; 23.Regardingthescopeofthevaribles;identifytheincorrectstatement: (a)automaticvariablesareautomaticallyinitialisedto0 (b)staticvariablesareareautomaticallyinitialisedto0 (c)theaddressofaregistervariableisnotaccessiable (d)staticvariablescannotbeinitialisedwithanyexpression 24.cond1?cond2?cond3?:exp1:exp2:exp3:exp4; isequivalenttowhichofthefollowing? (a)ifcond1 exp1; elseifcond2 exp2; elseifcond3 exp3; elseexp4; (b)ifcond1 ifcond2 ifcond3 exp1;

elseexp2; elseexp3; elseexp4; (c)ifcond1&&cond2&&cond3 exp1|exp2|exp3|exp4; (d)ifcond3 exp1; elseifcond2exp2; elseifcond3exp3; elseexp4; 25.Theoperatorforexponencationis (a)** (b)^ (c)% (d)notavailable 26.Whichofthefollowingisinvalid (a)a+=b (b)a*=b (c)a>>=b (d)a**=b 27.Whatisyvalueofthecodeifinputx=10 y=5; if(x==10) elseif(x==9) elsey=8; (a)9 (b)8 (c)6 (d)7

 28.Whatdoesthefollowingcodedo? fn(intn,intp,intr){ staticinta=p; switch(n){ case4:a+=a*r; case3:a+=a*r; case2:a+=a*r; case1:a+=a*r;}} (a)computessimpleinterestforoneyear (b)computesamountoncompoundinterestfor1to4years (c)computessimpleinterestforfouryear (d)computescompoundinterstfor1year 29.a=0; while(a<5) printf("%d\\n",a++); Howmanytimesdoestheloopoccurs? (a)infinite (b)5 (c)4 (d)6 30.Howmanytimesdoestheloopiterated? for(i=0;i=10;i+=2) printf("Hi\\n"); (a)10 (b)2 (c)5 (d)Noneofthese 31.Whatisincorrectamongthefollowing Arecursivefunction

(a)callsitself (b)isequivalenttoaloop (c)hasaterminationcondition (d)doesnothaveareturnvalueatall 32.Whichofthefollowinggooutoftheloopifexpn2becomingfalse (a)while(expn1)\{...if(expn2)continue;} (b)while(!expn1)\{if(expn2)continue;...} (c)do{..if(expn1)continue;..}while(expn2); (d)while(!expn2)\{if(expn1)continue;..\} 33.Considerthefollowingprogram main() {unsignedinti=10; while(i>=0){ printf("%u",i) i;} } Howmanytimestheloopwillgetexecuted (a)10 (b)9 (c)11 (d)infinite 34.Pickouttheaddoneout (a)malloc() (b)calloc() (c)free() (d)realloc() 35.Considerthefollowingprogram

main(){ inta[5]={1,3,6,7,0}; int*b; b=&a[2]; } Thevalueofb[1]is (a)1 (b)3 (c)6 (d)none 36.#defineprod(a,b)=a*b main(){ intx=2; inty=3; printf("%d",prod(x+2,y10));} theoutputoftheprogramis (a)8 (b)6 (c)7 (d)None 37.Considerthefollowingprogramsegment intn,sum=1; switch(n){ case2:sum=sum+2; case3:sum*=2; break; default:sum=0;} Ifn=2,whatisthevalueofsum (a)0 (b)6 (c)3 (d)Noneofthese

 38.Identifytheincorrectone 1.if(c=1) 2.if(c!=3) 3.if(a<b)then 4.if(c==1) (a)1only (b)1&3 (c)3only (d)Alloftheabove 39.Theformatspecifiedforhexadecimalis (a)%d (b)%o (c)%x (d)%u 40.Findtheoutputofthefollowingprogram main(){ intx=5,*p; p=&x printf("%d",++*p); } (a)5 (b)6 (c)0 (d)noneofthese 41.ConsiderthefollowingCcode main(){ inti=3,x; while(i>0){

x=func(i); i;} intfunc(intn){ staticsum=0; sum=sum+n; return(sum);} Thefinalvalueofxis (a)6 (b)8 (c)1 (d)3 43.Int*a[5]refersto (a)arrayofpointers (b)pointertoanarray (c)pointertoapointer (d)noneofthese 44.Whichofthefollowingstatementsisincorrect (a)typedefstructnew{ intn1; charn2; }DATA; (b)typedefstruct{ intn3; char*n4;}ICE; (c)typedefunion{intn5; floatn6;}UDT; (d)#typedefunion{ intn7; floatn8;}TUDAT;

M.B.T:paper pattern only

__________________________ Section-1. Passage (10 min reading ,5 questions) Section-2. English (error finding,15 questions) Section-3. Number series (Letter series also) Section-4. Analytical ability (5 questions) Section-5 Numerical ability (additions,multiplications etc) note: -marking 1:1 Intergraph:paper pattern only ________________________________ Analytical. 1.seating arrangement 2.Inferences (Ref. GRE book) C-language. 48 questions - 45 min. 1. Diff.between inlinefunction((++)-macns(c) 2. 3 to 4 questions on conditional operator :?: 3. Write a macro for sqaring no. 4. Trees -3 noded tree ( 4 to 5 questions fundamentals) Maximum possible no.of arrnging these nodes 5. Arrange the nodes in depth first order breadth first order 6. Linked lists Q) Given two statments 1. Allocating memory dynamiccaly 2. Arrays

Tree the above both and find the mistake 7. Pointers (7 to 8 questions) Schaum series Pointer to functions, to arrays 4 statements ->meaning,syntax for another 4 statements 8. Booting-def(When you on the system the process that takes place is -----9. -----Type of global variable can be accessible from any where in the working environment ( external global variable) 10. Which of the following can be accessed randomly Ans. a. one way linked list b. two way " c. Arrays d. Trees 11. Write a class for a cycle purchase(data items req.)

Novell network paper The paper consists os three sections. 1. aptitude 15 questions 20 min. 2. system concepts 20 questions 20 min. 3. 'c' 15 questions 20 min. NOTE::::: I'm sendin the questions, somany have no answers. U do check the answers for all the given questions also. All questions are MULTIPLE CHOICES ONLY.

U do try to cover the related topics to get some understanding. In interview They are asking C C++ Operating system concepts and Networks. They will ask about Ur interesting subjects, U try to have good grip on those intresting subjects. They selected 11 out of 55 students. They asked about c c++ project work and OS,NETWORKS. But they selected only 2 , one from CS and another is BTech ECE.

SECTION 1 is main factor selection to the interview

-------------------------------------------------------------In the interveiw you should be very active .And should be frank to say no also.One CS student said that he don't know NETWORK and he hasn't taken NETWORKS subject.But he has selected. OK BEST OF LUCK.

section 1::::; *. GRE book test paper 3 section 5 question no. 8 to 12 (ships WXYZ starting on dec. 23rd..........)

* 5 programs are sheduled from monday to saterday, monday is not holiday,

PQRST are the programs. Theday before P is holiday, and some other clues are given, we have to find the sequence (4 questions) ANS: tuesday is the holiday P comes on wednesday , U can do the remaining very easily. * Suppose U R the presoner, There are two guards Who will tell truth or one will tell truth. There is a gate for liberty and another foe hell. Some questions are given, like i. are U tell truth? ii. another tell truth or not?? iii. both of U R telling truth?? iV. both of U lieing?? V. --------------

they gave a. b. c. d. and asking about which sequencing is sufficient to find the gate for liberty?? ( I can't give exact thing) * There are WIFE and HUSBAND at one side of river. They have one child, They want to cross the river. The child can't be lonly. The boat boy won't permit morethan one to cross the river, what is the correct way to

cross the river?? * There are 7 targets, A B and C has to shoot them. All should be shooted consicutively. 1. The no. of chances for A and B are not less thn 2, 2. for C there is only one chance. 3. A can't shot 3 times consicutively. 4. B is permited to shoot in even chances only. They have given some 3or 4 questions on this * --------------------------------------------------------------------------------------------------------------------------------------------------------

14.

SATYAM COMPUTERS (HYDERABAD) ---------------------------Release : 1997 ---------

ANTONYMS --------1)disregarded A) heed 2) GRE book pg no. 407 q.no. 13-16 para ie:in a certain society.... 3)GRE .............446, 8th quest A) 1 4)GRE..............487, 8th..... 5).................488, 14th...... 6).................513, 4 &8 ..... 7) if A+B+C+D is a +ve no's then a) one must be +ve no's b) two .............. c)three ............. d)all ................ 8) GRE pg no.586 32nd qst. 9)if x+y =3 and y/x=2 then y= a)0 b) 1/2 c)1 d)3/2 e)2 17) how many squares with sides 1/2 inch long are needed to cover a rectangle that is 4 feet long & 6feet wide a)24 b)96 c)3456 d)13824 e)14266 18)GMAT pg.no. 439 passage 1 with question 1to9 on pg.440-441 excluding qst.no.2 GMAT pg.442 passage. 2 excluding q.nos.11, 15. 20) successive discounts of 20% and 15% are equal to a single

discount of ; a)30% b) 32% c)34% d) 35% e)36% ans) 32% if x/y =4 and y is not '0' what % of 'x' is '2x-y' ans:175% if x=y=2z and xyz =256 then x= ans: 8 23)if 2x-y=4 then 6x-y is ans:12
-------------------------------------------------------------------------

SIEMENS INFO THIS PAPER CONSISTS 6 PARTS. all are multiple choice q's 1)general 2)c/unix 3)c++/motif 4)database 5)x-windows 6)ms-windows we have written q's not acc. to each part.total 50. q's. time is sufficient. if u have basic idea about all of the u can easily answer the paper. paper -----1)which of following operator can't be overloaded. a)== b)++ c)?! d)<=

2)#include<iostream.h> main() { printf("Hello World"); } the program prints Hello World without changing main() the o/p should be intialisation Hello World Desruct the changes should be a)iostream operator<<(iostream os, char*s) os<<'intialisation'<<(Hello World)<<Destruct b) c) d)none of the above 3)CDPATH shell variable is in(c-shell) a) b) c) d) 4) term stickily bit is related to a)kernel b)undeletable file c) d)none 5)semaphore variable is different from ordinary variable by 6)swap(int x,y) { int temp;

temp=x; x=y; y=temp; } main() { int x=2;y=3; swap(x,y); } after calling swap ,what are yhe values x&y? 7) static variable will be visible in a)fn. in which they are defined b)module " " " " c)all the program d)none 8)unix system is a)multi processing b)multi processing ,multiuser c)multi processing ,multiuser,multitasking d)multiuser,multitasking 9)x.25 protocol encapsulates the follwing layers a)network b)datalink

c)physical d)all of the above e)none of the above 10)TCP/IP can work on a)ethernet b)tokenring c)a&b d)none 11)a node has the ip address 138.50.10.7 and 138.50.10.9.But it is transmitting data from node1 to node2only. The reason may be a)a node cannot have more than one address b)class A should have second octet different c)classB " " " " " d)a,b,c 12) the OSI layer from bottom to top 13)for an application which exceeds 64k the memory model should be a)medium b)huge c)large d)none 14)the condition required for dead lock in unix sustem is 15)set-user-id is related to (in unix) 16) bourne shell has

a)history record b) c) d) 17)wrong statement about c++ a)code removably b)encapsulation of data and code c)program easy maintenance d)program runs faster 18)struct base {int a,b; base(); int virtual function1(); } struct derv1:base{ int b,c,d; derv1() int virtual function1(); } struct derv2 : base {int a,e; } base::base() {

a=2;b=3; } derv1::derv1(){ b=5; c=10;d=11;} base::function1() {return(100); } derv1::function1() { return(200); } main() base ba; derv1 d1,d2; printf("%d %d",d1.a,d1.b) o/p is a)a=2;b=3; b)a=3; b=2; c)a=5; b=10; d)none 19) for the above program answer the following q's main()

base da; derv1 d1; derv2 d2; printf("%d %d %d",da.function1(),d1.function1(),d2.function1()); o/p is a)100,200,200; b)200,100,200; c)200,200,100; d)none 20)struct { int x; int y; }abc; you can not access x by the following 1)abc-->x; 2)abc[0]-->x; abc.x; (abc)-->x; a)1,2,3 b)2&3 c)1&2 d)1,3,4 21) automatic variables are destroyed after fn. ends because

a)stored in swap b)stored in stack and poped out after fn. returns c)stored in data area d)stored in disk 22) relation between x-application and x-server (x-win) 23)UIL(user interface language) (x-win) 24)which is right in ms-windows a)application has single qvalue system has multiple qvalue b) " multiple " " single " c)" " " multiple " d)none 25)widget in x-windows is 26)gadget in x_windows is 27)variable DESTDIR in make program is accessed as a)$(DESTDIR) b)${DESTDIR} c)DESTDIR d)DESTDIR 28)the keystroke mouse entrie are interpreted in ms windows as a)interrupt b)message c)event d)none of the above

29)link between program and out side world (ms -win) a)device driver and hardware disk b)application and device driver c)application and hardware device d)none 30)ms -windows is a)multitasking b) c) d) 31)dynimic scoping is 32) after logout the process still runs in the background by giving the command a)nohop b) 33)process dies out but still waita a)exit b)wakeup c)zombie d)steep 34)in dynamic memory allocation we use a)doubly linked list b)circularly linked c)B trees d)L trees

e)none 35)to find the key of search the data structure is a)hask key b)trees c)linked lists d)records 36)data base --------------------------------------------------------employ_code salary employ_code leave -----------------------------------------------------------from to -------------------------------------1236 1500 1238 --- --1237 2000 1238 --- --1238 2500 1237 ------1237 --- --1237 --- --1237 --- ---------------------------- ------------------------------------select employ_code,employ_data ,leave

the number of rows in the o/p a)18 b)6 c)7 d)3 37)DBMS 38)read about SQL,db 39)which is true a)bridge connects dissimiler LANand protocol insensitive b)router " " " " " c)gateway " " " " " d)none of the above 40)read types of tree traversals. 41)42)43) simple programs on pointers in c

UNIX Concepts
SECTIONI FILEMANAGEMENTINUNIX

1. HowaredevicesrepresentedinUNIX?
Alldevicesarerepresentedbyfilescalledspecialfilesthatarelocatedin/devdirectory. Thus, device files and other files are named and accessed in the same way. A 'regular file' is just an ordinarydatafileinthedisk.A'blockspecialfile'representsadevicewithcharacteristicssimilartoadisk (data transfer in terms of blocks). A 'character special file' represents a device with characteristics similartoakeyboard(datatransferisbystreamofbitsinsequentialorder).

2. Whatis'inode'?
All UNIX files have its description stored in a structure called 'inode'. The inode contains info about the filesize, its location, time of last access, time of last modification, permission and so on. Directoriesarealsorepresentedasfilesandhaveanassociatedinode.Inadditiontodescriptionsabout thefile,theinodecontainspointerstothedatablocksofthefile.Ifthefileislarge,inodehasindirect pointertoablockofpointerstoadditionaldatablocks(thisfurtheraggregatesforlargerfiles).Ablockis typically8k. Inodeconsistsofthefollowingfields: Fileowneridentifier Filetype Fileaccesspermissions Fileaccesstimes Numberoflinks Filesize Locationofthefiledata

3. BriefaboutthedirectoryrepresentationinUNIX
AUnixdirectoryisafilecontainingacorrespondencebetweenfilenamesandinodes.Adirectory is a special file that the kernel maintains. Only kernel modifies directories, but processes can read directories. The contents of a directory are a list of filename and inode number pairs. When new directoriesarecreated,kernelmakestwoentriesnamed'.'(referstothedirectoryitself)and'..'(refers toparentdirectory). Systemcallforcreatingdirectoryismkdir(pathname,mode).

4. WhataretheUnixsystemcallsforI/O?
open(pathname,flag,mode)openfile creat(pathname,mode)createfile close(filedes)closeanopenfile read(filedes,buffer,bytes)readdatafromanopenfile write(filedes,buffer,bytes)writedatatoanopenfile lseek(filedes,offset,from)positionanopenfile dup(filedes)duplicateanexistingfiledescriptor dup2(oldfd,newfd)duplicatetoadesiredfiledescriptor fcntl(filedes,cmd,arg)changepropertiesofanopenfile ioctl(filedes,request,arg)changethebehaviourofanopenfile Thedifferencebetweenfcntlanfioctlisthattheformerisintendedforanyopenfile,whilethelatteris fordevicespecificoperations.

5. HowdoyouchangeFileAccessPermissions?

Everyfilehasfollowingattributes: owner'suserID(16bitinteger) owner'sgroupID(16bitinteger) Fileaccessmodeword 'rwxrwxrwx' (userpermissiongrouppermissionotherspermission) rread,wwrite,xexecute Tochangetheaccessmode,weusechmod(filename,mode). Example1: To change mode of myfile to 'rwrwr' (ie. read, write permission for user read,write permissionforgrouponlyreadpermissionforothers)wegivetheargsas: chmod(myfile,0664). Eachoperationisrepresentedbydiscretevalues 'r'is4 'w'is2 'x'is1 Therefore,for'rw'thevalueis6(4+2). Example2: Tochangemodeofmyfileto'rwxrr'wegivetheargsas: chmod(myfile,0744).

6. WhatarelinksandsymboliclinksinUNIXfilesystem?
Alinkisasecondname(notafile)forafile.Linkscanbeusedtoassignmorethanonenameto a file, but cannot be used to assign a directory more than one name or link filenames on different computers. Symboliclink'is'afilethatonlycontainsthenameofanotherfile.Operationonthesymboliclink isdirectedtothefilepointedbytheit.Boththelimitationsoflinksareeliminatedinsymboliclinks. Commandsforlinkingfilesare: Link lnfilename1filename2

Symboliclink

lnsfilename1filename2

7. WhatisaFIFO?
FIFOareotherwisecalledas'namedpipes'.FIFO(firstinfirstout)isaspecialfilewhichissaidto bedatatransient.Oncedataisreadfromnamedpipe,itcannotbereadagain.Also,datacanberead onlyintheorderwritten.Itisusedininterprocesscommunicationwhereaprocesswritestooneendof thepipe(producer)andtheotherreadsfromtheotherend(consumer).

8. Howdoyoucreatespecialfileslikenamedpipesanddevicefiles?
Thesystemcallmknodcreatesspecialfilesinthefollowingsequence. 1. kernelassignsnewinode, 2. setsthefiletypetoindicatethatthefileisapipe,directoryorspecialfile, 3. Ifitisadevicefile,itmakestheotherentrieslikemajor,minordevicenumbers. Forexample: If the device is a disk, major device number refers to the disk controller and minor device numberisthedisk.

9. Discussthemountandunmountsystemcalls
The privileged mount system call is used to attach a file system to a directory of another file system; the unmount system call detaches a file system. When you mount another file system on to yourdirectory,youareessentiallysplicingone directorytreeontoabranchinanother directory tree. The first argument to mount call is the mount point, that is , a directory in the current file naming system.Thesecondargumentisthefilesystemtomounttothatpoint.Whenyouinsertacdromtoyour unixsystem'sdrive,thefilesysteminthecdromautomaticallymountsto/dev/cdrominyoursystem.

10. Howdoestheinodemaptodatablockofafile?
Inodehas13blockaddresses.Thefirst10aredirectblockaddressesofthefirst10datablocksin the file. The 11th address points to a onelevel index block. The 12th address points to a twolevel (doubleindirection)indexblock.The13thaddresspointstoathreelevel(tripleindirection)indexblock. Thisprovidesaverylargemaximumfilesizewithefficientaccesstolargefiles,butalsosmallfilesare accesseddirectlyinonediskread.

11. Whatisashell? A shell is an interactive user interface to an operating system services that allows an user to enter commandsascharacterstringsorthroughagraphicaluserinterface.Theshellconvertsthemtosystem

callstotheOSorforksoffaprocesstoexecutethecommand.Systemcallresultsandotherinformation from the OS are presented to the user through an interactive interface. Commonly used shells are sh,csh,ksetc. SECTIONII 1. Briefabouttheinitialprocesssequencewhilethesystembootsup. Whilebooting,specialprocesscalledthe'swapper'or'scheduler'iscreatedwithProcessID0. The swapper manages memory allocation for processes and influences CPU allocation. The swapper inturncreates3children: theprocessdispatcher, vhandand dbflush withIDs1,2and3respectively. Thisisdonebyexecutingthefile/etc/init.Processdispatchergivesbirthtotheshell.Unixkeeps trackofalltheprocessesinaninternaldatastructurecalledtheProcessTable(listingcommandisps el). 2. WhatarevariousIDsassociatedwithaprocess? UnixidentifieseachprocesswithauniqueintegercalledProcessID.Theprocessthatexecutes therequestforcreationofaprocessiscalledthe'parentprocess'whosePIDis'ParentProcessID'.Every processisassociatedwithaparticularusercalledthe'owner'whohasprivilegesovertheprocess.The identification for the user is 'UserID'. Owner is the user who executes the process. Process also has 'EffectiveUserID'whichdeterminestheaccessprivilegesforaccessingresourceslikefiles. getpid()processid getppid()parentprocessid getuid()userid geteuid()effectiveuserid 3. Explainfork()systemcall. PROCESSMODELandIPC

The`fork()'usedtocreateanewprocessfromanexistingprocess.Thenewprocessiscalled thechildprocess,andtheexistingprocessiscalledtheparent.Wecantellwhichiswhichbychecking the return value from `fork()'. The parent gets the child's pid returned to him, but the child gets 0 returnedtohim. 4. Predicttheoutputofthefollowingprogramcode main() { fork(); printf("HelloWorld!"); } Answer: HelloWorld!HelloWorld! Explanation: The fork creates a child that is a duplicate of the parent process. The child begins from the fork().Allthestatementsafterthecalltofork()willbeexecutedtwice.(oncebytheparentprocessand otherbychild).Thestatementbeforefork()isexecutedonlybytheparentprocess. 5. Predicttheoutputofthefollowingprogramcode main() { fork();fork();fork(); printf("HelloWorld!"); } Answer: "HelloWorld"willbeprinted8times. Explanation:

2^ntimeswherenisthenumberofcallstofork()

6. Listthesystemcallsusedforprocessmanagement: Systemcalls fork() exec() wait() exit() getpid() getppid() nice() brk() 7. Howcanyouget/setanenvironmentvariablefromaprogram? Gettingthevalueofanenvironmentvariableisdonebyusing`getenv()'. Settingthevalueofanenvironmentvariableisdonebyusing`putenv()'. 8. Howcanaparentandchildprocesscommunicate? A parent and child can communicate through any of the normal interprocess communication schemes (pipes, sockets, message queues, shared memory), but also have some special ways to communicatethattakeadvantageoftheirrelationshipasaparentandchild.Oneofthemostobviousis thattheparentcangettheexitstatusofthechild. 9. Whatisazombie? Whenaprogramforksandthechildfinishesbeforetheparent,thekernelstillkeepssomeofits information about the child in case the parent might need it for example, the parent may need to checkthechild'sexitstatus.Tobeabletogetthisinformation,theparentcalls`wait()';Intheinterval betweenthechildterminatingandtheparentcalling`wait()',thechildissaidtobea`zombie'(Ifyoudo Description Tocreateanewprocess Toexecuteanewprograminaprocess Towaituntilacreatedprocesscompletesitsexecution Toexitfromaprocessexecution

Togetaprocessidentifierofthecurrentprocess Togetparentprocessidentifier Tobiastheexistingpriorityofaprocess Toincrease/decreasethedatasegmentsizeofaprocess

`ps',thechildwillhavea`Z'initsstatusfieldtoindicatethis.) 10. WhataretheprocessstatesinUnix? Asaprocessexecutesitchangesstateaccordingtoitscircumstances.Unixprocesseshavethe followingstates: Running:Theprocessiseitherrunningoritisreadytorun. Waiting:Theprocessiswaitingforaneventorforaresource. Stopped:Theprocesshasbeenstopped,usuallybyreceivingasignal. Zombie:Theprocessisdeadbuthavenotbeenremovedfromtheprocesstable. 11. WhatHappenswhenyouexecuteaprogram? WhenyouexecuteaprogramonyourUNIXsystem,thesystemcreatesaspecialenvironment forthatprogram.Thisenvironmentcontainseverythingneededforthesystemtoruntheprogramasif nootherprogramwererunningonthesystem.Eachprocesshasprocesscontext,whichiseverything that is unique about the state of the program you are currently running. Every time you execute a programtheUNIXsystemdoesafork,whichperformsaseriesofoperationstocreateaprocesscontext andthenexecuteyourprograminthatcontext.Thestepsincludethefollowing: Allocateaslotintheprocesstable,alistofcurrentlyrunningprogramskeptbyUNIX. Assignauniqueprocessidentifier(PID)totheprocess. iCopythecontextoftheparent,theprocessthatrequestedthespawningofthenewprocess. ReturnthenewPIDtotheparentprocess.Thisenablestheparentprocesstoexamineorcontrolthe processdirectly. Aftertheforkiscomplete,UNIXrunsyourprogram. 12. WhatHappenswhenyouexecuteacommand? Whenyouenter'ls'commandtolookatthecontentsofyourcurrentworkingdirectory,UNIX doesaseriesofthingstocreateanenvironmentforlsandtherunit:TheshellhasUNIXperformafork. Thiscreatesanewprocessthattheshellwillusetorunthelsprogram.TheshellhasUNIXperforman execofthelsprogram.Thisreplacestheshellprogramanddatawiththeprogramanddataforlsand thenstartsrunningthatnewprogram.Thelsprogramisloadedintothenewprocesscontext,replacing the text and data of the shell. The ls program performs its task, listing the contents of the current directory.

13. WhatisaDaemon? A daemon is a process that detaches itself from the terminal and runs, disconnected, in the background, waiting for requests and responding to them. It can also be defined as the background processthatdoesnotbelongtoaterminalsession.Manysystemfunctionsarecommonlyperformedby daemons, including the sendmail daemon, which handles mail, and the NNTP daemon, which handles USENETnews.Manyotherdaemonsmayexist.Someofthemostcommondaemonsare: init:Takesoverthebasicrunningofthesystemwhenthekernelhasfinishedthebootprocess. inetd:Responsibleforstartingnetworkservicesthatdonothavetheirownstandalonedaemons. Forexample,inetdusuallytakescareofincomingrlogin,telnet,andftpconnections. cron:Responsibleforrunningrepetitivetasksonaregularschedule. 14. Whatis'ps'commandfor? The ps command prints the process status for some or all of the running processes. The informationgivenaretheprocessidentificationnumber(PID),theamountoftimethattheprocesshas takentoexecutesofaretc. 15. Howwouldyoukillaprocess? ThekillcommandtakesthePIDasoneargument;thisidentifieswhichprocesstoterminate.The PIDofaprocesscanbegotusing'ps'command. 16. Whatisanadvantageofexecutingaprocessinbackground? Themostcommonreasontoputaprocessinthebackgroundistoallowyoutodosomething elseinteractivelywithoutwaitingfortheprocesstocomplete.Attheendofthecommandyouaddthe special background symbol, &. This symbol tells your shell to execute the given command in the background. Example:cp*.*../backup&(cpisforcopy) 17. Howdoyouexecuteoneprogramfromwithinanother? The system calls used for lowlevel process creation are execlp() and execvp(). The execlp call overlays the existing program with the new one , runs that and exits. The original program gets back controlonlywhenanerroroccurs. execlp(path,file_name,arguments..);//lastargumentmustbeNULL

Avariantofexeclpcalledexecvpisusedwhenthenumberofargumentsisnotknowninadvance. execvp(path,argument_array);//argumentarrayshouldbeterminatedbyNULL 18. WhatisIPC?Whatarethevariousschemesavailable? ThetermIPC(InterProcessCommunication)describesvariouswaysbywhichdifferentprocess runningonsomeoperatingsystemcommunicatebetweeneachother.Variousschemesavailableareas follows: Pipes: Oneway communication scheme through which different process can communicate. The problem is that the two processes should have a common ancestor (parentchild relationship).Howeverthisproblemwasfixedwiththeintroductionofnamedpipes(FIFO). MessageQueues: Message queues can be used between related and unrelated processes running on a machine. SharedMemory: This is the fastest of all IPC schemes. The memory to be shared is mapped into the addressspaceoftheprocesses(thataresharing).Thespeedachievedisattributedtothefact thatthereisnokernelinvolvement.Butthisschemeneedssynchronization. Variousformsofsynchronisationaremutexes,conditionvariables,readwritelocks, locks,andsemaphores. SECTIONIII 1. WhatisthedifferencebetweenSwappingandPaging?
Swapping:

record

MEMORYMANAGEMENT

Whole process is moved from the swap device to the main memory for execution. Process size must be less than or equal to the available main memory. It is easier to implementation and overhead to the system. Swapping systems does not handle the memory more flexibly as compared to the paging systems.

Paging:

Onlytherequiredmemorypagesaremovedtomainmemoryfromtheswapdevicefor execution.Processsizedoesnotmatter.Givestheconceptofthevirtualmemory.

It provides greater flexibility in mapping the virtual address space into the physical memory of the machine. Allows more number of processes to fit in the main memory simultaneously. Allows the greater process size than the available physical memory. Demand paging systems handle the memory more flexibly.
2. What is major difference between the Historic Unix and the new BSD release of Unix System V in termsofMemoryManagement? HistoricUnixusesSwappingentireprocessistransferredtothemainmemoryfromtheswap device,whereastheUnixSystemVusesDemandPagingonlythepartoftheprocessismovedtothe mainmemory.HistoricUnixusesoneSwapDeviceandUnixSystemVallowmultipleSwapDevices. 3. WhatisthemaingoaloftheMemoryManagement? Itdecideswhichprocessshouldresideinthemainmemory, Managesthepartsofthevirtualaddressspaceofaprocesswhichisnoncoreresident, Monitorstheavailablemainmemoryandperiodicallywritetheprocessesintotheswapdeviceto providemoreprocessesfitinthemainmemorysimultaneously. 4. WhatisaMap? AMapisanArray,whichcontainstheaddressesofthefreespaceintheswapdevicethatare allocatableresources,andthenumberoftheresourceunitsavailablethere. Address nits U 1 10,000

ThisallowsFirstFitallocationofcontiguousblocksofaresource.InitiallytheMapcontainsone entryaddress(blockoffsetfromthestartingoftheswaparea)andthetotalnumberofresources. Kernel treats each unit of Map as a group of disk blocks. On the allocation and freeing of the resourcesKernelupdatestheMapforaccurateinformation. 5. What scheme does the Kernel in Unix System V follow while choosing a swap device among the multipleswapdevices? KernelfollowsRoundRobinschemechoosingaswapdeviceamongthemultipleswapdevicesin UnixSystemV. 6. WhatisaRegion? ARegionisacontinuous areaofaprocesssaddressspace(suchas text,dataandstack). The kernelinaRegionTablethatislocaltotheprocessmaintainsregion.Regionsaresharableamongthe process. 7. What are the events done by the Kernel after a process is being swapped out from the main memory? WhenKernelswapstheprocessoutoftheprimarymemory,itperformsthefollowing: Kernel decrements the Reference Count of each region of the process. If the reference countbecomeszero,swapstheregionoutofthemainmemory, Kernelallocatesthespacefortheswappingprocessintheswapdevice, Kernellockstheotherswappingprocesswhilethecurrentswappingoperationisgoingon, TheKernelsavestheswapaddressoftheregionintheregiontable. 8. IstheProcessbeforeandaftertheswaparethesame?Givereason. Processbeforeswappingisresidingintheprimarymemoryinitsoriginalform.Theregions(text, dataandstack)maynotbeoccupiedfullybytheprocess,theremaybefewemptyslotsinanyofthe regionsandwhileswappingKerneldonotbotherabouttheemptyslotswhileswappingtheprocessout. After swapping the process resides in the swap (secondary memory) device. The regions swapped out will be present but only the occupied region slots but not the empty slots that were presentbeforeassigning.
While swapping the process once again into the main memory, the Kernel referring to the Process Memory Map, it assigns the main memory accordingly taking care of the empty slots in the regions.

9. Whatdoyoumeanbyuarea(userarea)orublock?

ThiscontainstheprivatedatathatismanipulatedonlybytheKernel.ThisislocaltotheProcess, i.e.eachprocessisallocatedauarea. 10. Whataretheentitiesthatareswappedoutofthemainmemorywhileswappingtheprocessoutof themainmemory? Allmemoryspaceoccupiedbytheprocess,processsuarea,andKernelstackareswappedout, theoretically. Practically,iftheprocesssuareacontainstheAddressTranslationTablesfortheprocessthen Kernelimplementationsdonotswaptheuarea. 11. WhatisForkswap? fork()isasystemcalltocreateachildprocess.Whentheparentprocesscallsfork()systemcall, thechildprocessiscreatedandifthereisshortofmemorythenthechildprocessissenttothereadto runstateintheswapdevice,andreturntotheuserstatewithoutswappingtheparentprocess.When thememorywillbeavailablethechildprocesswillbeswappedintothemainmemory. 12. WhatisExpansionswap? Atthetimewhenanyprocessrequiresmorememorythanitiscurrentlyallocated,theKernel performsExpansionswap.TodothisKernelreservesenoughspaceintheswapdevice.Thentheaddress translation mapping is adjusted for the new virtual address space but the physical memory is not allocated.AtlastKernelswapstheprocessintotheassignedspaceintheswapdevice.Laterwhenthe Kernel swaps the process into the main memory this assigns memory according to the new address translationmapping. 13. HowtheSwapperworks? The swapper is the only process that swaps the processes. The Swapper operates only in the KernelmodeanditdoesnotusesSystemcallsinsteaditusesinternalKernelfunctionsforswapping.Itis thearchetypeofallkernelprocess. 14. Whataretheprocessesthatarenotbotheredbytheswapper?GiveReason. Zombieprocess:Theydonottakeanyupphysicalmemory. Processeslockedinmemoriesthatareupdatingtheregionoftheprocess. Kernelswapsonlythesleepingprocessesratherthanthereadytorunprocesses,asthey havethehigherprobabilityofbeingscheduledthantheSleepingprocesses.

15. Whataretherequirementsforaswappertowork? The swapper works on the highest scheduling priority. Firstly it will look for any sleeping process, if not found then it will look for the readytorun process for swapping. But the major requirement for the swapper to work the readytorun process must be coreresident for at least 2 seconds before swapping out. And for swapping in the process must have been resided in the swap deviceforatleast2seconds.Iftherequirementisnotsatisfiedthentheswapperwillgointothewait stateonthateventanditisawakenonceinasecondbytheKernel. 16. Whatarethecriteriaforchoosingaprocessforswappingintomemoryfromtheswapdevice? The resident time of the processes in the swap device, the priority of the processes and the amountoftimetheprocesseshadbeenswappedout. 17. Whatarethecriteriaforchoosingaprocessforswappingoutofthememorytotheswapdevice? Theprocesssmemoryresidenttime, Priorityoftheprocessand Thenicevalue. 18. Whatdoyoumeanbynicevalue? Nicevalueisthevaluethatcontrols{incrementsordecrements}thepriorityoftheprocess.This valuethatisreturnedbythenice()systemcall.Theequationforusingnicevalueis: Priority=(recentCPUusage/constant)+(basepriority)+(nicevalue) Onlytheadministratorcansupplythenicevalue.Thenice()systemcallworksfortherunning processonly.Nicevalueofoneprocesscannotaffectthenicevalueoftheotherprocess. 19. Whatareconditionsonwhichdeadlockcanoccurwhileswappingtheprocesses? Allprocessesinthemainmemoryareasleep. Allreadytorunprocessesareswappedout. Thereisnospaceintheswapdeviceforthenewincomingprocessthatareswappedoutof themainmemory. Thereisnospaceinthemainmemoryforthenewincomingprocess. 20. WhatareconditionsforamachinetosupportDemandPaging? MemoryarchitecturemustbasedonPages, Themachinemustsupporttherestartableinstructions. 21. Whatistheprincipleoflocality?

Its the nature of the processes that they refer only to the small subset of the total data space of the process. i.e. the process frequently calls the same subroutines or executes the loop instructions. 22. What is the working set of a process? The set of pages that are referred by the process in the last n, references, where n is called the window of the working set of the process. 23. What is the window of the working set of a process? The window of the working set of a process is the total number in which the process had referred the set of pages in the working set of the process. 24. What is called a page fault? Page fault is referred to the situation when the process addresses a page in the working set of the process but the process fails to locate the page in the working set. And on a page fault the kernel updates the working set by reading the page from the secondary device. 25. What are data structures that are used for Demand Paging? Kernel contains 4 data structures for Demand paging. They are, Page table entries, Disk block descriptors, Page frame data table (pfdata), Swap-use table.
26. Whatarethebitsthatsupportthedemandpaging?

Valid, Reference, Modify, Copy on write, Age. These bits are the part of the page table entry, which includes physical address of the page and protection bits.
Pageaddress

Age Copy on write

Modify Reference

Valid Protection

27. How the Kernel handles the fork() system call in traditional Unix and in the System V Unix, while swapping? Kernel in traditional Unix, makes the duplicate copy of the parents address space and attaches it to the childs process, while swapping. Kernel in System V Unix, manipulates the region tables, page table, and pfdata table entries, by incrementing the reference count of the region table of shared regions. 28. Difference between the fork() and vfork() system call? During the fork() system call the Kernel makes a copy of the parent processs address space and attaches it to the child process. But the vfork() system call do not makes any copy of the parents address space, so it is faster than the fork() system call. The child process as a result of the vfork() system call executes exec() system call. The child process from vfork() system call executes in the parents address space (this can overwrite the parents data and stack ) which suspends the parent process until the child process exits.

29. What is BSS(Block Started by Symbol)? A data representation at the machine level, that has initial values when a program starts and tells about how much space the kernel allocates for the un-initialized data. Kernel initializes it to zero at run-time. 30. What is Page-Stealer process? This is the Kernel process that makes rooms for the incoming pages, by swapping the memory pages that are not the part of the working set of a process. Page-Stealer is created by the Kernel at the system initialization and invokes it throughout the lifetime of the system. Kernel locks a region when a process faults on a page in the region, so that page stealer cannot steal the page, which is being faulted in. 31. Name two paging states for a page in memory? The two paging states are: The page is aging and is not yet eligible for swapping, The page is eligible for swapping but not yet eligible for reassignment to other virtual address space. 32. What are the phases of swapping a page from the memory? Page stealer finds the page eligible for swapping and places the page number in the list of pages to be swapped. Kernel copies the page to a swap device when necessary and clears the valid bit in the page table entry, decrements the pfdata reference count, and places the pfdata table entry at the end of the free list if its reference count is 0. 33. What is page fault? Its types? Page fault refers to the situation of not having a page in the main memory when any process references it. There are two types of page fault : Validity fault, Protection fault. 34. In what way the Fault Handlers and the Interrupt handlers are different? Fault handlers are also an interrupt handler with an exception that the interrupt handlers cannot sleep. Fault handlers sleep in the context of the process that caused the memory fault. The fault refers to the running process and no arbitrary processes are put to sleep. 35. What is validity fault? If a process referring a page in the main memory whose valid bit is not set, it results in validity fault. The valid bit is not set for those pages: that are outside the virtual address space of a process, that are the part of the virtual address space of the process but no physical address is assigned to it.

36. Whatdoestheswappingsystemdoifitidentifiestheillegalpageforswapping?

If the disk block descriptor does not contain any record of the faulted page, then this causes the attempted memory reference is invalid and the kernel sends a Segmentation violation signal to the offending process. This happens when the swapping system identifies any invalid memory reference.
37. Whatarestatesthatthepagecanbein,aftercausingapagefault?

On a swap device and not in memory, On the free page list in the main memory, In an executable file, Marked demand zero, Marked demand fill.
38. Inwhatwaythevalidityfaulthandlerconcludes?

It sets the valid bit of the page by clearing the modify bit. It recalculates the process priority.
39. Atwhatmodethefaulthandlerexecutes?

At the Kernel Mode.

40. Whatdoyoumeanbytheprotectionfault?

Protection fault refers to the process accessing the pages, which do not have the access permission. A process also incur the protection fault when it attempts to write a page whose copy on write bit was set during the fork() system call.
41. HowtheKernelhandlesthecopyonwritebitofapage,whenthebitisset?

In situations like, where the copy on write bit of a page is set and that page is shared by more than one process, the Kernel allocates new page and copies the content to the new page and the other processes retain their references to the old page. After copying the Kernel updates the page table entry with the new page number. Then Kernel decrements the reference count of the old pfdata table entry. In cases like, where the copy on write bit is set and no processes are sharing the page, the Kernel allows the physical page to be reused by the processes. By doing so, it clears the copy on write bit and disassociates the page from its disk copy (if one exists), because other process may share the disk copy. Then it removes the pfdata table entry from the page-queue as the new copy of the virtual page is not on the swap device. It decrements the swap-use count for the page and if count drops to 0, frees the swap space.
42. Forwhichkindoffaultthepageischeckedfirst?

The page is first checked for the validity fault, as soon as it is found that the page is invalid (valid bit is clear), the validity fault handler returns immediately, and the process incur the validity page fault. Kernel handles the validity fault and the process will incur the protection fault if any one is present.
43. Inwhatwaytheprotectionfaulthandlerconcludes?

After finishing the execution of the fault handler, it sets the modify and protection bits and clears the copy on write bit. It recalculates the process-priority and checks for signals.

44. HowtheKernelhandlesboththepagestealerandthefaulthandler?

The page stealer and the fault handler thrash because of the shortage of the memory. If the sum of the working sets of all processes is greater that the physical memory then the fault handler will usually sleep because it cannot allocate pages for a process. This results in the reduction of the system throughput because Kernel spends too much time in overhead, rearranging the memory in the frantic pace.

TECHNICALSECTION Q1.typedefstruct{ char*; nodeptrnext; }*nodeptr; Whatdoesnodeptrstandfor? Q2.Whatdoes.int*x[]();means? Q3.structlist{ intx; structlist*next; }*head; thestructhead.x=100 Istheaboveassignmenttopointeriscorrectorwrong? Ans.Wrong Q4.Whatistheoutputofthefollowing? inti; i=1; i=i+2*i++; printf(%d,i); Ans.4

Q5.FILE*fp1,*fp2; fp1=fopen("one","w") fp2=fopen("one","w") fputc('A',fp1) fputc('B',fp2) fclose(fp1) fclose(fp2)} a.errorb.c.d. Ans.noerror.ButItwilloverwritesonsamefile. Whataretheoutput(s)forthefollowing? Q6.#include<malloc.h> char*f() {char*s=malloc(8); strcpy(s,"goodbye")} main() { char*f(); printf("%c",*f()='A'); } Q7.#defineMAN(x,y)(x)>(y)?(x):(y) { inti=10;j=5;k=0; k=MAX(i++,++j) printf(%d%d%d%d,i,j,k) } Ans.1050 Q8.a=10;b=5;c=3;d=3; if(a<b)&&(c=d++) printf(%d%d%d%da,b,c,d)

elseprintf("%d%d%d%da,b,c,d); Q9.#include<stdarg.h> show(intt,va_listptr1) { inta,x,i; a=va_arg(ptr1,int) printf("\n%d",a) } display(char) { intx; listptr; va_star(otr,s); n=va_arg(ptr,int); show(x,ptr); } main() { display("hello",4,12,13,14,44); } Q10.main() { printf("hello"); fork(); } Q11.main() { inti=10; printf("%d%d%d\n",++i,i++,++i); } Q12.#include<stdio.h> main()

{ int*p,*c,i; i=5; p=(int*)(malloc(sizeof(i))); printf("\n%d",*p); *p=10; printf("\n%d%d",i,*p); c=(int*)calloc(2); printf("\n%d\n",*c); } Q13.#defineMAX(x,y)(x)>(y)?(x):(y) main() { inti=10,j=5,k=0; k=MAX(i++,++j); printf("%d..%d..%d",i,j,k); } Q14.#include<stdio.h> main() { enum_tag{left=10,right,front=100,back}; printf("leftis%d,rightis%d,frontis%d,backis %d",left,right,front,back); } Q15.main() { inta=10,b=20; a>=5?b=100:b=200; printf("%d\n",b); } Q16.#definePRINT(int)printf("int=%d",int) main()

{ intx,y,z; x=03;y=02;z=01; PRINT(x^x); z<<=3;PRINT(x); y>>=3;PRINT(y); } Q17.#include<stdio.h> main() { chars[]="BouquetsandBrickbats"; printf("\n%c,",*(&s[2])); printf("%s,",s+5); printf("\n%s",s); printf("\n%c",*(s+2)); } Q18.main() { structs1 { char*str; structs1*ptr; }; staticstructs1arr[]={{"Hyderabad",arr+1}, {"Bangalore",arr+2}, {"Delhi",arr} }; structs1*p[3]; inti; for(i=0;i<=2;i++) p[i]=arr[i].ptr;

printf("%s\n",(*p)>str); printf("%s\n",(++*p)>str); printf("%s\n",((*p)++)>str); } Q19..main() { char*p="helloworld!"; p[0]='H'; printf("%s",p); } End

SUNSampleTestPaper

Home

Back To SUN Page 1. For the following program. struct XXX {int a; float b; char *s; }X; If optimization :X not used in compiler then unused bits_________________. Give your assumption_______________.

2. Give the output of the following program struct XXX {int a:6; float b:4; char s; }structure; size of (structure);

3.Class used for the multiple inheritence in JAVA_________________ (a) anonymous class (b) inner class (c) abstreet class (d) none

4. XDR fixes in which part of OS1 stack.

5. LDAP is____________service protocol.

6. Given definition for a function which returns a array of pointers with argument of int*.

7. Give a function declaration with no arguments which refers a two dimensional array

8. Pick up the correct function declaration. 1. void *[] name(); 2. void int[][] name(); 3. void ** name(); 4. none of the above.

9. Give the difference between monolithic and microlithic kernal: a. monolithic large b. microlithic used in embedded systems. c. none.

10. rPC coresponds to_______________in OSI stack.

11. Find the no.of page faults using LRU stack. eg.3 4 4 6 7 8 1 2 .. ..

12.The inorder representation of a tree 41523 and preorder is 211513 Draw it?

13. When does a stack member will be initialised (a) when object is created (b) when object is initialised. (c) doesnot depend on object. (d) none.

14. Number of CPU in a multiprocess is contrassed by (a) RISC nohere of CPU (b) memory (c) both (a) and (b) (d) None of the above 15. Give the output of the following program main() {char *s; s="hot java"; strcpy(s,"solarrs java") } 16. Give the output of the following program main() {printf("hot java"); fork() exit(0); } (i). When redirected to a screen what will be printed. (ii). When redirected to file what will be printed.

17. Give the output of the following program main() {int ret; ret=fork();ret=fork();ret=fork();ret=fork(); if(!ret) printf("sun"); else printf("solaris");

18. Give the output of the following program main() {char *p='a'; int *i=100/*p; } what will be the value of *i= 1

19. Which data structure gives efficient search 1 B-tree 2 binary tree 3 array 4 linked list

20. Find the error in the following program struct point {struct point *next; int data; } x; main() {int i; for(x=p;x!=0;) x=x->next,x++; freelist(x); } freelist(x) {free(x); return }

21. Mutex and _________are similar locking mechanisms.

22. A complex question on pointers and functions.

23. SNM and SMIP transport la MP P ayer protoco for TCP/I ols IP&OSI.
24UNIX:d differencebe etweenselect tandpoll

C/C++ Inte erview Ques w stions

The following article is taken fro the D Dobb's Journal, a om Dr. s Septem mber 199 96. It rec commend suitab metho ds ble ods for in nterviewing C++ jo applicants. ob

Wante Senio C++ P ed: or Programm mer

by Al Stevens
The ques stions are in three categories: n * The fir category probes whe rst ether applica ants have a rudimentar understanding of the ry e differenc between C and C++ ces n +. * The se econd catego examine their gras of class d ory es sp design. * The third determin how well they have kept abrea of langua nes e ast age changes that. s

Questions to Qualify an Applicant Q y

ou asic underst tanding of C and C++ a and their sim milarities an difference nd es? Q: Do yo have a ba A: Yes. If the an nswer is "yes proceed and plan to ask all the questions in the first g s," o group. If not t, the inter rview for a C++ programmer's job should be o C over, and yo should be talking ab ou e bout other em mployment opportunities. o Q: Have you particip pated in the design of C e C++ classes to support an applicat s t tion's proble em domain? A: Yes or No. nswer is "yes plan to include the q s," questions in the second group. App n d plicants usu ually If the an want to d describe the details of t e the systems they have designed. P s Pay attentio if you on understa and the natu of the ap ure pplication. I not, prete If end to pay a attention. If they have n not

actually done any class design, ask if they think they understand it. If so, include the second set of questions. Q: Do you keep up with what the ANSI C++ Standards committee is doing? A: Yes or No. Most people do not. Few people have the time. But occasionally there is that rare soul who reads all the magazines and books, owns a copy of the draft standard, and regularly tracks the C++ news groups on the net. If an applicant claims to be one of them, include the third group of questions in your interrogation.

Questions for All Applicants Here's the first group of questions and my opinions about what some acceptable answers would be. These questions do not cover C++ wall-to-wall, of course. I selected them as typical of the kind of knowledge that all C++ programmers should be expected to possess. There are five questions. Three correct answers is a good score. Q: How do you link a C++ program to C functions? A: By using the extern "C" linkage specification around the C function declarations. Programmers should know about mangled function names and type-safe linkages. Then they should explain how the extern "C" linkage specification statement turns that feature off during compilation so that the linker properly links function calls to C functions. Another acceptable answer is "I don't know. We never had to do that." Merely describing what a linker does indicates that the programmer does not understand the issue that underlies the question. Q: Explain the scope resolution operator. A: It permits a program to reference an identifier in the global scope that has been hidden by another identifier with the same name in the local scope. The answer can get complicated. However, it should start with "::". If the programmer is well into the design or use of classes that employ inheritance you might hear a lot about overriding member function overrides to explicitly call a function higher in the hierarchy. That's good to know, but ask specifically about global scope resolution. You're looking for a description of C++'s ability to override the particular C behavior where identifiers in the global scope are always hidden by like identifiers in a local scope. Q: What are the differences between a C++ struct and C++ class? A: The default member and base-class access specifiers are different. This is one of the commonly misunderstood aspects of C++. Believe it or not, many programmers think that a C++ struct is just like a C struct, while a C++ class has inheritance, access specifiers, member functions, overloaded operators, and so on. Some of

them have even written books about C++. Actually, the C++ struct has all the features of the class. The only differences are that a struct defaults to public member access and public base-class inheritance, and a class defaults to the private access specifier and private baseclass inheritance. Getting this question wrong does not necessarily disqualify an applicant. Getting it right is a definite plus. Saying, "I don't know" is definitely the wrong answer. I advance an unusual position about this. C++ programmers should at least believe that they know the differences, even when they are wrong about them. Getting it wrong is, therefore, right. You can explain the true difference in the interview and advance the programmer's knowledge. If they disagree vociferously, you have an opportunity to observe how they handle contentious debate when they are wrong and don't know it yet.

Q: How many ways are there to initialize an int with a constant? A: Two. There are two formats for initializers in C++ as shown in the example that follows. The first format uses the traditional C notation. The second format uses constructor notation. int foo = 123; int bar (123); It's acceptable when a programmer does not know about the second notation, although they should certainly know about the first one. Many old-timer C programmers who made the switch to C++ never use the second idiom, although some wise heads of C++ profess to prefer it. If your applicant is quick with the right answer, that's a good sign. Q: How does throwing and catching exceptions differ from using setjmp and longjmp? A: The throw operation calls the destructors for automatic objects instantiated since entry to the try block. Exceptions are in the mainstream of C++ now, so most programmers, if they are familiar with setjmp and longjmp, should know the difference. Both idioms return a program from the nested depths of multiple function calls to a defined position higher in the program. The program stack is "unwound" so that the state of the program, with respect to function calls and pushed arguments, is restored as if the calls had not been made. C++ exception handling adds to that behavior the orderly calls to the destructors of automatic objects that were instantiated as the program proceeded from within the try block toward where the throw expression is evaluated. Applicants might think you want to hear about the notational differences between the two idioms. Let them proceed to explain the syntax of try blocks, catch exception handlers, and throw expressions. Then ask them specifically what happens in a throw that does not

happen i a longjmp Their ans in p. swer should reflect an u understandin of the be ng ehavior described in the pre d evious answe er. One valid reason for not knowin about ex d r ng xception han ndling is that the applicant's experi ience is exclus sively with older C++ co o ompilers tha do not im at mplement ex xception han ndling. I would prefer th they hav at least h hat ve heard of exc ception hand dling, though. Another marginally acceptab reason is that their f ble s former supe ervisors and designers did not man d ndate and specify the use of ex xception handling in programs. In that case get the name of those es signers so th you can decline their applicatio hat ons if they should come e supervisors and des ng. a'knockin It is not unusual for C and C++ programm r + mers to be un nfamiliar with setjmp/ . structs are not particularly intuitive. A C programmer who has writte en longjmp. Those cons recursive descent pa e arsing algor rithms will c certainly be familiar with setjmp/longjmp. Others might no and that' acceptable. In that ca ot, 's ase, they w won't be able to discuss how e setjmp/longjmp diff fers from C+ exception handling, but let the interview tu into a ++ urn on e andling in ge eneral. That conversation will reveal a lot about a t discussio of C++ exception ha programmer's understanding of C++. f

Questio ons for Cla Designers ass

ond group of questions explores the applicant's knowledge of class de esign. There are e The seco eight que estions. Five out of eigh is a good score. e ht d Q: What is your reaction to this line of code? s his; delete th A: It's no a good pr ot ractice. Many applicants will look at you like you ar nuts. The l u re ey've never heard of this usage, an nd t good answe Perhaps t er. they will try to explain the y it's never occurred to them. That's a very g r ences. Two q quite accept table behavior of the statement. Ask them to contemplate its conseque reactions are, "Don't do it," and "Don't do it unless yo really kno what you are doing and s d ou ow u you are a masochist t." A good p programmer will insist t r that you sho ould absolut tely never u the state use ement if the e class is t be used by other pro to b ogrammers a and instanti iated as stat tic, extern, or automatic objects. That much should be o obvious. e uilt-in pitfalls. First, if it executes in a member function fo an extern t or n, The code has two bu static, or automatic object, the program will probably crash as so r oon as the d delete statem ment executes There is no portable w s. n way for an o object to tell that it was instantiate on the he ed eap, so the class cannot assert that its object is properly in s nstantiated. Second, wh hen an object s using progra might no know abo its demis As far as the am ot out se. s commits suicide this way, the u ating program is concer rned, the ob bject remains in scope a and continue to exist e es even instantia though t the object did itself in. S Subsequent dereferenc t cing of the p pointer can a and usually does lead to disaste I think th the langu d er. hat uage rules s should disallow the idio om, but that t's another matter.

In More Effective C++ (Addison-Wesley, 1996), Scott Meyers devotes one of his items to "delete this," implying that there are valid applications for the idiom and advancing contrived code kludges to make it seem to work better. A programmer who has read this otherwise very good book might think that the practice is acceptable. Experience leads me to disagree. Q: What is a default constructor? A: A constructor that has no arguments. If you don't code one, the compiler provides one if there are no other constructors. If you are going to instantiate an array of objects of the class, the class must have a default constructor. Q: What is a conversion constructor? A: A constructor that accepts one argument of a different type. The compiler uses this idiom as one way to infer conversion rules for your class. A constructor with more than one argument and with default argument values can be interpreted by the compiler as a conversion constructor when the compiler is looking for an object of your constructor's type and sees an object of the type of the constructor's first argument. Q: What is the difference between a copy constructor and an overloaded assignment operator? A: A copy constructor constructs a new object by using the content of the argument object. An overloaded assignment operator assigns the contents of an existing object to another existing object of the same class. First, the applicant must know that a copy constructor is one that has only one argument of the same type as the constructor. The compiler invokes a copy constructor wherever it needs to make a copy of the object, for example to pass an argument by value. If you do not provide a copy constructor, the compiler creates a member- by-member copy constructor for you. You can write overloaded assignment operators that take arguments of other classes, but that behavior is usually implemented with implicit conversion constructors. If you do not provide an overloaded assignment operator for the class, the compiler creates a default member- by-member assignment operator. This discussion is a good place to get into why classes need copy constructors and overloaded assignment operators. If the applicant discusses these with respect to data member pointers that point to dynamically allocated resources, the applicant probably has a good grasp of the problem. Q: When should you use multiple inheritance? A: There are three acceptable answers: "Never," "Rarely," and "When the problem domain cannot be accurately modeled any other way."

There are some famous C++ pundits and luminaries who disagree with that third answer, but I will accept it. Let's digress to consider this issue lest your interview turn into a religious debate. Consider an Asset class, Building class, Vehicle class, and CompanyCar class. All company cars are vehicles. Some company cars are assets because the organizations own them. Others might be leased. Not all assets are vehicles. Money accounts are assets. Real estate holdings are assets. Some real estate holdings are buildings. Not all buildings are assets. Ad infinitum. When you diagram these relationships, it becomes apparent that multiple inheritance is a likely and intuitive way to model this common problem domain. The applicant should understand, however, that multiple inheritance, like a chainsaw, is a useful tool that has its perils, needs respect, and is best avoided except when nothing else will do. Q: What is a virtual destructor? A: The simple answer is that a virtual destructor is one that is declared with the virtual attribute. The behavior of a virtual destructor is what is important. If you destroy an object through a pointer or reference to a base class, and the base-class destructor is not virtual, the derived-class destructors are not executed, and the destruction might not be complete. Q: Explain the ISA and HASA class relationships. How would you implement each in a class design? A: A specialized class "is" a specialization of another class and, therefore, has the ISA relationship with the other class. An Employee ISA Person. This relationship is best implemented with inheritance. Employee is derived from Person. A class may have an instance of another class. For example, an employee "has" a salary, therefore the Employee class has the HASA relationship with the Salary class. This relationship is best implemented by embedding an object of the Salary class in the Employee class. The answer to this question reveals whether the applicant has an understanding of the fundamentals of object- oriented design, which is important to reliable class design. There are other relationships. The USESA relationship is when one class uses the services of another. The Employee class uses an object (cout) of the ostream class to display the employee's name on the screen, for example. But if the applicant gets ISA and HASA right, you don't need to go any further. Q: When is a template a better solution than a base class? A: When you are designing a generic class to contain or otherwise manage objects of other types, when the format and behavior of those other types are unimportant to their containment or management, and particularly when those other types are unknown (thus, the genericity) to the designer of the container or manager class. Prior to templates, you had to use inheritance; your design might include a generic List container class and an application-specific Employee class. To put employees in a list, a ListedEmployee class is multiply derived (contrived) from the Employee and List classes. These solutions were unwieldy and error-prone. Templates solved that problem.

Questions for ANSI-Knowledgeable Applicants

There are six questions for those who profess knowledge of the progress of the ANSI committee. If you claim to have that much interest in the language, you should know the answers to all these questions. Q: What is a mutable member? A: One that can be modified by the class even when the object of the class or the member function doing the modification is const. Understanding this requirement implies an understanding of C++ const, which many programmers do not have. I have seen large class designs that do not employ the const qualifier anywhere. Some of those designs are my own early C++ efforts. One author suggests that some programmers find const to be such a bother that it is easier to ignore const than to try to use it meaningfully. No wonder many programmers don't understand the power and implications of const. Someone who claims to have enough interest in the language and its evolution to keep pace with the ANSI deliberations should not be ignorant of const, however. Q: What is an explicit constructor? A: A conversion constructor declared with the explicit keyword. The compiler does not use an explicit constructor to implement an implied conversion of types. It's purpose is reserved explicitly for construction. Q: What is the Standard Template Library? A: A library of container templates approved by the ANSI committee for inclusion in the standard C++ specification. A programmer who then launches into a discussion of the generic programming model, iterators, allocators, algorithms, and such, has a higher than average understanding of the new technology that STL brings to C++ programming. Q: Describe run-time type identification. A: The ability to determine at run time the type of an object by using the typeid operator or the dynamic_cast operator. Q: What problem does the namespace feature solve? A: Multiple providers of libraries might use common global identifiers causing a name collision when an application tries to link with two or more such libraries. The namespace feature surrounds a library's external declarations with a unique namespace that eliminates the potential for those collisions. This solution assumes that two library vendors don't use the same namespace identifier, of course.

Q: Are there any new intrinsic (built-in) data types? A: Yes. The ANSI committee added the bool intrinsic type and its true and false value keywords. Other apparent new types (string, complex, and so on) are implemented as classes in the Standard C++ Library rather than as intrinsic types.

C/C++ Questions
These are sample questions. Personally I hate asking questions related to code. If you want some old question papers of some Indian IT industries , You many find it here

1. Whatistheoutputofprintf("%d") 2. WhatwillhappenifIsaydeletethis 3. Differencebetween"Cstructure"and"C++structure". 4. Diffrencebetweena"assignmentoperator"anda"copyconstructor" 5. Whatisthedifferencebetween"overloading"and"overridding"? 6. Explaintheneedfor"VirtualDestructor". 7. Canwehave"VirtualConstructors"? 8. Whatarethedifferenttypesofpolymorphism? 9. WhatareVirtualFunctions?Howtoimplementvirtualfunctionsin"C" 10. WhatarethedifferenttypesofStorageclasses? 11. WhatisNamespace? 12. WhatarethetypesofSTLcontainers?. 13. Differencebetween"vector"and"array"? 14. Howtowriteaprogramsuchthatitwilldeleteitselfafterexectution? 15. CanwegenerateaC++sourcecodefromthebinaryfile? 16. Whatareinlinefunctions? 17. Talksometimingaboutprofiling? 18. Howmanylinesofcodeyouhavewrittenforasingleprogram? 19. Whatis"strstream"? 20. HowtowriteMultithreadedapplicationsusingC++? 21. Explain"passingbyvalue","passingbypointer"and"passingbyreference" 22. Writeanysmallprogramthatwillcompilein"C"butnotin"C++" 23. Haveyouheardof"mutable"keyword? 24. Whatisa"RTTI"? 25. IstheresomethingthatIcandoinCandnotinC++?

26. Whypreincrementoperatorisfasterthanpostincrement? 27. Whatisthedifferencebetween"calloc"and"malloc"? 28. WhatwillhappenifIallocatememoryusing"new"andfreeitusing"free"orallocatesing "calloc"andfreeitusing"delete"? 29. WhatisMemoryAlignment? 30. Explainworkingofprintf. 31. Differencebetween"printf"and"sprintf". 32. Whatis"map"inSTL? 33. WhenshallIuseMultipleInheritance? 34. Whatarethetechniquesyouusefordebugging? 35. Howtoreduceafinalsizeofexecutable? 36. Give2examplesofacodeoptimization.

Java Interview Questions

1. MeaningAbstractclasses,abstractmethods 2. DifferenceJava,C++ 3. Differencebetween==andequalsmethod 4. ExplainJavasecuritymodel 5. ExplainworkingofJavaVirtualMachine(JVM) 6. Difference:JavaBeans,Servlets 7. Difference:AWT,Swing 8. DisadvantagesofJava 9. WhatisBYTECode? 10. Whatgivesjavait's"writeonceandrunanywhere"nature? 11. DoesJavahave"goto"? 12. Whatisthemeaningof"final"keyword? 13. CanIcreatefinalexecutablefromJava? 14. ExplainGarbagecollectionmechanisminJava 15. WhyJavaisnot100%pureobjectorientedlanguage? 16. Whatareinterfaces?orHowtosupportmultipleinhertanceinJava? 17. HowtouseC++codeinJavaProgram? 18. Differencebetween"APPLET"and"APPLICATION"

|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Q:HowdoyoulinkaC++programtoCfunctions? A:Byusingtheextern"C"linkagespecificationaroundtheCfunctiondeclarations. Q:Explainthescoperesolutionoperator. A:Itpermitsaprogramtoreferenceanidentifierintheglobalscopethathasbeenhiddenbyanother identifierwiththesamenameinthelocalscope. Q:WhatarethedifferencesbetweenaC++structandC++class? A:Thedefaultmemberandbaseclassaccessspecifiersaredifferent. Q:Howmanywaysaretheretoinitializeanintwithaconstant? A:Two. TherearetwoformatsforinitializersinC++asshownintheexamplethatfollows.Thefirstformatuses thetraditionalCnotation.Thesecondformatusesconstructornotation. intfoo=123; intbar(123); Q:Howdoesthrowingandcatchingexceptionsdifferfromusingsetjmpandlongjmp? A:Thethrowoperationcallsthedestructorsforautomaticobjectsinstantiatedsinceentrytothetry block. Q:Whatisyourreactiontothislineofcode? deletethis; A:It'snotagoodpractice. Q:Whatisadefaultconstructor? A:Aconstructorthathasnoarguments. Q:Whatisaconversionconstructor? A:Aconstructorthatacceptsoneargumentofadifferenttype. Q:Whatisthedifferencebetweenacopyconstructorandanoverloadedassignmentoperator? A:Acopyconstructorconstructsanewobjectbyusingthecontentoftheargumentobject.An overloadedassignmentoperatorassignsthecontentsofanexistingobjecttoanotherexistingobjectof thesameclass. Q:Whenshouldyouusemultipleinheritance? A:Therearethreeacceptableanswers:"Never,""Rarely,"and"Whentheproblemdomaincannotbe accuratelymodeledanyotherway." Q:Whatisavirtualdestructor?

A:Thesimpleansweristhatavirtualdestructorisonethatisdeclaredwiththevirtualattribute. Q:ExplaintheISAandHASAclassrelationships.Howwouldyouimplementeachinaclassdesign? A:Aspecializedclass"is"aspecializationofanotherclassand,therefore,hastheISArelationshipwith theotherclass.AnEmployeeISAPerson.Thisrelationshipisbestimplementedwithinheritance. EmployeeisderivedfromPerson.Aclassmayhaveaninstanceofanotherclass.Forexample,an employee"has"asalary,thereforetheEmployeeclasshastheHASArelationshipwiththeSalaryclass. ThisrelationshipisbestimplementedbyembeddinganobjectoftheSalaryclassintheEmployeeclass. Q:Whenisatemplateabettersolutionthanabaseclass? A:Whenyouaredesigningagenericclasstocontainorotherwisemanageobjectsofothertypes,when theformatandbehaviorofthoseothertypesareunimportanttotheircontainmentormanagement, andparticularlywhenthoseothertypesareunknown(thus,thegenericity)tothedesignerofthe containerormanagerclass. Q:Whatisamutablemember? A:Onethatcanbemodifiedbytheclassevenwhentheobjectoftheclassorthememberfunction doingthemodificationisconst. Q:Whatisanexplicitconstructor? A:Aconversionconstructordeclaredwiththeexplicitkeyword.Thecompilerdoesnotuseanexplicit constructortoimplementanimpliedconversionoftypes.It'spurposeisreservedexplicitlyfor construction. Q:WhatistheStandardTemplateLibrary? A:AlibraryofcontainertemplatesapprovedbytheANSIcommitteeforinclusioninthestandardC++ specification. Aprogrammerwhothenlaunchesintoadiscussionofthegenericprogrammingmodel,iterators, allocators,algorithms,andsuch,hasahigherthanaverageunderstandingofthenewtechnologythat STLbringstoC++programming. Q:Describeruntimetypeidentification. A:Theabilitytodetermineatruntimethetypeofanobjectbyusingthetypeidoperatororthe dynamic_castoperator. Q:Whatproblemdoesthenamespacefeaturesolve? A:Multipleprovidersoflibrariesmightusecommonglobalidentifierscausinganamecollisionwhenan applicationtriestolinkwithtwoormoresuchlibraries.Thenamespacefeaturesurroundsalibrary's externaldeclarationswithauniquenamespacethateliminatesthepotentialforthosecollisions. Thissolutionassumesthattwolibraryvendorsdon'tusethesamenamespaceidentifier,ofcourse. Q:Arethereanynewintrinsic(builtin)datatypes? A:Yes.TheANSIcommitteeaddedtheboolintrinsictypeanditstrueandfalsevaluekeywords.

|||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| Q1:WhataretheadvantagesofOOPL? Ans:Objectorientedprogramminglanguagesdirectlyrepresentthereallifeobjects.Thefeaturesof OOPLasinhreitance,polymorphism,encapsulationmakesitpowerful. Q2:Whatdomeanbypolymorphisum,inheritance,encapsulation? Ans:Polymorhisum:isafeatureofOOPlthatatruntimedependinguponthetypeofobjectthe appropriatemethodiscalled. Inheritance:isafeatureofOOPLthatrepresentsthe"isa"relationshipbetweendifferent objects(classes).Sayinreallifeamanagerisaemployee.SoinOOPLmangerclassisinheritedfromthe employeeclass. Encapsulation:isafeatureofOOPLthatisusedtohidetheinformation. Q3:Whatdoyoumeanbystaticmethods? Ans:Byusingthestaticmethodthereisnoneedcreatinganobjectofthatclasstousethatmethod.We candirectlycallthatmethodonthatclass.Forexample,sayclassAhasstaticfunctionf(),thenwecan callf()functionasA.f().ThereisnoneedofcreatinganobjectofclassA. Q4:Whatdoyoumeanbyvirtualmethods? Ans:virtualmethodsareusedtousethepolymorhismfeatureinC++.SayclassAisinheritedfromclass B.Ifwedeclaresayfuctionf()asvirtualinclassBandoverridethesamefunctioninclassAthenat runtimeappropriatemethodoftheclasswillbecalleddependinguponthetypeoftheobject. Q5:GiventwotablesStudent(SID,Name,Course)andLevel(SID,level)writetheSQLstatementtoget thenameandSIDofthestudentwhoaretakingcourse=3andatfreshmanlevel. Ans:SELECTStudent.name,Student.SID FROMStudent,Level WHEREStudent.SID=Level.SID ANDLevel.Level="freshman" ANDStudent.Course=3; Q6:Whatarethedisadvantagesofusingthreads? Ans:DeadLock. Q1:WritetheJavacodetodeclareanyconstant(saygravitationalconstant)andtogetitsvalue Ans:ClassABC { staticfinalfloatGRAVITATIONAL_CONSTANT=9.8; publicvoidgetConstant() { system.out.println("Gravitational_Constant:"+GRAVITATIONAL_CONSTANT); }

} Q2:WhatdoyoumeanbymultipleinheritanceinC++? Ans:MultipleinheritanceisafeatureinC++bywhichoneclasscanbeofdifferenttypes.Sayclass teachingAssistantisinheritedfromtwoclassessayteacherandStudent. Q3:CanyouwriteJavacodefordeclarationofmultipleinheritanceinJava? Ans:ClassCextendsAimplementsB { } |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||| |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||

C++interviewquestions
1.DesignandimplementaStringclassthatsatisfiesthefollowing:

Supportsembeddednulls Providethefollowingmethods(atleast)
o o o o o o o o

Constructor Destructor Copyconstructor Assignmentoperator Additionoperator(concatenation) Returncharacteratlocation Returnsubstringatlocation Findsubstring

ProvideversionsofmethodsforStringandforchar*arguments

2.Giventhefollowingclasses class Fruit { // ... } class Apple : public Fruit { // ... } class Peach : public Fruit { // ... } // Container of fruit class BasketOfFruit {

BasketOfFruit() ; void insert( Fruit & f ) ; // ... } // Container of apples class BasketOfApples /* ??? */ { // ... } ShouldBasketOfApplesderivefromBasketOfFruit?Whyorwhynot? Whatisthegeneralprinciplethatdeterminestheanswer? 3.Describebrieflywhatthefollowingfunctiondoes.Whatstandardfunctionisitmostlike? int f( char *p ) { int n = 0 ; while ( *p != 0 ) n = 10*n + *p++ - '0' ; return n ; } 4.Describebrieflywhatfunction'a'doesinthefollowingcodefragment. struct s { struct s *next ; } a( struct s *p, struct s *x ) { while ( p-next != 0 ) p = p-next ; p-next = x ; x-next = 0 ; } 5.WhatdefaultmethodsaredeclaredimplicitlybytheC++compilerfortheclassbelow: class Empty { }; 6.Givenasystemwithahardrealtimepriority,multithreadedarchitecture,withprioritiesfrom1(least) to5(most),explainthemajorflawinthedesignbelow: Thefollowingobjectsaresharedbetweenthethreads: Disk:Thisclassisasingleton.Theread()andwrite()methodsbothblockonasimpleatomic lock()/unlock()sharedbetweenthetwo.(ie,onlyonethreadcanaccessthedisk,thrueitherreador write,atanygiventime).ItalsohasawaitForData()method,whichblocks(withoutclaimingthelock) untileitheratimeoutelapses,ordataisready.Itreturnstrueuponreturningduetonewdata,false uponreturningduetothetimeout.

Network:Thisclassisasingleton.Theread()andwrite()methodsbothblockonasimpleatomic lock()/unlock()sharedbetweenthetwo.(ie,onlyonethreadcanaccessthedisk,thrueitherreador write,atanygiventime). Sensor:TheSensorclassaccessesanumberofphysicalsensors.Thefirstmethod,'waitForData()',blocks untildatahasbeencollectedfromthesensors.Thesecondmethod,'processData()',doesaseriesof longandcpuintensivecalculationsonthedata.Thesecalculationsoftentakeseveralminutes.Itthen returnstheprocesseddata. Eachofthefollowingthreadsisrunningconcurrently.Assumethatthepsuedocodeineachthreadis loopedinfinitely(ie,encasedinawhile(true){}.Itisextremelyimportantthatinformationbufferedto thediskbesenttothenetworkasquicklyaspossible,thisiswhyThread1runsatpriority5.Thesystem conditionscheckedinthread3arenotparticularlyimportantevents(notasimportantasthe calculationsdoneinthread2).Iftheeventsaren'ttransmittedoverthenetworkforseveralminutes,it's notaproblematall.Theydo,however,containalargeamountofsysteminformation.Thread4watches forserioussystemalarms,indicatingseriousproblems.Theseareaseriousconcernandifnotquickly bufferedtothediskandsenttothenetwork,cancauseseriousrevenueloss. Thread 1: (priority: 5) while(!Disk.waitForData()) { yield(); } /* Wait until someone has written data to the disk */ Network.write(Disk.read()); /* Write the data buffered on the disk to the network */ Thread 2: (priority: 2) while(!Sensor.waitForData()) { yield(); } /* Wait until the sensors have picked up data */ Disk.write(Sensor.processData()); /* process the data and write it to the disk. */ Thread 3: (priority: 1) if (checkSystemCondition1()) /* Disk.write(SystemCond1Data); /* condition and buffer it to disk if (checkSystemCondition2()) /* Disk.write(SystemCond2Data); if (checkSystemCondition3()) /* Disk.write(SystemCond3Data); yield(); If system condition 1 is true.. */ Grab the data on the system */ see above*/ see above */

Thread 4: (priority: 4) if (checkAlarms()) /* If any serious alarms exist */ Disk.write(AlarmData); /* Buffer that data to disk for immediate network transmit */ yield();

1. In C++, what is the difference between method overloading and method overwriting?

Overloading a method (or function) in C++ is the ability for functions of the same name to be defined as long as these methods have different signatures (different set of parameters). Method overwriting is the ability of the inherited class rewriting the virtual method of the base class.
2.WhatmethodscanbeoverwritteninJava? InC++terminalogy,allpublicmethodsinJavaarevirtual.Therefore,allJavamethodscanbeoverwritten insubclassesexceptthosethataredeclaredfinal,static,andprivate. 3.InC,Whatisthedifferencebetweenastaticvariableandglobalvariable? Astaticvariabledeclaredoutsideofanyfunctionisaccessibleonlytoallthefunctionsdefinedinthe samefile(asthestaticvariable).However,aglobalvariablecanbeaccessedbyanyfunction(including theonesfromdifferentfiles). 4.InC,whyisthevoidpointeruseful? Thevoidpointerisusefulbecuaseitisagenericpointerthatanypointercanbecastintoandbackagain withoutlossofinformation. 5.Whatarethedefiningtraitsofanobjectorientedlanguage? Thedefiningtraitsofanobjectorientedlangaugeare:

encapsulation inheritance polymorphism

Q:WhatisthedifferencebetweenStackandQueue? A:StackisaLastInFirstOut(LIFO)datastructure. QueueisaFirstInFirstOut(FIFO)datastructure Q:Writeafucntionthatwillreverseastring.(Microsoft) A:char*strrev(char*s) { inti=0,len=strlen(s); char*str; if((str=(char*)malloc(len+1))==NULL)/*cannotallocatememory*/ err_num=2; return(str); } while(len) str[i++]=s[len]; str[i]=NULL;

return(str); } Q:WhatisthesoftwareLifeCycle? A:ThesoftwareLifeCycleare 1)Analysisandspecificationofthetask 2)Designofthealgorithmsanddatastructures 3)Implementation(coding) 4)Testing 5)Maintenanceandevolutionofthesystem 6)Obsolescence Q:WhatisthedifferencebetweenaJavaapplicationandaJavaapplet? A:ThedifferencebetweenaJavaapplicationandaJavaappletisthata JavaapplicationisaprogramthatcanbeexecutedusingtheJava interpeter,andaJAVAappletcanbetransferedtodifferentnetworks andexecutedbyusingawebbrowser(transferabletotheWWW). Q:Name7layersoftheOSIReferenceModel?(fromCisco) A:Applicationlayer Presentationlayer Sessionlayer Transportlayer Networklayer DataLinklayer Physicallayer 1.Question:Supposethatdataisanarrayof1000integers.Writeasinglefunctioncallthatwillsort the100elementsdata[222]throughdata[321]. Answer:quicksort((data+222),100); 2.Question:Whichrecursivesortingtechniquealwaysmakesrecursivecallstosortsubarraysthatare abouthalfsizeoftheoriginalarray? Answer:Mergesortalwaysmakesrecursivecallstosortsubarraysthatareabouthalfsizeoftheoriginal array,resultinginO(nlogn)time. 3.Question:Whatisthedifferencebetweenanexternaliteratorandaninternaliterator?Describean advantageofanexternaliterator. Answer:.Aninternaliteratorisimplementedwithmemberfunctionsoftheclassthathasitemstostep

through..Anexternaliteratorisimplementedasaseparateclassthatcanbe"attach"totheobjectthat hasitemstostepthrough..Anexternaliteratorhastheadvantagethatmanydifferenceiteratorscanbe activesimultaneouslyonthesameobject. 4.Question:Whyarearraysusuallyprocessedwithforloop? Answer:Therealpowerofarrayscomesfromtheirfacilityofusinganindexvariabletotraversethe array,accessingeachelementwiththesameexpressiona[i].Alltheisneededtomakethisworkisa iteratedstatementinwhichthevariableiservesasacounter,incrementingfrom0toa.length1.Thatis exactlywhataloopdoes. 5.Question:WhatisanHTMLtag? Answer:AnHTMLtagisasyntacticalconstructintheHTMLlanguagethatabbreviatesspecific instructionstobeexecutedwhentheHTMLscriptisloadedintoaWebbrowser.Itislikeamethodin Java,afunctioninC++,aprocedureinPascal,orasubroutineinFORTRAN. 1.Howdoyouwriteafunctionthatcanreversealinkedlist?(CiscoSystem) voidreverselist(void) { if(head==0) return; if(head>next==0) return; if(head>next==tail) { head>next=0; tail>next=head; } else { node*pre=head; node*cur=head>next; node*curnext=cur>next; head>next=0; cur>next=head; for(;curnext!=0;) {

cur>next=pre; pre=cur; cur=curnext; curnext=curnext>next; } curnext>next=cur; } } 2.Whatispolymorphism? Polymorphismistheideathatabaseclasscanbeinheritedbyseveralclasses.Abaseclasspointercan pointtoitschildclassandabaseclassarraycanstoredifferentchildclassobjects. 3.Howdoyoufindoutifalinkedlisthasanend?(i.e.thelistisnotacycle) Youcanfindoutbyusing2pointers.Oneofthemgoes2nodeseachtime.Thesecondonegoesat1 nodeseachtime.Ifthereisacycle,theonethatgoes2nodeseachtimewilleventuallymeettheone thatgoesslower.Ifthatisthecase,thenyouwillknowthelinkedlistisacycle. 4.HowcanyoutellwhatshellyouarerunningonUNIXsystem? YoucandotheEcho$RANDOM.ItwillreturnaundefinedvariableifyouarefromtheCShell,justa returnpromptifyouarefromtheBourneshell,anda5digitrandomnumbersifyouarefromtheKorn shell.YoucouldalsodoapslandlookfortheshellwiththehighestPID. 5.WhatisBoyceCoddNormalform? ArelationschemaRisinBCNFwithrespecttoasetFoffunctionaldependenciesifforallfunctional dependenciesinF+oftheforma>b,whereaandbisasubsetofR,atleastoneofthefollowingholds: a>bisatrivialfunctionaldependency(bisasubsetofa) aisasuperkeyforschemaR WhatisaMakefile?(Fujitsu) Ans:MakefileisautilityinUnixtohelpcompilelargeprograms.Ithelpsbyonlycompilingtheportionof theprogramthathasbeenchanged. 2.Whatisdeadlock?(Novell) Deadlockisasituationwhentwoormoreprocessespreventeachotherfromrunning.Example:ifT1is holdingxandwaitingforytobefreeandT2holdingyandwaitingforxtobefreedeadlockhappens. 3.WhatisaSemaphore?(Novell) Semaphoreisaspecialvariable,ithastwomethods:upanddown.Semaphoreperformsatomic operations,whichmeansonesasemaphoreiscalleditcannotbeinturrupted. 4.IsCanObjectOrientedlanguage?(Microsoft) CisnotanObjectOrientedlanguage,butlimitedObjectOrientedprogrammingcanbedoneinC.

5.WhatisdifferencebetweenC++andJava? C++haspointersJavadoesnot. JavaisplatformindependentC++isnot. JavahasgarbagecollectionC++doesnot. QUESTION:WhatisaJavaBean?(askedbyLifescaninc) ANSWER:JavaBeansarereusablesoftwarecomponentswrittenintheJavaprogramminglanguage, designedtobemanipulatedvisuallybyasoftwaredevelpomentenvironment,likeJBuilderorVisualAge forJava.TheyaresimilartoMicrosoft'sActiveXcomponents,butdesignedtobeplatformneutral, runninganywherethereisaJavaVirtualMachine(JVM). QUESTION:Whatarethesevenlayers(OSImodel)ofnetworking?(askedbyCaspio.com) ANSWER:1.Physical,2.DataLink,3.Network,4.Transport,5.Session,6.Presentationand7.Application Layers. QUESTION:WhataresomeadvantagesanddisadvantagesofJavaSockets?(askedbyArashsoft.com) ANSWER: AdvantagesofJavaSockets: Socketsareflexibleandsufficient.Efficientsocketbasedprogrammingcanbeeasilyimplementedfor generalcommunications. Socketscauselownetworktraffic.UnlikeHTMLformsandCGIscriptsthatgenerateandtransferwhole webpagesforeachnewrequest,Javaappletscansendonlynecessaryupdatedinformation. DisadvantagesofJavaSockets: SecurityrestrictionsaresometimesoverbearingbecauseaJavaappletrunninginaWebbrowserisonly abletoestablishconnectionstothemachinewhereitcamefrom,andtonowhereelseonthenetwork DespitealloftheusefulandhelpfulJavafeatures,Socketbasedcommunicationsallowsonlytosend packetsofrawdatabetweenapplications.Boththeclientsideandserversidehavetoprovide mechanismstomakethedatausefulinanyway. Sincethedataformatsandprotocolsremainapplicationspecific,thereuseofsocketbased implementationsislimited. QUESTION:WhatisthedifferencebetweenaNULLpointerandavoidpointer?(askedbyLifescaninc) ANSWER:ANULLpointerisapointerofanytypewhosevalueiszero.Avoidpointerisapointertoan objectofanunknowntype,andisguaranteedtohaveenoughbitstoholdapointertoanyobject.Avoid pointerisnotguaranteedtohaveenoughbitstopointtoafunction(thoughingeneralpracticeitdoes). QUESTION:Whatisencapsulationtechnique?(askedbyMicrosoft) ANSWER:Hidingdatawithintheclassandmakingitavailableonlythroughthemethods.Thistechnique isusedtoprotectyourclassagainstaccidentalchangestofields,whichmightleavetheclassinan inconsistentstate.

Questions
L1.Q1:Writetheoutputofthefollowingprogram
#include #define ABC 20 10 ABC - XYZ

#define XYZ #define XXX void main() { int

a;

a = XXX * 10; printf("%d\n", a); }

Solution for L1.Q1

L1.Q2:Writetheoutputofthisprogram
#include #define calc(a, b) void main() { int a = 20, b = 10; printf("%d\n", calc(a + 4, b -2)); } (a * b) / (a - b)

Solution for L1.Q2

L1.Q3:Whatwillbeoutputofthefollowingprogram?
#include void main() { int cnt = 5, a; do { a /= cnt; } while (cnt --); printf ("%d\n", a); }

Solution for L1.Q3

L1.Q4:Printtheoutputofthisprogram
#include void main() { int a, b, c, abc = 0; a = b = c = 40; if (c) { int abc; abc = a*b+c; } printf ("c = %d, abc = %d\n", c, abc); }

Solution for L1.Q4

L1.Q5:Printtheoutputofthisprogram
#include main() { int k = 5; if (++k < 5 && k++/5 || ++k <= 8); printf("%d\n", k); }

Solution for L1.Q5

L1.Q6:Whatistheoutputofthisprogram?
#include void fn(int, int); main() { int a = 5;

printf("Main : %d %d\n", a++, ++a); fn(a, a++); } void fn(int a, int b) { printf("Fn : a = %d \t b = %d\n", a, b); }

Solution for L1.Q6

Answers
L1.A1 SolutionforL1.Q1
a = xxx * 10 which is => a = ABC - XYZ * 10 => a = 20 - 10 * 10 => a = 20 - 100 => a = -80

L1.A2 SolutionforL1.Q2
Actual substitution is like this : calc(20+4, 10 -2) is calculated as follows (20+4 * 10-2) / (20+4 - 10-2) (20+40-2) / 12 58 / 12 = 4.8 since it is printed in %d the ans is 4

L1.A3 SolutionforL1.Q3
This problem will compile properly, but it will give run time error. It will give divide-by-zero error. Look in to the do loop portion do { a /= cnt; } while (cnt --); when the 'cnt' value is 1, it is decremented in 'while ( cnt --)' and on next reference of 'cnt' it becomes zero. a /= cnt; /* ie. a /= 0 */ which leads to divide-by-zero error.

L1.A4 SolutionforL1.Q4
the result will be c = 40 and abc = 0; because the scope of the variable 'abc' inside if(c) {.. } is not valid out side that if (.) { .. }.

L1.A5 SolutionforL1.Q5
The answer is 7. The first condition ++k < 5 is checked and it is false (Now k = 6). So, it checks the 3rd condition (or condition ++k <= 8) and (now k = 7) it is true. At this point k value is incremented by twice, hence the value of k becomes 7.

L1.A6 SolutionforL1.Q6
The solution depends on the implementation of stack. (Depends on OS) In some machines the arguments are passed from left to right to the stack. In this case the result will be Main : 5 7 Fn : 7 7 Other machines the arguments may be passed from right to left to the stack. In that case the result will be Main : 6 6 Fn : 8 7

C Puzzles : Questions and Answers - Level 2

Questions

L2.Q1:Writetheoutputofthisprogram
#include main() { int *a, *s, i; s = a = (int *) malloc( 4 * sizeof(int)); for (i=0; i<4; i++) *(a+i) = i * 10; printf("%d\n", *s++); printf("%d\n", (*s)++); printf("%d\n", *s); printf("%d\n", *++s); printf("%d\n", ++*s); }

Solution for L2.Q1

L2.Q2:Checkoutthisprogramresult
#include void fn(int); static int val = 5; main() { while (val --) fn(val); printf("%d\n", val); } void fn(int val) { static int val = 0;

for (; val < 5; val ++) printf("%d\n", val); }

Solution for L2.Q2

L2.Q3:Canyoupredicttheoutputofthisprogram?
#include main() { typedef union { int char float } Union; Union x.a = 50; strcpy (x.b, "hello"); x.c = 21.50; printf ("Union 2 : %d %s %f\n", x.a, x.b, x.c); printf ("Union Y : %d %s %f\n", y.a, y.b, y.c); } x, y = { 100 }; a; b[10]; c;

Solution for L2.Q3

L2.Q4:Printtheoutputoftheprogram
#include main() { struct Data {

int int

a; b;

} y[4] = { 1, 10, 3, 30, 2, 20, 4, 40}; struct Data *x = y; int i; for(i=0; i<4; i++) { x->a = x->b, ++x++->b; printf("%d %d\t", y[i].a, y[i].b); } }

Solution for L2.Q4

L2.Q5:Writetheoutputofthisprogram
#include main() { typedef struct { int int int char int }xyz; typedef union { xyz X; char y[100]; }abc; printf("sizeof xyz = %d sizeof abc = %d\n", sizeof(xyz), sizeof(abc)); } a; b; c; ch; d;

Solution for L2.Q5

L2.Q6:Findouttheerrorinthiscode
#include #include #define Error(str) printf("Error : %s\n", str); exit(1); main() { int fd; char str[20] = "Hello! Test me"; if ((fd = open("xx", O_CREAT | O_RDWR)) < 0) Error("open failed"); if (write(fd, str, strlen(str)) < 0) Error("Write failed"); if (read(fd, str, strlen(str)) < 0) Error("read failed"); printf("File read : %s\n", str); close(fd); }

Solution for L2.Q6

L2.Q7:Whatwillbetheoutputofthisprogram?
#include main() { int *a, i;

a = (int *) malloc(10*sizeof(int));

for (i=0; i<10; i++) *(a + i) = i * i; for (i=0; i<10; i++) printf("%d\t", *a++); free(a); }

Solution for L2.Q7

L2.Q8:
Write a program to calculate number of 1's (bit) in a given integer number i.e) Number of 1's in the given integer's equivalent binary representation.

Solution for L2.Q8

Answers
L2.A1 SolutionforL2.Q1
The output will be : 0 10 11 20 21 *s++ *++s ++*s => *(s++) => *(++s) => ++(*s)

L2.A2 SolutionforL2.Q2
Some compiler (ansi) may give warning message, but it will compile without errors. The output will be : 0 1 2 3 4 and -1

L2.A3 SolutionforL2.Q3
This is the problem about Unions. Unions are similar to structures but it differs in some ways. Unions can be assigned only with one field at any time. In this case, unions x and y can be assigned with any of the one field a or b or c at one time. During initialisation of unions it takes the value (whatever assigned ) only for the first field. So, The statement y = {100} intialises the union y with field a = 100. In this example, all fields of union x are assigned with some values. But at any time only one of the union field can be assigned. So, for the union x the field c is assigned as 21.50. Thus, The output will be Union 2 : 22 22 21.50 Union Y : 100 22 22 ( 22 refers unpredictable results )

L2.A4 SolutionforL2.Q4
The pointer x points to the same location where y is stored. So, The changes in y reflects in x. The output will be : 10 11 30 31 20 21 40 41

L2.A5 SolutionforL2.Q5
The output of this program is purely depends on the processor architecuture. If the sizeof integer is 4 bytes and the size of character is 1 byte (In some computers), the output will be sizeof xyz = 20 sizeof abc = 100

The output can be generalized to some extent as follows, sizeof xyz = 4 * sizeof(int) + 1 * sizeof(char) + padding bytes sizeof abc = 100 * sizeof(char) + padding bytes To keep the structures/unions byte aligned, some padding bytes are added in between the sturcture fields. In this example 3 bytes are padded between ' char ch' and 'int d' fields. The unused bytes are called holes. To understand more about padding bytes (holes) try varing the field types of the structures and see the output.

L2.A6 SolutionforL2.Q6
Just try to execute this file as such. You can find out that it will exit immediately. Do you know why? With this hint, we can trace out the error. If you look into the macro 'Error', you can easily identify that there are two separete statements without brases '{ ..}'. That is the problem. So, it exits after the calling open(). The macro should be put inside the brases like this. #define Error(str) { printf("Error : %s\n", str); exit(1); }

L2.A7 SolutionforL2.Q7
This program will fault (Memory fault/segmentation fault). Can you predict Why? Remove the statment 'free(a);' from the program, then execute the program. It will run. It gives the results correctly.

What causes 'free(a)' to generate fault? Just trace the address location of pointer variable 'a'. The variable 'a' is incremented inside the 'for loop'. Out side the 'for loop' the variable 'a' will point to 'null'. When the free() call is made, it will free the data area from the base_address (which is passed as the argument of the free call) upto the length of the data allocated previously. In this case, free() tries to free the length of 10 *sizeof(int) from the base pointer location passed as the argument to the free call, which is 'null' in this case. Thus, it generates memory fault.

L2.A8 SolutionforL2.Q8
#include main(argc, argv) int argc; char *argv[]; { int count = 0, i; int v = atoi(argv[1]); for(i=0; i<8*sizeof(int); i++) if(v &(1<< } count); v, %d='%d\n",' in 1?s of printf(?No count++;>

C Puzzles : Questions and Answers - Level 1

Questions
L1.Q1:Writetheoutputofthefollowingprogram
#include #define ABC 20 10 ABC - XYZ

#define XYZ #define XXX void main() { int

a;

a = XXX * 10; printf("%d\n", a); }

Solution for L1.Q1

L1.Q2:Writetheoutputofthisprogram
#include #define calc(a, b) void main() { int a = 20, b = 10; printf("%d\n", calc(a + 4, b -2)); } (a * b) / (a - b)

Solution for L1.Q2

L1.Q3:Whatwillbeoutputofthefollowingprogram?
#include void main() { int cnt = 5, a; do { a /= cnt; } while (cnt --); printf ("%d\n", a); }

Solution for L1.Q3

L1.Q4:Printtheoutputofthisprogram
#include void main() { int a, b, c, abc = 0; a = b = c = 40; if (c) { int abc; abc = a*b+c; } printf ("c = %d, abc = %d\n", c, abc); }

Solution for L1.Q4

L1.Q5:Printtheoutputofthisprogram
#include main() { int k = 5; if (++k < 5 && k++/5 || ++k <= 8); printf("%d\n", k); }

Solution for L1.Q5

L1.Q6:Whatistheoutputofthisprogram?
#include void fn(int, int); main() { int a = 5;

printf("Main : %d %d\n", a++, ++a); fn(a, a++); } void fn(int a, int b) { printf("Fn : a = %d \t b = %d\n", a, b); }

Solution for L1.Q6

Answers
L1.A1 SolutionforL1.Q1
a = xxx * 10 which is => a = ABC - XYZ * 10 => a = 20 - 10 * 10 => a = 20 - 100 => a = -80

L1.A2 SolutionforL1.Q2
Actual substitution is like this : calc(20+4, 10 -2) is calculated as follows (20+4 * 10-2) / (20+4 - 10-2) (20+40-2) / 12 58 / 12 = 4.8 since it is printed in %d the ans is 4

L1.A3 SolutionforL1.Q3
This problem will compile properly, but it will give run time error. It will give divide-by-zero error. Look in to the do loop portion do { a /= cnt; } while (cnt --); when the 'cnt' value is 1, it is decremented in 'while ( cnt --)' and on next reference of 'cnt' it becomes zero. a /= cnt; /* ie. a /= 0 */ which leads to divide-by-zero error.

L1.A4 SolutionforL1.Q4
the result will be c = 40 and abc = 0; because the scope of the variable 'abc' inside if(c) {.. } is not valid out side that if (.) { .. }.

L1.A5 SolutionforL1.Q5
The answer is 7. The first condition ++k < 5 is checked and it is false (Now k = 6). So, it checks the 3rd condition (or condition ++k <= 8) and (now k = 7) it is true. At this point k value is incremented by twice, hence the value of k becomes 7.

L1.A6 SolutionforL1.Q6
The solution depends on the implementation of stack. (Depends on OS) In some machines the arguments are passed from left to right to the stack. In this case the result will be Main : 5 7 Fn : 7 7 Other machines the arguments may be passed from right to left to the stack. In that case the result will be Main : 6 6 Fn : 8 7