Biennale Danza 2014. Mondo Novo. Gesto Luogo Comunità (Venezia, 19>29.06), a cura di Virgilio Sieni e Stefano Tomassini (with english texts), Venezia: La Biennale di Venezia, 2014

biennale danza 2014 mondo novo gesto luogo comunità Venezia 19>29.06 Fondazione la Biennale di Venezia Presidente President Paolo Baratta Consiglio di Amministrazione Board Giorgio Orsoni vicepresidente / vice president Luca Zaia Francesca Zaccariotto Adriano Rasi Caldogno Collegio dei Revisori dei Conti Audit Committee Marco Costantini presidente president Stefania Bortoletti Anna Maria Como Silvana Bellan supplente / deputy member Direttore Generale General Manager Andrea Del Mercato Direttore del 9. Festival Internazionale di Danza Contemporanea Director of the 9th International Festival of Contemporary Dance Virgilio Sieni la Biennale di Venezia e i suoi collaboratori per Biennale Danza 2014 la Biennale di Venezia and its collaborators for Dance Biennale 2014 Giovanni Alberti Nicola Angelillis Filippo Armellin Valentina Baldessari Cinzia Bernardi Marina Bertaggia Elisa Boato Francesca Boglietti Nicola Bon Andrea Bonaldo Caterina Boniollo Valentina Borsato Valentina Bortoli Silvia Bruni Benedetta Bruzzese Alessia Cacco Emanuela Caldirola Michela Campagnolo Giulio Cantagalli Claudia Capodiferro Graziano Carrer Maria Elena Cazzaro Maurizio Celoni Francesca Chizzola Gianpaolo Cimarosti Maria Cristina Cinti Sara Codolo Federica Colella Annamaria Colonna Elena Conti Maria Cristiana Costanzo Rosaria Crotone Luigi Cuciniello Federica Curreli Valentina Da Tos Giacinta Dalla Pietà Lara De Bellis Giulio De Leo Erica De Luigi Lucia De Manincor Caterina De Rienzo Francesco di Cesare Stefania Di Paolo Antonella Dondi Dall’Orologio Giovanni Drudi Alessandra Durand De La Penne Lia Durante Stefania Fabris Marcella Fiori Roberta Fontanin Cristiano Frizzele Giuliana Fusco Bruna Gabbiato Marica Gallina Silvia Gatto Jessica Giassi Daniela Giuliano Cristina Graziussi Valentina Greggio Stefania Guerra Laura Lamborghini Arianna Laurenzi Michela Lazzarin Elena Leonardi Maria Cristina Lion Flavia Lo Mastro Silvia Loddo Tania Lombardozzi Manuela Luca' Dazio Paolo Lughi Michele Mangione Elena Mantoan Michela Mason Pina Maugeri Elisa Meggiato Silvia Menegazzi Alessandro Mezzalira Elisabetta Mistri Manuela Momentè Nicola Monaco Sandra Montagner Annalisa Montesi Le attività del Settore Danza sono realizzate con il sostegno della Fondazione Prada The activities of the Dance Department receive the kind support of Fondazione Prada Si ringrazia Thanks to Fondazione Teatro La Fenice di Venezia Palazzo Grassi – Punta della Dogana – Pinault Collection Francesca Montorio Veronica Mozzetti Monterumici Ambra Moschini Piero Novello Elena Oselladore )DELR3DFL¿FR Emanuela Padoan Elisabetta Parmesan Paola Pavan Ilaria Pellanda Manuela Pellicciolli Daniela Persi Maddalena Pietragnoli Marta Plevani Luigi Ricciari Maya Romanelli Chiara Rossi Debora Rossi Ilaria Ruggiero Fabio Sajiz Micol Saleri Cristina Sartorel Davide Savorani Adriana Rosaria Scalise Cristiana Scavone Michele Schiavon Paolo Scibelli Antonella Sfriso Maria Stefanoni Fiorella Tagliapietra Stefano Tomassini Lucia Toso Maurizio Urso Leonardo Viale Sara Vianello Alessia Viviani Ellie Zachariadou Leandro Zennaro Jasna Zoranovic Rossella Zulian Mondo Novo p. 17 Danza & Architettura p. 125 Vangelo secondo Matteo p. 169 Le foto di dettagli per il 9. Festival Internazionale di Danza &RQWHPSRUDQHDVRQRWUDWWHGDOFLFORGLD̆UHVFKLGL*LDPEDWWLVWD Tiepolo dedicato alle Storie di Antonio e Cleopatra (1746-1747) e GDOO¶D̆UHVFR7ULRQIRGL=H¿URH)ORUD (1745), rispettivamente nel Salone da Ballo e nella Sala degli Specchi di Palazzo Labia. Si ringrazia la Rai – Sede Regionale del Veneto per la disponibilità e la collaborazione. The photos of the details for the 9th International Contemporary Dance Festival are from the cycle of frescoes by Giambattista Tiepolo dedicated to the Story of Anthony and Cleopatra (1746-1747) and from the fresco The Triumph of Zephyr and Flora (1745), respectively in the Ballroom and the Hall of Mirrors of Palazzo Labia. We wish to thank Rai – Sede Regionale del Veneto for their kindness and collaboration. Paolo Baratta Presidente della Biennale di Venezia Alcuni elementi conferiscono carattere di straordinarietà al programma de La Biennale Danza che abbraccia quest’anno un lungo periodo di attività: dalle iniziative che si VYROJHUDQQRDOOH&RUGHULH¿QGDLSULPLJLRUQL di giugno – in coincidenza con la vernice e poi nel corso della 14. Mostra Internazionale di Architettura – agli spettacoli del 9. Festival Internazionale di Danza Contemporanea, in scena dal 19 al 29 giugno, al progetto speciale del Vangelo secondo Matteo di Virgilio 6LHQL FKH YHUUj SUHVHQWDWR QHL SULPL WUH ¿QH settimana di luglio, cui è dedicato un catalogo VSHFL¿FR ¿QR DOOD PRVWUD FKH ULSHUFRUUH JOL anni sessanta e settanta alla Biennale con testimonianze di Merce Cunningham, Steve Paxton, Meredith Monk, Julian Beck, Simone Forti tratte dall’Archivio Storico/ASAC. Senza contare l’impegno del Settore nel 5. Carnevale Internazionale dei Ragazzi che si è svolto a febbraio. Collaborazione tra i Settori Lo scorso anno si caratterizzò per la partecipazione di tutti i direttori artistici della Biennale a progetti comuni come quello di Biennale College e si preannunciava una sempre maggiore convergenza delle loro diverse energie. Quest’anno per la prima volta le strutture dedicate all’esposizione di Architettura ospitano “incursioni” di Danza, Musica, Teatro e Cinema. Si tratta di attività QRQ VHPSOLFHPHQWH ḊDQFDWH H JLXVWDSSRVWH alla Mostra di Architettura, ma integrate nella Mostra in spazi dedicati, in pieno accordo con il direttore della stessa Rem Koolhaas. I nostri direttori hanno tutti raccolto lo stimolo e hanno sviluppato parte dei loro programmi all’interno delle Corderie dell’Arsenale. Sieni ha invitato artisti che trovassero uno stimolo nei tempi e nei modi di questa Mostra e negli spazi riservati e che modulassero i loro interventi di conseguenza. Sieni ha poi condiviso con Ivan Fedele (direttore del Settore Musica) la progettazione di uno spettacolo di Biennale College, nato da un percorso di formazione che ha coinvolto giovani danzatrici tra i 10 e i 15 anni (Vita Nova). Lo spettacolo, con musiche commissionate a Giovanni Dario Manzini 6 There are certain elements that lend an aura of exceptionality to the programme of the Dance Biennale, which will extend its activity this year over a longer period of time: from the initiatives that will take place in the Corderie starting in early June – during the preview and after the opening of the 14th International Architecture Exhibition – to the productions of the 9th International Contemporary Dance Festival, to be held from the 19th to the 29th of June, to the special project Vangelo secondo Matteo by 9LUJLOLR6LHQLWKDWZLOOEHSUHVHQWHGRYHUWKH¿UVW WKUHHZHHNHQGVLQ-XO\DQGWRZKLFKDVSHFL¿F catalogue is dedicated, up to the exhibition that will highlight the period of the 1960s and 70s at La Biennale with documents featuring Merce Cunningham, Steve Paxton, Meredith Monk, Julian Beck, Simone Forti, from the Historic Archives/ASAC. Not to mention the Sector’s work for the 5th International Kids’ Carnival which took place in February of this year. Collaboration between Sectors Last year, it was distinguished by the participation of all the artistic directors of La Biennale in common projects such as the Biennale College, leading to an increasing convergence of their GLYHUVH HQHUJLHV 7KLV \HDU IRU WKH ¿UVW WLPH ever, the venues dedicated to the Architecture Exhibition will host the “incursions” of Dance, Music, Theatre and Cinema. These activities will not just be added to or juxtaposed with the Architecture Exhibition, but fully integrated into the Exhibition in dedicated spaces, in total accord with its director Rem Koolhaas. Our directors have all accepted the challenge and developed part of the programmes inside the Corderie dell’Arsenale. Sieni has invited artists who were inspired by the timeframe and the modality of this Exhibition and by the reserved spaces, and they have shaped their work as a consequence. Sieni also developed a joint project with Ivan Fedele (director of the Music Sector) for a production of the Biennale College, which grew out of an educational programme involving young dancers between the ages of 10 and 15 (Vita Nova). The production, with music commissioned to Giovanni Dario Manzini and choreography by Sieni, will involve two phases H OH FRUHRJUD¿H GL 6LHQL DYUj GXH IDVL GL elaborazione: la prima all’interno del Festival di Danza e la seconda a ottobre, nel Festival di Musica. Si intitola Indigene. Ugualmente nato da una progettazione condivisa, Vesalii Icones di Peter Maxell Davies, coreografato dal giovane Jari Boldrini, debutterà nel Festival di Musica di ottobre. Biennale College e il coinvolgimento della città La Biennale Danza vuol essere anche centrale di energia per gli artisti di questa disciplina. Luogo di conoscenza approfondita delle pratiche altrui, di sperimentazione, di formazione sul campo, di cimento e di incontro tra giovani e grandi maestri. Per Biennale College – Danza sono presentati all’interno del Festival gli spettacoli di due cicli: Vita Nova (7 spettacoli) e Agorà (5 spettacoli). Sono stati selezionati 126 danzatori. Vita Nova &RUHRJUD¿ D̆HUPDWL FRQGXU ranno periodi di pratica con interpreti selezionati tra i 10 e i 15 anni in vista di una nuova creazione, commissionata dalla Biennale e focalizzata sul tema dei giochi popolari. Per Vita Nova sono state sviluppate collaborazioni con enti e istituzioni di Veneto, Toscana, Marche, Umbria, Lazio, Puglia operanti nella danza. Agorà È il coinvolgimento della città con il ciclo di brevi creazioni pensate per i campi GL9HQH]LD&RUHRJUD¿JXLGHUDQQRLGDQ]DWRUL selezionati per Biennale College – Danza. Festival Per quanto riguarda il Festival a VSHWWDFROL QDWL DOWURYH VL ḊDQFDQR FRUHRJUD¿H elaborate e performance che nascono a Venezia su commissione della Biennale (per esempio la sezione Aura, che invita a creare una performance ispirandosi al dettaglio di un dipinto della tradizione pittorica veneziana – Bellini, Tiepolo, Tintoretto, Giorgione). Sono oltre 30 gli artisti invitati, 42 gli spettacoli presentati, 26 le prime assolute, 9 le prime nazionali. Un progetto speciale Il Vangelo secondo Matteo È il progetto speciale del Festival, che ha attraversato l’Italia nel suo formarsi coinvolgendo enti e istituzioni di 5 regioni (Emilia Romagna, Basilicata, Puglia, Toscana, Trentino) e 200 interpreti tra danzatori e amatori. Alcune fasi di creazione e prove saranno mostrate negli spazi delle Corderie dell’Arsenale. L’intero ciclo di 27 quadri verrà presentato nella sua compiutezza al Teatro alle Tese: il 4, 5, 6 luglio i primi nove RI HODERUDWLRQ WKH ¿UVW DV SDUW RI WKH 'DQFH Festival and the second in October, during the Music Festival. The title of the work is Indigene. Another jointly developed work, Vesalii Icones by Peter Maxell Davies, choreographed by young Jari Boldrini, will also premiere during the Music Festival in October. Biennale College and the participation of the city The Dance Biennale also wishes to be a source of energy for the artists in this discipline. A place for an indepth exploration of the practices of others, IRU H[SHULPHQWDWLRQ IRU WUDLQLQJ RQ WKH ¿HOG a place that can bring together young people and great masters to work together. Biennale College – Dance will present the productions of two of the Festival cycles: Vita Nova (7 performances) and Agorà (5 performances). 126 dancers were selected. Vita Nova Prominent choreographers will lead periods of practice with selected performers between the ages of 10 and 15 in order to develop a new production, commissioned by La Biennale and centering on the theme of folk games. For Vita Nova, collaborations were initiated with organizations and institutions working in the ¿HOG RI GDQFH LQ 9HQHWR 7XVFDQ\ 0DUFKH Umbria, Lazio, Puglia. Agorà This represents the involvement of the city with a cycle of short creations conceived for the campi, the city squares in Venice. Choreographers will lead the dancers selected for the Biennale College – Dance. Festival As for the Festival, the productions that were created elsewhere will be joined by choreographies and performances that were developed or created in Venice on commission by La Biennale (for example the Aura section, an invitation to create a performance inspired by a detail of a painting representing the Venetian painting tradition – Bellini, Tiepolo, Tintoretto, Giorgione). There will be over 30 guest artists, 42 performances, 26 world premieres, 9 Italian premieres. A special project Il Vangelo secondo Matteo This is the Festival’s special project, which took form all across Italy and involved RUJDQL]DWLRQVDQGLQVWLWXWLRQVIURPGL̆HUHQW regions (Emilia Romagna, Basilicata, Puglia, Tuscany Trentino), with 200 performers including dancers and amateurs. Some of 7 quadri; i successivi nove l’11, 12, 13 luglio; gli ultimi nove quadri il 17 e 18 luglio. Gli spazi 21 sono gli spazi utilizzati: dai Campi di Venezia (S. Angelo, Pisani, Novo, S. Maurizio), ai luoghi della Biennale (Teatro alle Tese, Teatro Piccolo Arsenale, Corderie, &D¶ *LXVWLQLDQ  ¿QR DG DOWUL VSD]L FLWWDGLQL come il Conservatorio, il Teatro Malibran e il Teatrino di Palazzo Grassi, con cui la Biennale collabora per la prima volta. Sostenitori o donors L'attività di quest'anno in particolare il progetto Vangelo secondo Matteo hanno potuto essere realizzati grazie anche al contributo della Fondazione Prada cui va il nostro ringraziamento. Grazie anche al contributo fattivo di tante istituzioni e soggetti che mi piace qui ricordare. L’Institut IUDQoDLV O¶$PEDVFLDWD G¶2ODQGD O¶8̇FLR Culturale dell’Ambasciata d’Israele che hanno contribuito alla realizzazione di alcuni spettacoli. Il ciclo di danze Vita Nova è stato realizzato in collaborazione con Fondazione Romaeuropa – Attività di promozione danza, AMAT & Civitanova Danza per Civitanova Casa della Danza, Unione Europea Regione Puglia, Teatro Pubblico Pugliese, Teatro Stabile dell’Umbria, CSC Centro per la Scena Contemporanea_Casa della danza di Bassano del Grappa sostenuto dalla Regione del Veneto, Regione Toscana, Accademia sull’arte del gesto. ll Vangelo secondo Matteo verrà realizzato con il sostegno di Fondazione I Teatri di Reggio Emilia, Ert Emilia Romagna Teatro, Teatro Pubblico Pugliese, Crest, Regione Toscana, CID Centro Internazionale della Danza e Festival Oriente Occidente, Comune di Matera, Comitato Matera 2019, Soprintendenza BSAE della Basilicata, Basilicata 1799/Festival Città delle 100 scale. Il Teatro La Fenice ci ha concesso lo spazio del Teatro Malibran. Palazzo Grassi ospiterà negli spazi del Teatrino di Palazzo Grassi 5 degli spettacoli in programma nel Festival (per un totale di 16 rappresentazioni). Un ringraziamento sentito a tutti quanti hanno dato le loro energie creative e professionali in questo lavoro corale. 8 the phases of creation and rehearsals will be open to the public in the spaces of the Corderie dell’Arsenale. The entire cycle of 27 tableaux ZLOOEHSUHVHQWHGLQWKH¿QLVKHGYHUVLRQDWWKH Teatro alle Tese: on the 4th, 5th and 6th of July WKH¿UVWQLQHWDEOHDX[WKHQH[WQLQHRQWKHWK WKDQGWKRI-XO\WKHODVWQLQHWDEOHDX[RQ the 17th and 18th of July. The spaces  GL̆HUHQW VSDFHV ZLOO EH used: from the campi in Venice (S.Angelo, Pisani, Novo, S. Maurizio), to the venues of La Biennale (Teatro alle Tese, Teatro Piccolo Arsenale, Corderie, Ca’ Giustinian), to further spaces in the city such as the Conservatory, the Teatro Malibran and the Teatrino at Palazzo Grassi, with which La Biennale is collaborating IRUWKH¿UVWWLPH Supporters or donors This year’s activities, and in particular the project Vangelo secondo Matteo, were made possible by the contribution of the Fondazione Prada whom we now wish to thank. We would also like to thank the many institutions and subjects who FRQWULEXWHG WKHLU H̆RUWV VXFK DV WKH ,QVWLWXW français, the Embassy of Holland, the Cultural 2̇FH RI WKH ,VUDHOL (PEDVV\ ZKLFK VXSSRUWHG the realization of several performances. The Vita Nova cycle of dances was developed in collaboration with the Fondazione Romaeuropa – Dance promotion, AMAT & Civitanova Danza for Civitanova Casa della Danza, European Union Puglia Region, Teatro Pubblico Pugliese, Teatro Stabile dell’Umbria, CSC Centro per la Scena Contemporanea_Casa della danza di Bassano del Grappa with the support of the Regione del Veneto, Regione Toscana, Accademia sull’arte del gesto. The Vangelo secondo Matteo is made possible by the support of the Fondazione I Teatri di Reggio Emilia, Ert Emilia Romagna Teatro, Teatro Pubblico Pugliese, Crest, Regione Toscana, CID Centro Internazionale della Danza and Festival Oriente Occidente, Comune di Matera, Comitato Matera 2019, Soprintendenza BSAE della Basilicata, Basilicata 1799/Festival Città delle 100 scale. The Teatro La Fenice has JHQHURXVO\ R̆HUHG WKH VSDFHV RI WKH 7HDWUR Malibran. Palazzo Grassi will be the venue, in the spaces of the Teatrino di Palazzo Grassi, for 5 of the productions in the Festival programme (for a total of 16 performances). We would especially like to thank everyone who donated their creative DQGSURIHVVLRQDOHQHUJLHVWRWKLVFRQFHUWHGH̆RUW BIENNALE DANZA 19>29.06> 9. Festival Internazionale di Danza Contemporanea/Mondo Novo 7>29.06> Danza & Architettura/Polis Corderie 4>18.07> Vangelo secondo Matteo/27 quadri Virgilio Sieni Direttore Settore Danza Il 9. Festival Internazionale di Danza Contemporanea Mondo Novo – gesto luogo comunità è l'approdo di un lungo percorso GL ULÀHVVLRQH H GL ULFHUFD DUWLVWL QD]LRQDOL H internazionali sono stati invitati a interrogarsi sulla relazione tra corpo e luogo. La città è stata immaginata, tracciata da nuovi sentieri, proposta per creare passaggi, viaggi e percorsi di ricerca che aprono lo sguardo dello spettatore a una nuova frequentazione del gesto. ,O)HVWLYDOLQWHQGHSURSRUUHXQDJHRJUD¿D di esperienze dislocate in un’articolazione di spazi tra il centro della città e l’area dell’Arsenale, spazi al chiuso e all’aperto, rivisitando il modo di stare tra i margini dei campi all’aperto e la capacità di accoglienza degli altri luoghi. Agiremo secondo l’idea di Polis, cioè di un arcipelago organico di avvenimenti tra pratiche e visioni. Desideriamo che il pubblico, il viaggiatore, colui che dona il proprio tempo per WUDFFLDUHXQOHJDPHFRQLOJHVWRHODFRUHRJUD¿D trovi l’opportunità di praticare a sua volta uno spostamento ricco e complesso. Il Festival propone tre aree di visione attive durante tutte le giornate, dalla mattina alla sera, che ospiteranno ciascuna una serie GL VSHWWDFROL D]LRQL FRUHRJUD¿FKH SUDWLFKH e dialoghi: Polis San Marco, Polis Corderie e Polis Arsenale. Ed è articolato secondo diverse sezioni: Aperto, Aura, Vita Nova, Invenzioni, Agorà, Prima Danza e Boschetto. &RLQYROJHUHPR  FRUHRJUD¿ LQ GLDORJR con 20 spazi, allo scopo di creare un respiro tra interno ed esterno. Ogni artista ospite lavorerà VHFRQGR XQD GXUDWD H XQ WHPSR ḊQFKp OD propria presenza al Festival sia il risultato di SHUFRUVL GL FUHD]LRQH ODERUDWRUL YHUL¿FKH presentazioni, tutte esperienze rivolte a The 9th International Contemporary Dance Festival Mondo novo – gesture place community is the end point of an extended process of thought and research: national and international artists were invited to explore the relationship between body and place. The city was imagined, scored with new paths, proposed for the creation of crossings, journeys and research processes that open the spectator’s gaze to a new engagement with gesture. The Festival intends to present a geography of experiences spread across a network of spaces between the centre of the city and the area of the Arsenale, both indoor and outdoor spaces, to reinterpret our way of being between the margins of the outdoor city squares and the capacity for hospitality of other places. We will base our work on the idea of Polis, of an organic archipelago of events that include both practices and visions. We would like the audience, the traveller, the individual who donates his time to trace a relationship with gesture and choreography, to personally take the opportunity to practice a rich and complex crossing. 7KH )HVWLYDO R̆HUV WKUHH DUHDV RI DFWLYH visions all day long every day, from morning to evening, featuring a series of performances, choreographic actions, practices and dialogues: Polis San Marco, Polis Corderie and Polis$UVHQDOH,WLVGLYLGHGLQWRGL̆HUHQW sections: Aperto, Aura, Vita Nova, Invenzioni, Agorà, Prima Danza and Boschetto. We will involve 30 choreographers in a dialogue with 20 spaces, in order that inside and outside may breathe together. Each guest artist will work within a timeframe and a schedule so that his presence at the Festival 9 professionisti, giovanissimi danzatori tra i 10 H L  DQQL QRQ YHGHQWL FRUDOL PDGUL H ¿JOL coppie di anziani. Una durata che permetterà a questi artisti di trasmettere ai danzatori le pratiche della tattilità e della manualità, della complessità insita nell’accostarsi all’altro, nell’approssimarsi alla natura della costruzione attraverso il gesto e l’umano del corpo. Il Festival proporrà un continuum di VSHWWDFROLEUDQLFRUHRJUD¿FLHSHUIRUPDQFHFKH abiteranno luoghi pensati in dialogo l’uno con l’altro. Ogni giorno apre a un viaggio di visioni e di esperienze che rappresentano altrettanti punti di ricerca verso il luogo, il corpo, il senso di comunità: in questo modo nasce la Polis quale entità che ospita e prende vita attraverso l’atto del corpo e la complessità delle forme. Verranno presentate 26 prime mondiali, 100 repliche che si disporranno in calendari quotidiani da frequentare come un cammino. L’artista sarà dunque chiamato a confrontarsi con una pratica di trasmissione e a inserire la propria opera/percorso in un crocevia di esperienze. L’adiacenza al corpo e al gesto dell’altro, nelle sue forme fondate sulla diversità dell’individuo, ci invita a una ULÀHVVLRQH FKH VL ULQQRYD D RJQL YHUL¿FD L’impoverimento della postura umana si apre così a un atteggiamento di presenza e ascolto. /D YLWD VWHVVD QHOOR VFRUUHUH ¿JXUDOH della dinamica corporea, ci coglie nell’atto del guardare, spostandoci letteralmente dall’interno: cogliere questo spostamento è il gesto richiesto sia all’artista che allo spettatore HLQTXHVWRVLDUWLFRODODJHRJUD¿DGHO)HVWLYDO Danza & Architettura/ Polis Corderie Il Festival include l’esperienza alle Corderie dell’Arsenale, risultato di un inedito dialogo con la 14. Mostra Internazionale di Architettura diretta da Rem Koolhaas. Per la prima volta l’architettura guarda alla danza, e viceversa, attraverso un progetto pensato organicamente per abitare gli spazi espositivi della mostra. La collaborazione è nata con l’intento di ripensare integralmente i concetti di pratica H IUHTXHQWD]LRQH 7XWWL L FRUHRJUD¿ RVSLWL DOOH Corderie daranno vita a un ciclo continuo di SHUFRUVLFUHDWLYLDOWHUQDWLDYHUL¿FKHVHQ]DVRVWD rinunciando al segreto del processo e aprendo al pubblico ogni fase di elaborazione: una nuova città fatta di risonanze e atti creativi. 10 is the outcome of processes of creation, workshops, evaluations, presentations, all of them experiences involving professionals, young dancers between the ages of 10 and 15, blind dancers, groups, mothers and children, elderly couples. The timeframe will make it possible for these artists to transmit to the dancers practices of tactility and of the hands, of the complexity inherent in approaching the other and in apprehending the nature of construction through the gesture and humanity of the body. 7KH )HVWLYDO ZLOO R̆HU D continuum of productions, choreographic pieces and performances that will inhabit places conceived to be engaged in dialogue with one another. Each day will lead into a journey of visions and experiences that ZLOO HDFK UHSUHVHQW D GL̆HUHQW WKHPH RI research into the place, the body, the sense of community, thereby generating the Polis as an entity that receives and comes to life through the act of the body and the complexity of forms. There will be 26 world premieres, 100 repeat performances organized across a daily schedule to be experienced as a journey. The artist will therefore be required to engage in the practice of transmission and to integrate his own work/process into a crossroads of experiences. The adjacency to the body and gesture of the other, in its forms founded on the diversity of each individual, encourages a thought process that is renewed every time it must be YHUL¿HG 7KH LPSRYHULVKHG KXPDQ SRVWXUH thereby opens to an attitude of presence and listening. /LIH LWVHOI LQ WKH ¿JXUDO ÀRZ RI WKH body’s dynamic, catches us in the act of looking, literally moving us from the inside: capturing this shift is the gesture we seek from both the artist and the spectator and this is the core of the geography of the Festival. Dance & Architecture/ Polis Corderie The Festival includes the experience at the Corderie dell’Arsenale, the result of an original dialogue with the 14th International Architecture Exhibition directed by Rem Vangelo secondo Matteo Il progetto presenta in prima mondiale XQ¶RSHUDFRPSRVWDGDD]LRQLFRUHRJUD¿FKH ispirate al Vangelo secondo Matteo. Le creazioni hanno coinvolto 200 interpreti nei loro territori di origine, dal Trentino alla Puglia, comprendendo il Veneto, l’Emilia Romagna, la Toscana e la Basilicata, che saranno presentate a Venezia in tre cicli. Ognuno dei quali accoglie, al pari di XQ¶DJRUj QRYH TXDGUL FRUHRJUD¿FL HVHJXLWL simultaneamente, lasciando al pubblico la possibilità di determinare il proprio percorso tra soste, cammini e ritorni. La simultaneità delle azioni, colte nel loro insieme, costituirà il continuo farsi fra gli arti e le nervature di un solo corpo. Le attività del Settore Danza 2014 sono realizzate in collaborazione con la Fondazione Prada che ringrazio per il suo contributo. .RROKDDV )RU WKH ¿UVW WLPH DUFKLWHFWXUH looks to dance, and vice-versa, in a project organically conceived to inhabit the gallery spaces of the Exhibition. The collaboration was initiated with the intent to drastically rethink the concepts of practice and frequentation. Together the guest choreographers at the Corderie will create a continuous cycle of creative processes alternating with unremitting evaluations, renouncing the secrecy of the process and opening each phase of elaboration to the public eye: a new city made of resonances and creative acts. Vangelo secondo Matteo The project presents the world premiere of a work consisting in 27 choreographic actions inspired by the Gospel according to Matthew. The creations involved over 200 performers in their native regions, from the Trentino in the north to Puglia in the south, and including the Veneto, Emilia Romagna, Tuscany and Basilicata regions. They will be presented in Venice in three GL̆HUHQW F\FOHV (DFK RI WKHP ZLOO LQFOXGH like an agorà, nine choreographic tableaux performed simultaneously, allowing the audience to decide on its own where to stop, to walk, to turn back. The simultaneous actions, taken as a whole, will constitute the continuous formation of the limbs and nerves of a single body. The activities of the Dance Sector 2014 are developed in collaboration with the Fondazione Prada, which I wish to thank for its contribution. 11 STEVE PAxTON Leone d’oro alla carriera Golden Lion for Lifetime per la Danza Achievement in Dance Il Leone d’oro alla carriera è stato attribuito a Steve Paxton per aver aperto il luogo della danza allo studio capillare del movimento come fonte continua di origini proiettando la ricerca sulla gravità al sistema delle articolazioni e intuendo prima di tutti, XQDGDQ]DWUDDVFROWRHWUDV¿JXUD]LRQHGHOOH tecniche. Emerge una percezione dell’essere umano che eleva la danza a valore fondante della cultura e dei sistemi di relazione. La continua frequentazione del gesto, ci ha indicato come l’uomo possa ampliare la sua visione sul mondo congiungendo la memoria alla consapevolezza di appartenere a un corpo e aprendo “silenziosamente” strade LQQRYDWLYH D XQD ULFHUFD VFRQ¿QDWD LQ WXWWH le arti. The Golden Lion for Lifetime Achievement has been awarded to Steve Paxton for having opened the space of dance to a capillary study of movement as a constant source of origins projecting his experimentation with gravity onto the system of articulations and being the ¿UVWWRLQVWLQFWLYHO\SHUFHLYHGDQFHDVOLVWHQLQJ DQG WKH WUDQV¿JXUDWLRQ RI WHFKQLTXHV 7KH perception of the human being that emerges elevates dance to a founding value of culture and of systems of relations. The constant exercise of gesture has shown us how man can expand his vision of the world by linking memory to the awareness of belonging to a body and “silently” opening innovative paths to unlimited experimentation in all the arts. 13 MIChELE DI STEFANO Leone d’argento per la Danza Silver Lion for Dance Il Leone d’argento per la Danza è stato attribuito a Michele Di Stefano per DYHU LQWURGRWWR DWWUDYHUVR OD FRUHRJUD¿D un corpo vibratile e musicale coincidente con l’immagine dell’uomo in continua RVVHUYD]LRQHGHOSDHVDJJLRHGHOODJHRJUD¿D Per aver scelto il linguaggio della danza allo scopo di dar luogo a camminamenti antropologici che ci lasciano intuire la presenza di tribù organizzate per posture, dinamiche irregolari, e decostruzione dei perimetri spaziali, all’interno di ciascuno di noi. Michele Di Stefano ci illustra col corpo OD IDXQD H OD ÀRUD FKH LQVLHPH LUURUDQR OD FDSDFLWjGHOO¶XRPRGLWUDV¿JXUDUVLHVDOYDUVL col gesto della danza. The Silver Lion for Dance has been awarded to Michele Di Stefano for introducing, in choreography, a vibrating musical body that corresponds to the image of man and his ceaseless observation of geography and the landscape. For having chosen the language of dance as a means to generate anthropological journeys that lead us to discern within each of us the presence of tribes organized in terms of posture, irregular dynamics and the deconstruction of spatial perimeters. Michele Di Stefano uses his body to illustrate the fauna and the ÀRUD WKDW WRJHWKHU IHHG PDQ¶V FDSDFLW\ IRU WUDQV¿JXUDWLRQDQGVDOYDWLRQWKURXJKWKH gesture of dance. 14 9. FESTIVAL INTERNAzIONALE DI DANzA CONTEMPORANEA Mondo Novo gesto luogo comunità 19>29.06.2014 Come monadi esitanti nel Mondo Novo Like hesitating monads in the Mondo Novo Stefano Tomassini $SURSRVLWRGHOO¶DUUHVWRPHVVLDQLFRGHOO¶DFFDGHUHVLSRWUHEEHDGGXUUHODGH¿QL]LRQHGHOOR “stile classico” in [henri] Focillon: «Breve istante di pieno possesso delle forme [...]: il giogo della bilancia ormai oscilla solo debolmente. Ciò che aspetto non è di vederla ben SUHVWRLQFOLQDUVLGLQXRYRDQFRUPHQRDWWHQGRLOPRPHQWRGHOOD¿VVLWjDVVROXWDPDQHO miracolo di questa immobilità esitante, il tremolio leggero, impercettibile, che mi indichi che essa vive». 5HJDUGLQJWKHPHVVLDQLFVWDQGVWLOORIWLPHRQHPLJKWUHIHUWRWKHGH¿QLWLRQRIWKH³FODVVLF style” in [Henri] Focillon: «A brief instant of the full possession of forms […]:the yoke of the scale now oscillates only weakly. I do not expect to see a balance again weighing RYHUWRRQHVLGHDQGHYHQOHVVWKHPRPHQWRILWVDEVROXWH¿[LW\EXWLPSHUFHSWLEOHOLJKW wobbling to prove it is alive, in the miracle of this hesitating immobility». Walter Benjamin Il programma di un Festival è sempre insieme un mondo e una monade. Come mondo, organizzato in uno spazio, esso è ciclico. Come monade, che balza invece fuori dal continuum del tempo, esso è discontinuità. Virgilio Sieni sembra aver perfettamente concertato questi due irrinunciabili bisogni nel suo progetto triennale per Biennale Danza. Già nel 2013, con Abitare il mondo. Trasmissione e pratiche, la dimensione dell’ascolto del gesto e del passaggio delle memorie hanno inaugurato nuove possibilità di impostare il rapporto tra i corpi e l’ambiente. In una stretta dialettica tra atti di conoscenza e dirette esperienze della prassi, GRSR TXDVL GXH PHVL GL LQFRQWUL H ULÀHVVLRQL di pratiche e creazioni, è emersa una nuova unità costitutiva di tutti i lavori: il gesto è la via per entrare in relazione con l’altro. Tutto il mondo può dunque danzare. E lo abbiamo YLVWR VRSUDWWXWWR QHL FRUSL GL PDGUL ¿JOL anziani, artigiani e bambini. Si tratta di respiri, attese, quadri di corpi mobili, eseguiti anche tra imbarazzi, esitazioni, errori e perdite, ma che non possono essere fermati per essere JLXGLFDWL Qp LVRODWL SHU HVVHUH FRPSUHVL 'HYRQRHVVHUHODVFLDWLÀXLUH$RJQLVSHWWDWRUH 18 9. Festival Internazionale di Danza Contemporanea A Festival programme is always both a world and a monad. As a world, organized in a space, it is cyclical. As a monad, which on the contrary leaps out of the continuum of time, it is discontinuity. Virgilio Sieni seems to have perfectly orchestrated these two essential needs in his three-year project for the Dance Biennale. Last year, in 2013, in Living in the World. Transmission and practices, the dimension of listening in the gesture and the passing down of memories inaugurated new possibilities of shaping the relationship between bodies and the environment. In a tight dialectic rapport between cognitive acts and direct experiences of practice, after almost two months of meetings and UHÀHFWLRQRISUDFWLFHVDQGFUHDWLRQVDQHZ constituent unity between all the works emerged: gesture is the means by which to enter into a relationship with the Other. This means that everyone in the world can dance. And we have observed this in particular in the bodies of mothers, children, elderly people, craftsmen and children. We saw breathing, pauses, tableaux of still bodies, performed with embarrassment, hesitation, resta la possibilità di una emozione concorde o GLXQSLGL̇FLOHHQHJR]LDWRULFRQRVFLPHQWR Questo è stato uno dei modi di comprendere e abitare il mondo con le attività di formazione per Biennale College Danza 2013. Con l’articolato programma del 9. Festival Internazionale di Danza Contemporanea Mondo Novo – gesto luogo comunità (19>29 giugno), Virgilio Sieni prova ora a rifondare soprattutto la relazione tra il dentro e il fuori, i teatri e i campi, e a ridiscutere lo VSD]LR GHOOD SHUIRUPDQFH QHOOD JHRJUD¿D urbana. Un programma anticipato, in alcune delle sue esperienze, all’interno delle Corderie dell’Arsenale (7>29 giugno) in stretto dialogo con la 14. Mostra Internazionale di Architettura diretta da Rem Koolhaas. Qui i processi di FUHD]LRQH GHL FRUHRJUD¿ HQWUDQR D IDU SDUWH degli spazî espositivi, animano di presenze una lunga serie di palchi che per la prima volta sono stati costruiti apposta per accompagnare LOFDPPLQRHVSRVLWLYRḊQFKpO¶LQFRQWURHOD relazione, tra visitatori e performer, produca una continua metamorfosi dello sguardo, una continua apertura alle ragioni dell’altro. Sette unità (Aperto, Aura, Vita Nova, Invenzioni, Agorà, Prima Danza e Boschetto) mistakes and loss, but which cannot be stopped to be judged, nor isolated to be XQGHUVWRRG 7KH\ PXVW EH DOORZHG WR ÀRZ Each spectator is left with the possibility of IHHOLQJDVKDUHGHPRWLRQRUDPRUHGL̇FXOW negotiated acknowledgment. This was one of the ways of understanding and living in the world with the educational activities of the Biennale College – Dance 2013. In the highly articulated programme of the 9th International Contemporary Dance Festival Mondo Novo – gesture place community (19>29 June), Virgilio Sieni now tries to establish a new foundation particularly for the relationship between inside and outside, the theatres and the city squares, and to debate the space of performance within the urban geography. A program that will be anticipated, in some of its experiences, in the Corderie dell’Arsenale (7>29 June) in a close dialogue with the 14th International Architecture Exhibition directed by Rem Koolhaas. Now the processes of creation by the choreographers will EHFRPHSDUWRIWKHH[KLELWLRQVSDFHVZLOO¿OO with presences a long series of stages that for WKH¿UVWWLPHHYHUZLOOEHEXLOWVSHFL¿FDOO\WR 9. Festival Internazionale di Danza Contemporanea 19 compongono invece la molteplicità del programma di Mondo Novo – gesto luogo comunità, che non si esaurisce nell’ordine cronologico del Festival (19-29 giugno) ma FKH LQ HVVR WURYD XQ¶XOWHULRUH VWUDWL¿FD]LRQH della ricerca di Sieni: creare aperture, punti di vista, osservazioni e fessure da cui provare a fare chiarezza, da cui provare a formulare nuove modalità di relazione fra i corpi. Ed è un cómpito questo a cui la danza contemporanea non dovrebbe mai sottrarsi. Queste unità o sezioni, luoghi di lavoro, VSD]v GL LQFRQWUR ]RQH GL RVSLWDOLWj H FRQ¿QL sempre disgiunti di un incessante accadere, sono disposte a rete, continuamente ripiegate per raddoppiare gli eventi e riprodurre una sorta di incarnazione virtuale: la materia di una nuova comunità, la vita di una nuova Polis. E non può non tornare alla mente l’idea di città invisibile, che contiene il suo passato «come le linee d’una mano», anche ingannatrice e sempre mutante, descritta in una pluralità di immagini da Italo Calvino: «Ogni città riceve la sua forma dal deserto a cui si oppone». Così come ogni spettatore è un viaggiatore, capace di riconoscere quel poco che ha e che gli appartiene, e deve scoprire, fra campi e teatri, «il molto che non ha avuto e non avrà». Per questo il primo lavoro del suo sguardo è quello GL ©ULFRQRVFHUH ¿JXUHª QHOOD FXL ULSHWL]LRQH ©TXDOFRVD DUULYL D ¿VVDUVL QHOOD PHQWHª In questa ridondanza, il deserto sparisce e qualcosa comincia a esistere. In ApertoLFRUHRJUD¿RVSLWDWLR̆URQRXQ largo panorama della danza contemporanea nazionale e internazionale, tutti accomunati GD XQD IRUWH ORJLFD FRUHRJUD¿FD QRQ LQ autonomia ma in aperto scambio con le altre sezioni del Festival. Qui gli incontri, anche indiretti, fra culture del corpo diverse, come ad esempio fra Oriente e Occidente, sembrano moltiplicare nuove intenzioni, mostrare SRVVLELOL GL̆HUHQ]H TXDVL FRPH SHU IDYRULUH attraverso la danza un nuovo gioco dello 20 9. Festival Internazionale di Danza Contemporanea accompany the exhibition route so that the encounter and rapport between the visitor and performer may produce a continuous metamorphosis of the gaze, an attitude of openness towards the reasons of the Other. Seven units (Aperto, Aura, Vita Nova, Invenzioni, Agorà, Prima Danza and Boschetto) will bring multiplicity to the programme of Mondo Novo – gesture place community, which will not end with the chronological order of the Festival  -XQH  EXW ZLOO ¿QG WKHUH D IXUWKHU VWUDWL¿FDWLRQ RI 6LHQL¶V UHVHDUFK WR FUHDWH openings, points of view, observations and ¿VVXUHV DV WKH VWDUWLQJ SRLQW IRU JUHDWHU clarity, for formulating new ways for bodies to relate to one another. This is a responsibility that contemporary dance can never shirk. These units or sections, workplaces, spaces for encounter, zones of hospitality and the discontinuous borders of a constancy of events, are arranged as a network, folded over to double the events and imitate a sort of virtual incarnation: the material of a new community, the life of a new Polis. And the mind necessarily turns to the idea of invisible city, which contains its past «like the lines of a hand», which may be deceptive but is always changing, described in a plurality of images by Italo Calvino: «Each city receives its form in the desert to which it is opposed». Thus every spectator is a traveller, capable of recognizing what little he has and that belongs to him, who must discover, between town squares and theatres, «the much that he has not had and will not have». 7KDWLVZK\WKH¿UVWWDVNIRUKLVJD]HLVWKH «UHFRJQLWLRQ RI ¿JXUHV», which will be repeated so that «something will remain embedded in the mind». This redundancy will cause the desert to disappear and bring something into existence. In Aperto, the guest choreographers R̆HU DQ DPSOH VXUYH\ RI ,WDOLDQ DQG international contemporary dance, all linked scambio delle memorie e del dono di nuovi desideri. Anche la consegna del Leone d’oro alla carriera a Steve Paxton, non è soltanto il dovuto riconoscimento a un maestro indiscusso della danza contemporanea, la FXL ULÀHVVLRQH VXO contact improvisation ha interessato negli anni molti generi e culture del corpo. È anche una forte indicazione a favore GL XQ JHVWR PDL GLVJLXQWR GDOOD ULÀHVVLRQH dalla relazione e dalla condivisione ossia, e non a caso, dalla pratica e dalla sua trasmissione. Per di più, il lavoro e la ricerca di Paxton, negli anni, si sono svolti sempre con una chiarezza intellettuale incapace di compromessi con il mercato e l’omologazione globale. Un esempio di fedeltà e rigore della sua ricerca sul corpo, sulla generazione del movimento e sulle forze all’opera nell’improvviso incontro tra corpi, che ha cambiato per sempre il modo di intendere e concepire il linguaggio contemporaneo della danza. Il Leone d’argento quest’anno è consegnato a Michele Di Stefano, coreografo estremamente rappresentativo di una gran parte della nuova VFHQDFRUHRJUD¿FDLWDOLDQDSHUODVXDDWWHQ]LRQH al rapporto tra la presenza scenica del performer e l’autonomia del segno visivo, in lavori che puntano a sfatare i miti dispotici dell’esotismo turistico, decostruendo lo spazio coloniale dello sguardo occidentale per mostrarne tutta la ¿WWL]LDWUDVSDUHQ]D Nella sezione Aura ha luogo uno dei più importanti esperimenti di questa Biennale, forse per la prima volta abbattendo realmente L FRQ¿QL WUD VSD]LR GHOOD SHUIRUPDQFH H museo, tra l’aura istituzionale del nostro immenso patrimonio visivo e la precarietà non meno luminosa dei corpi e dei gesti dei performer. L’inedito incontro di cinque FRUHRJUD¿ FRQ DOFXQH SLWWXUH YHQH]LDQH (Tiepolo, Bellini, Giorgione, Tintoretto) da cui WUDUUDQQR XQD ULÀHVVLRQH H XQD SHUIRUPDQFH magari attraverso solo un dettaglio, un gesto QDVFRVWRRXQD¿JXUDGLVELHFRTXDQGRQRQ più in generale sul senso della relazione con by a strong choreographic logic pursued not independently but in an open exchange with the other sections of the Festival. Here the encounters, even when indirect, between GL̆HUHQW FXOWXUHV RI WKH ERG\ IRU H[DPSOH between East and West, seem to multiply new intentions, demonstrate possible GL̆HUHQFHV DV LI WR HQFRXUDJH GDQFH DV D new form of play for exchanging memories and bestowing new desires. The attribution of the Golden Lion for Lifetime Achievement to Steve Paxton is not only a well-deserved acknowledgment for an indisputable master RI FRQWHPSRUDU\ GDQFH ZKRVH UHÀHFWLRQ on contact improvisation has involved RYHU WKH \HDUV D YDULHW\ RI GL̆HUHQW JHQUHV and cultures of the body. It is also a strong signal in favour of a gesture that is always DFFRPSDQLHG E\ UHÀHFWLRQ UHODWLRQ DQG sharing and hence, not coincidentally, by practice and its transmission. Furthermore, over the years Paxton’s work and research have always demonstrated an intellectual clarity incapable of compromise with the market and global standardization. A example of faith and severity in his research on the body, on the generation of movement and on the forces at work in the sudden meeting of bodies, that has forever changed our way of understanding and conceiving the contemporary language of dance. The Silver Lion this year has been awarded to Michele Di Stefano, a choreographer who is particularly representative of a large part of the new Italian choreographic scene, for his attention to the relationship between the presence on stage of the performer and the independence of the visual imprint, in works that seek to dispel the despotic myths of touristic exoticism, deconstructing the colonial space of the western point of view to reveal the falseness of its transparency. The Aura section will feature one of the most important experiments of this Biennale, SHUKDSVIRUWKH¿UVWWLPHHYHUWUXO\EUHDNLQJ 9. Festival Internazionale di Danza Contemporanea 21 un’opera d’arte, sembra invitare l’attenzione dello spettatore, che vi assisterà, su più piani. Il patrimonio artistico di Venezia diventa qui il materiale principale di un nuovo processo creativo: il coreografo si dona all’opera mostrandone inedite letture e OHJDQGRVLDHVVDDWWUDYHUVRXQDULÀHVVLRQHFKH riguarda il senso del gesto e la forza della sua generazione. Lo spettatore riscopre, invece e in modo inedito, nella nuova vita se pur parziale o comunque personale di un’opera, la vitalità del passato attraverso i corpi del SUHVHQWH ,Q TXHVWD ULVFRSHUWD OD ¿VVLWj GHO dipinto esposto si muove, attraverso l’evento e nell’immaginazione dello spettatore, verso una nuova convergenza, una nuova reciproca appropriazione della vita dell’opera, e della UHDOWjGHOPRQGRFKH¿QGDOODVXDUHDOL]]D]LRQH in essa ha preso corpo. Vita Nova è un progetto che incomincia a mostrare un suo forte spessore: investe prima di tutto la passione di trasmettere il fare e il trasformare attraverso i corpi delle nuove generazioni di interpreti, quest’anno tutti tra i 10 e i 15 anni. Per il coreografo, nel cambiamento, qualcosa va perduto e qualcosa si crea, ma è pur sempre l’esperienza del singolo giovane danzatore che cambia di stato o di forma, già durante la fase di creazione, ed è questa una consegna autenticamente etica. Comprende il coinvolgimento dei sensi nella FRPSUHQVLRQHGLVpHQHOODUHOD]LRQHFRQO¶DOWUR un nuovo agire del corpo che ci informa delle disposizioni necessarie per poter rovesciare le abitudini e far crescere la consapevolezza, in questi giovani corpi, che occorre saper operare delle scelte. La ricerca di un nuovo repertorio di danza destinato a giovanissimi interpreti q ḊGDWR TXHVW¶DQQR D XQ QXWULWR JUXSSR di coreografe italiane, Cristina Rizzo, helen Cerina, Simona Bertozzi, Adriana Borriello, allo stesso Sieni e al coreografo norvegese Stian Danielsen, in dialogo anche con note musiche di repertorio o appositamente create per il progetto, ma tutti operativi sul territorio 22 9. Festival Internazionale di Danza Contemporanea down the boundaries between the space of performance and the museum, between the institutional aura of our immense visual heritage and the no less luminous transience of the bodies and gestures of the performers. The unprecedented encounter RI¿YHFKRUHRJUDSKHUVZLWKVHYHUDO9HQHWLDQ paintings (Tiepolo, Bellini, Giorgione, Tintoretto) from which they have drawn D UHÀHFWLRQ DQG D SHUIRUPDQFH LQVSLUHG perhaps by a simple detail, a hidden gesture, D¿JXUHVHHQIURPWKHVLGHRUPRUHLQJHQHUDO the sense of the relationship with a work of art, seems to draw the attention of the spectator, who will be watching, to various levels. Venice’s artistic heritage has now become the primary material for a new creative process: the choreographer gives himself to the work, revealing new readings and creates DERQGZLWKLWIRXQGHGRQDUHÀHFWLRQDERXW the meaning of gesture and the power of its generation. The spectator on the other hand, LQDGL̆HUHQWZD\UHGLVFRYHUVLQWKHQHZOLIH of a work, no matter how partial or personal, the vitality of the past through the bodies of the present. In this process of discovery, the immobility of the painting on exhibit begins to move, through the event and in the imagination of the spectator, towards a new convergence, a new reciprocal acquisition of the life of the painting, and of the reality of the world that came to life in it from the very moment that it was completed. Vita Nova is a project that is beginning WR UHYHDO LWV VLJQL¿FDQW GHSWK ¿UVW RI DOO LW concerns the passion for transmitting action and transformation through the bodies of the new generations of performers, who this year are all between the ages of 10 and 15. For the choreographer, something is lost and something is gained by this change, but it is still the experience of the individual young dancer that changes condition or shape, even during the phase of creation, and this is a genuinely ethical responsibility. nazionale: sono state coinvolte quest’anno il Veneto e la Puglia, la Toscana e il Lazio, le Marche e l’Umbria. Un nuovo repertorio che si ricompone, nei giorni del Festival, non FRPHXQSXQWRGLDUULYRSRLFKpFRPHLQVHJQD la psicoanalisi la mèta è spesso un analogo rispetto all’origine. Ma come un esplicito invito a uno spostamento dell’abituale relazione tra creazione e formazione, come riconoscimento nel suo insieme della forza di questa idea. Con Invenzioni un altro decisivo tassello del Festival sembra organizzarsi qui in una autentica esperienza antropologica: siamo tutti nello stesso mondo, nuovo o vecchio che sia, qui restiamo, e occorre anche avere molta pazienza. L’avventura della creazione FRUHRJUD¿FD GRSR XQ SHULRGR GL UHVLGHQ]D (non solo) artistica in una città come Venezia è, in fondo, il risultato di una fatica pari a quella del viaggiare. Non a caso l’etnologo Vito Teti scrive che quella del «restare è un’arte, un’invenzione; un esercizio che mette in crisi le retoriche delle identità locali». 3HUFKp O¶HVHUFL]LR GHO UHVWDUH ©q XQD GLYHUVD pratica dei luoghi e una diversa esperienza del WHPSRª 3HU TXHVWD VH]LRQH L WUH FRUHRJUD¿ -pU{PH%HO5R\$VVDIH$OHVVDQGUR6FLDUURQL sono rimasti in residenza a Venezia per circa due settimane, e ciò che ne risulta è una ULÀHVVLRQH VX TXDQWR O¶HVHUFL]LR GHO UHVWDUH in un luogo possa in realtà trasformarsi in XQ YLDJJLR DJOL HVWUHPL FRQ¿QL GHOO¶DUWH H GHO gesto, in un mondo troppo mediatizzato in cui ci si sposta soltanto con inutili e ingannevoli movimenti. L’altrove, insomma, è già qui, dove si resta. Lo spazio urbano è dunque un palinsesto capace di raccontare il passato insieme alla politica della memoria che presiede la sua esperienza nel presente. Per questo la sezione Agorà è fra le più innovative del Festival: essa ricerca un rinnovato dialogo tra la danza e l’aperto dei luoghi. Se il segno sembra essere ricorrente, ciclico appunto, It includes the involvement of the senses in the understanding of one’s self and in the relationship with the Other: the body acts in a new way to inform us of the dispositions required to reverse habits and increase the awareness, in these young bodies, that it is important to learn to make choices. The search for a new repertory of dance for teenage performers has been entrusted this year to a sizeable group of Italian choreographers, Cristina Rizzo, Helen Cerina, Simona Bertozzi, Adriana Borriello, to Sieni himself and to Norwegian choreographer Stian Danielsen, in a dialogue with music from WKH UHSHUWRLUH RU FRPSRVHG VSHFL¿FDOO\ IRU the project, but all of them working in Italy: this year the regions involved are the Veneto and Puglia, Tuscany and Lazio, Marche and Umbria. A new repertoire that comes together, during the Festival, though not as a point of arrival, because as psychoanalysis teaches us, the goal is often an analogy of the origin. But as an explicit invitation to shift the traditional relationship between creation and training, as an acknowledgment all together of the power of this idea. In Inventions, another fundamental piece of the Festival seems to have organized itself into an authentic anthropological experience: we are all in the same world, be it new or old, and this is where we will stay. It will take a great deal of patience The adventure of choreographic creation after a period of (not just) artistic residency in a city such as Venice is, in the end, the result of DQ H̆RUW WKDW HTXDOV WKH H̆RUW RI WUDYHOLQJ It is no coincidence that ethnologist Vito Teti writes that «VWD\LQJLVDQDUWDQLQYHQWLRQ an exercise that disputes the rhetoric of local identities». Because the exercise of staying «is DGL̆HUHQWSUDFWLFHRISODFHVDQGDGL̆HUHQW experience of time». In this section, the three choreographers Jérôme Bel, Roy Assaf and Alessandro Sciarroni stayed in residency in Venice for about two weeks, and the result is 9. Festival Internazionale di Danza Contemporanea 23 SHUFKp D 9HQH]LD GD VHPSUH VL FRVWUXLVFRQR spettacoli all’aperto essendo Venezia stessa uno spettacolo sotto il cielo, è la modalità della sua realizzazione, invece, a introdurre un elemento di forte novità. All’aperto e al vuoto del luogo, dei campi veneziani, corrisponde un aperto e una nuova libertà dei corpi, delle modalità tattili e materiali con cui può darsi un gesto, della nuova vita che può generare GDOO¶LQFRQWUR FRQ XQR VSD]LR VSHFL¿FR Ê XQD vera invasione, come il pubblico ha già in parte potuto testimoniare lo scorso anno, nei campi San Maurizio, Pisani, e Campo Novo. &LQTXH FRUHRJUD¿H LUURPSRQR QHO WHPSR quotidiano dello spazio urbano per liberare ogni preconfezionata memoria della città dalle relazione gerarchiche con cui viviamo TXHVWLPDUJLQLWRSRJUD¿FLGHOODYLWD/¶LGHDGL questa nuova Agorà dà al mondo la possibilità GL ULFRPLQFLDUH LQ RJQL FDPSR 3HUFKp parafrasando Deleuze, occorre mettere il PRQGRLQFDPSRḊQFKpODFLWWjHLFRUSLFKH la abitano tornino a essere per il mondo. Con Prima Danza prosegue la scelta GL RVSLWDUH SURJHWWL GHOOD QXRYD FRUHRJUD¿D italiana, con una particolare attenzione al processo di creazione, al modo in cui le forme prendono vita: la responsabilità del meccanismo di decisione più che l’abilità di confezionare e riprodurre. Quest’anno due coreografe e interpreti, Marina Giovannini e Luisa Cortesi, sono state invitate a presentare il risultato dell’incontro tra il loro lavoro e la residenza in più spazi di Venezia, in un DUWLFRODWR SHUFRUVR GL FUHD]LRQH GL YHUL¿FD continua e di performance che coinvolge anche le attività in corso alle Corderie dell’Arsenale, in concomitanza con l’esposizione di Biennale Architettura. Spazio di libertà e di utopia del mondo è invece Boschetto: ogni giorno per quattro ore, durante tutto il periodo del Festival, in Campo Sant’Angelo, una vera e propria isola o macchia boschiva sarà abitata da due danzatrici, Ramona Caia e Sara Sguotti, nella 24 9. Festival Internazionale di Danza Contemporanea DUHÀHFWLRQDERXWKRZWKHH[HUFLVHRIVWD\LQJ in a place can actually turn into a journey towards the most distant frontiers of art and gesture. The elsewhere is already here, where we stay. The urban space is therefore a palimpsest that can narrate the past along with the politics of memory that govern its experience in the present. This is why the Agorà section is one of the most innovative of the Festival: it is a search for a renewed dialogue between dance and the outdoors of spaces. If the sign seems to be recurrent, even cyclical, because open-air spectacles have always been held in Venice given that Venice itself is a spectacle under the heavens, the true element of innovation is the way in which it is held. The open and empty nature of the place, of the Venetian campi, is matched by the openness and new freedom of the bodies, of the tactile and material modes in which a gesture can be made, of the new life that can EHJHQHUDWHGE\WKHHQFRXQWHUZLWKDVSHFL¿F space. It’s an invasion, as the audience was partly able to witness last year, in campo San Maurizio, campo Pisani and Campo Novo. Five choreographies burst into the everyday time of the urban space to liberate the pre-packaged memories of the city from the hierarchical relationships within which we experience these topographical edges of life. Because, to paraphrase Deleuze, you have to put the world out there, so that the city and the bodies that inhabit it can once again exist for the world. Prima Danza is a further manifestation of the decision to present projects of new Italian choreography, with particular attention to the process of creation, to the way in which the forms come to life: the responsibility of the decision-making process rather than the ability to put together or reproduce. This year two choreographers and performers, Marina Giovannini and Luisa Cortesi, were invited to present the PHWDPRUIRVL FRQWLQXD GL ¿JXUH ¿DEHVFKH Per lo spettatore è un luogo della sosta e del ritorno, fra i mille possibili itinerarî ch’egli potrà creare scegliendo di vivere con una mappa personale le tracce e i sentieri degli eventi programmati dal Festival. Qui avrà luogo una sorta di decontaminazione e ricapitolazione delle visioni del suo viaggio SHUODFLWWjSURSULRFRPHQHOOD¿DEDLQFXLLO UDSSRUWR WUD OH ¿JXUH q GL JLXVWDSSRVL]LRQH non di contaminazione. L’apparire e lo sparire GLTXHVWHLQTXLHWH¿JXUHSRWUjWUDVIRUPDUHLQ gioco il senso delle visioni raccolte. Proprio SHUFKp LO OHJDPH WUD FDUDWWHUH H VLWXD]LRQH GHYHHVVHUHVFLROWROD¿DEDFRQRVFHODIHOLFLWj Ma occorre sottolinearlo ancóra, qui in conclusione: il programma del Festival di Virgilio Sieni è progettato non come un’ennesima rassegna di danza, articolata in un più o meno ammiccante menù. Mondo Novo e le sue parallele sezioni sono progettate secondo XQ YHUR H SURSULR SHQVDUH FRUHRJUD¿FR 8Q pensiero capace di esplorare nuove modalità percettive della città e dei corpi, prima che queste modalità si sedimentino anch’esse nell’abitudine, e si chiudano in prestabilite FDWHJRULH &RJOLHUH TXHVWR JUDGXDOH H LQ¿QLWR SUHQGHUHIRUPDGHOO¶HVSHULHQ]DVLJQL¿FDDQFKH riconoscere che soltanto così, come monadi esitanti di un mondo che sempre ritorna, un’intera città può continuare a danzare. result of the encounter between their work and their residency in various spaces throughout Venice, in an articulated process of creation, constant testing and performance that also involves the activities taking place at the Corderie dell’Arsenale concurrently with the Biennale Architecture exhibition. Boschetto is a space for freedom and utopia in the world: every day for four hours, throughout the Festival period, in Campo Sant’Angelo, a veritable island or clump of forest will be inhabited by two dancers, Ramona Caia and Sara Sguotti, in a continuous metamorphosis of fairytale characters. For the spectator this is a place to stop at and come back to, along the thousand possible itineraries that he can create by choosing to draw a personal map for his experience of the traces and paths of the events scheduled for the Festival. This will be the place for a sort of decontamination and recapitulation of the visions of his journey around the city, like in a fairy tale in which WKH UHODWLRQVKLS EHWZHHQ WKH ¿JXUHV LV RQH of juxtaposition, not contamination. The appearance or disappearance of these restless ¿JXUHVFDQWXUQWKHPHDQLQJRIWKHYLVLRQVKH has collected into a game. Because the bond between character and situation must be broken, the fairy tale ends in happiness. But it is important to emphasize it once again, in conclusion: Virgilio Sieni’s Festival programme is not designed as the usual dance line-up, organized as a more or less attractive menu. Mondo Novo and its parallel sections have been planned as a real choreographic thought process. A thought process that explores new ways of perceiving the city and bodies, before these ways settle into habit, and are locked into preconceived categories. 7RFDSWXUHWKLVJUDGXDODQGLQ¿QLWHVKDSLQJ of experience also means to recognize that this is the only way, for the hesitating monads of a world that keeps returning, for an entire city to continue to dance. 9. Festival Internazionale di Danza Contemporanea 25 9. Festival Internazionale di Danza Contemporanea APERTO Biennale Danza ha invitato artisti dal IRUWHVHJQRFRUHRJUD¿FRDSUHVHQWDUHGHL propri lavori in prima assoluta e/o in prima italiana. Gli spettacoli ospitati coabitano con le altre esperienze del Festival. Biennale Danza has invited artists with a powerful choreographic identity to present their works in World or Italian Premiere. These productions will coexist with the other experiences in the Festival. APERTO SABURO TEShIGAWARA / KARAS COREOGRAFIA, SCENE, LUCI, COSTUMI E SELEZIONE MUSICALE Saburo Teshigawara DANZA Saburo Teshigawara e Rihoko Sato VIOLINO Sayaka Shoji ASSISTENTE LUCI Lines Sergio Pessanha PRIMA ASSOLUTA / WORLD PREMIERE GIAPPONE / JAPAN Karas PRODUZIONE durata 60’ Teatro Malibran 19.06, h 21.30 Alla vita che è nata al posto della vita che scompare ,OPRYLPHQWRGHOFRUSRqXQD¿JXUDFKHVFRPSDUH Il movimento è il continuo perire del corpo che scompare linee invisibili compaiono Cose che appaiono scompaiono In musica, lo scomparire di una nota permette alla successiva di comparire Come nuove cellule nascono dopo la morte delle vecchie Il tempo è sempre in movimento attorno al corpo Il tempo nasce nel corpo Tempo che accade dal corpo del violinista, dalle braccia e dallo strumento È intenso, ma allo stesso tempo è un’apparizione destinata a svanire Il corpo che ha partorito la musica destinata a scomparire rimane Non come rovine, ma come la fonte che continuamente partorisce musica 8VFHQGRGDOO¶LQ¿QLWjLQWHULRUHDOPRQGRGHOLPLWDWR 7UDVIRUPDLOSUHVHQWHOLPLWDWRLQLQ¿QLWj Tale è la forza dell’arte To life which is born in place of disappearing life 7KHPRYHPHQWRIWKHERG\LVDGLVDSSHDULQJ¿JXUH Movement is the continuous perish of the disappearing body invisible lines appear Appearing things disappear In music, the disappearing of one note allows the next note to appear Like how new cells are born after old ones die Time is always moving around the body Time is born from inside the body Time occurring from the violinist's body, arms, and instrument It is intense, but at the same time it is an appearance meant to vanish The body that gave birth to the continuously disappearing music remains Not as ruins, but as the source that continuously gives birth to music 6WHSSLQJRXWIURPWKHLQWHULRULQ¿QLW\WRWKHOLPLWHGZRUOG 7KH\WUDQVIRUPWKHOLPLWHGSUHVHQWWRLQ¿QLW\ Such is the force of art 30 9. Festival Internazionale di Danza Contemporanea 31 APERTO JONAThAN BURROWS/ MATTEO FARGION IN COLLABORAZIONE CON Kaaitheater Brussels, PACT zollverein Essen, 6DGOHUЧV:HOOV7KHDWUH/RQGUD BIT Teatergarasjen Bergen Burrows e Fargion sono attualmente artisti in residenza al Nightingale, Brighton Inghilterra durata 30’ %RG\QRW¿W for purpose PRIMA ASSOLUTA / WORLD PREMIERE GRAN BRETAGNA - ITALIA / GB - ITALy Teatrino Palazzo Grassi / Auditorium 19.06, h 19.00 20.06, h 16.00 21.06, h 11.00 22.06, h 11.00 Body Not Fit For Purpose q OЧXOWLPD di una serie continuativa di spettacoli realizzati dal coreografo Jonathan Burrows e dal compositore Matteo Fargion, in cui la dimensione formale della composizione musicale si sovrappone all’approccio aperto e a volte anarchico nei confronti della performance e del pubblico. Questa nuova creazione ha FRPH SXQWR GL SDUWHQ]D OЧLQDGHJXDWH]]D GHO corpo danzante come veicolo per esprimere ciò che è importante, e allo stesso tempo l’inerente radicalità di tale tentativo. Body Not Fit For Purpose presenterà l’abilità nel movimento di Jonathan Burrows LQWLPDPHQWH ḊDQFDWR GDOOD PXVLFD SHU mandolino di Matteo Fargion, ciascuno dei quali costruisce mondi diversi e intriganti derivanti dalla strutture di La Folia, una delle prime melodie che si ricordano in Europa, risalente al Quattrocento e che da allora è stata utilizzata come tema per variazioni da oltre 150 compositori. Questo percorso di traslazione da un medium a un altro ha costituito una strategia continuativa e un ossessione per i due artisti, creando eventi nei quali il pubblico sente la musica nei movimenti e vede la danza nei testi e nei suoni che ascolta. Body Not Fit For Purpose is the latest in an ongoing series of performances by choreographer Jonathan Burrows and composer Matteo Fargion, which juxtapose the formality of music composition with a sometimes anarchic and open approach to performance and audiences. This newest creation takes as its starting point the inadequacy of the dancing body as a vehicle to express that which is of concern, and at the same time the inherent radicality of the attempt. Body Not Fit For Purpose will feature the movement skills of Jonathan Burrows working intimately alongside mandolin by Matteo Fargion, each building worlds diverse and intriguing out of the structure of La FoliaRQHRI(XURSHЧVHDUOLHVWUHPHPEHUHG melodies, dating from the 15th Century and used as a basis for variations by over 150 composers since. This process of translation across mediums has been an ongoing strategy and obsession of the two artists, creating events where the audience hears music in the movement and sees dance in the texts and sounds they are hearing. 9. Festival Internazionale di Danza Contemporanea 33 APERTO STEVE PAxTON Bound (1982) USA Teatro Piccolo Arsenale 20.06, h 21.30 Bound è una performance composta di vignette; ognuna è isolata, ma come numeri in una colonna, si sommano per formare qualcosa di più grande. Alcuni episodi sono asciutti ma risuonano pensieri poetici. Altri sono annotazioni di danza non coreografate. Le musiche sono eclettiche, e le immagini non hanno una logica immediata. È forse un po’ come un incontro casuale con un uomo leggermente ubriaco in un bar tranquillo. Comincia a chiaccherare, e gradualmente emerge la sua storia scomposta, vissuta, come lo sono le vite, un momento alla volta, ma ora ricordata come frammenti di un YLDJJLRSHUVSLHJDUHDOOD¿QHFRPHPDLqTXL seduto da solo, i gomiti appoggiati sul bar e un bicchiere in mano, a parlare con te. «Una volta, ero un uomo…». Bound è stato creato nel 1982 per Spaziozero a Roma. È stato presentato in Gran Bretagna, in Belgio e al Kitchen di New york nel 1983; in quella occasione è stato girato un video sul quale si basa questa ricostruzione. 34 9. Festival Internazionale di Danza Contemporanea CON Jurij Konjar COREOGRAFIA Steve Paxton MUSICA Coro femminile della Radio e Televisione Bulgara, The Canadian Brass, paesaggi sonori durata 60’ Bound is a dance performance FRPSRVHGRIYLJQHWWHVHDFKLVLVRODWHGEXW like numbers in a column, they begin to add up to something larger as they accumulate. Some episodes are dry but resonate poetic thoughts. Some are unchoreographed dance remarks. The musics are eclectic, and the images are not immediately logical. Perhaps it is like a chance meeting with a slightly drunken man in a quiet bar. You begin to make conversation, and gradually his disjointed story emerges, lived, as lives are, one moment after another, but now remembered as fragments of a journey, ¿QDOO\WRH[SODLQKRZKHFDPHWREHVLWWLQJ alone, elbows on a bar and a glass in hand, talking to you. «Once upon a time, I was a man…». Bound was created in 1982 for Spaziozero in Rome. It was seen in Great Britain, Belgium, and at the Kitchen in NYC in 1983, which made a videotape on which this reconstruction is based. APERTO REGIA, COREOGRAFIA, SCENE, COSTUMI Enzo Cosimi COMPAGNIA ENZO COSIMI COLLABORAZIONE ALLA COREOGRAFIA Paola Lattanzi CON Paola Lattanzi Sopra di me il diluvio_ prima trancia VIDEO Stefano Galanti MUSIChE PRIMA ASSOLUTA / WORLD PREMIERE ITALIA /ITALy Chris Watson, Petro Loa e Jon Wheeler FRUSTE SCIAMANIChE Cristian Dorigatti Teatro alle Tese 20>21.06, h 20.30 DISEGNO LUCI Gianni Staropoli ORGANIZZAZIONE Maria Paola zedda IN COLLABORAZIONE CON Fondazione Teatro Comunale Città di Vicenza, Arteven, Electa Creative Arts, Milano Teatro Scuola Paolo Grassi durata 40’ Dopo la creazione Welcome to my world GHGLFDWD DOO¶LGHD GHOOD ¿QH GHO PRQGR GHO YHUL¿FDUVL GL XQD QXRYD $SRFDOLVVH prendo nuovamente ispirazione dal rapporto doloroso dell’Uomo con la Natura nella società contemporanea. Ripensare l’opera come un luogo di magia e di perdita di certezze. Dare spazio a XQ¶DUWH GHOOD FRUHRJUD¿D FKH FRQWHQJD XQD componente tecnica rigorosa, sperimentale, DWWUDYHUVRODTXDOHLQGLUL]]DUHXQDULÀHVVLRQH sul mondo in cui viviamo in rapporto alla Natura e a percepirlo in termini sensoriali. Esaurito il paradigma della postmodernità, si ipotizza l’apparire di un Nuovo 8RPR FKH VL D̆DFFLD D XQ SDHVDJJLR DUFDLFR tribale di cui il continente africano rappresenta l’emblema. Un’Africa urlata, violata che, QRQRVWDQWH L PDVVDFUL VHQ]D ¿QH D FXL q sottoposta da sempre, riesce a restituirci una visione di speranza. Anche questo lavoro, come Welcome to my world, focalizzerà una scrittura di danza scarna, ossuta, un campo percettivo vuoto in cui si vive in uno stato irreale, visionario. Partiture di gesti, movimenti, in apparenza semplici ma che 36 9. Festival Internazionale di Danza Contemporanea Following the creation Welcome to my world dedicated to the idea of the end of the world, when Apocalypse strikes, I once again draw inspiration from the painful relationship between Man and Nature in contemporary society. To conceive the work anew as a place of magic and loss of certainty. To give space to choreography as an art that contains a rigorous, experimental technical component, through which to channel a UHÀHFWLRQRQWKHZRUOGLQZKLFKZHGZHOOLQ relationship to Nature, and to perceive it in terms of the senses. Now that the paradigm of postmodernism has come to an end, one can hypothesize the coming of a New Man looking out over an archaic, tribal landscape of which the African continent is emblematic. A loud, violated Africa that continues, despite the endless PDVVDFUHVLWKDVDOZD\VVX̆HUHGWREULQJXV a vision of hope. This work too, like Welcome to my world, will be centred on stark, gaunt FKRUHRJUDSKLF FRPSRVLWLRQ DQ HPSW\ ¿HOG of perception leading to an unreal, visionary experience. Scores of gestures, movements, riportano alla complessità del lavoro sulla “presenza”, sull’atto performativo, sulla percezione del sistema nervoso a discapito GLTXHOORPXVFRODUH$PSOL¿FDUHLQVFULWWXUD FRUHRJUD¿FDIHQRPHQLQDWXUDOLFKHWHQGLDPR a considerare scontati e renderli visivamente FRPH FDPSL FKH VFRQ¿QDQR YHUVR XQD VSLULWXDOLWj ODLFD XQD PHWD¿VLFD GHO FRUSR un pellegrinaggio di meditazione. (Enzo Cosimi) which look simple but refer to the complexity of the work on “presence”, on the act of performing, on the perception of the nervous system to the detriment of the muscles. Using choreographic writing to amplify natural phenomena that we tend to take for granted, DQG WR H[SUHVV WKHP YLVXDOO\ DV ¿HOGV WKDW extend beyond their boundaries towards a secular spirituality, the metaphysics of the body, a pilgrimage of meditation. Un ringraziamento speciale a Francesco Marilungo, Giovanni Di Tommaso, Davide Babolin, Jim Tuhoy. With special thanks to Francesco Marilungo, Giovanni Di Tommaso, Davide Babolin, Jim Tuhoy. 9. Festival Internazionale di Danza Contemporanea 37 APERTO LAURENT ChÉTOUANE Sacré Sacre du Printemps CON BODyTRAINING Joséphine Evrard, Kathryn Enrigth, Senem Gökce Ogultekin, Matthieu Burner, Joris Camelin, Charlie Fouchier e Mikael Marklund Patricia Brülhart COREOGRAFIA IN COLLABORAZIONE CON Laurent Chétouane Igor Stravinsky e Leo Schmidthals Fondazione Culturale della Germania Federale (Kulturstiftung des Bundes) e del Sindaco di Berlino – Senatskanzlei – Kulturelle Angelegenheiten SCENE CO-PRODUZIONE Patrick Koch DRAMMATURGIA Ruhrtriennale, PACT zollverein Essen, Tanzquartier Vienna, Theater Bremen, Rencontres chorégraphiques internationales de Seine-Saint-Denis (Francia), Kaaitheater Bruxelles, Kampnagel Hamburg Leonie Otto durata 90’ MUSICA PRIMA ITALIANA / ITALIAN PREMIERE FRANCIA - GERMANIA / FRANCE - GERMANy COSTUMI Sophie Reble Teatro alle Tese 21.06, h 21.30 PRODUZIONE Christine Kammer, Sacré GbR COLLABORAZIONE ARTISTICA Anna Melnikova e Sigal zouk VIDEO Tomek Jeziorski LUCI Stefan Riccius In Sacré Sacre du PrintempsO¶D̆HUPDWR coreografo e regista teatrale Laurent &KpWRXDQH VFHJOLH XQD GHOOH RSHUH SL LQÀXHQWL QHOOD VWRULD GHOOD PXVLFD H GHOOD danza del ventesimo secolo come tema per il suo nuovo lavoro: Le Sacre du Printemps. La composizione di Igor Stravinsky, che fu incompresa e pesantemente contestata alla sua prima rappresentazione nel 1913, è VWUHWWDPHQWH OHJDWD DOOD ¿UPD GL 1LMLQVN\ e da allora ha ispirato numerosi artisti – GD 0DXULFH %pMDUW D 3LQD %DXVFK ± QHOOD FUHD]LRQH GL JUDQGLRVH FRUHRJUD¿H ,Q Le Sacre du Printemps, oggi considerato un momento fondamentale della musica dell’era moderna, l’altro si colloca al centro GHOOD VRFLHWj H ¿QLVFH SHU HVVHUH DVVLPLODWR da questa integrazione e privato della sua intrinseca alterità. Nel pensare la sua XOWLPD FRUHRJUD¿D &KpWRXDQH SDUWH GD questo punto: come è possibile lasciare che l’altro resti altro? Spostando il soggetto dal rituale “VDFUL¿FLR GHOOD SULPDYHUD´ YHUVR LO “VDFUL¿FLR´FRUHRJUD¿FRHYLVLYRGLLe Sacre du PrintempsVWHVVR&KpWRXDQHLQGDJDODQRVWUD incapacità di permettere all’altro di esistere nella sua alterità. In una serata articolata in 38 9. Festival Internazionale di Danza Contemporanea In 6DFUp6DFUHGX3ULQWHPSV the muchacclaimed choreographer and stage director Laurent Chétouane selects one of the most LQÀXHQWLDOZRUNVLQWKHKLVWRU\RIPXVLFDQG dance of the 20th century as the theme of his new piece: Le Sacre du Printemps, the Rite of Spring. Igor Stravinsky’s composition, which met with incomprehension and heavy rejection when it premiered in 1913, is closely connected with Nijinsky’s dance signature, and has since inspired numerous artists – from Maurice Béjart to Pina Bausch – to create impressive choreographies. In Le Sacre du Printemps, today regarded as a musical highlight of the modern era, the alien is located in the core of our society, but assimilated in this integration and thus bereft of its intrinsic alienness. In conceiving his new choreography, Chétouane takes up this point of departure: how can one make the alien stay alien? Shifting its sujet from WKH ULWXDO ³VSULQJ VDFUL¿FH´ WRZDUGV WKH FKRUHRJUDSKLF DQG YLVXDO ³VDFUL¿FH´ RI Le Sacre du Printemps itself, Chétouane deals with our inability to let the alien exist in its otherness. In a three-part evening which SXWV WKH VHYHQ GDQFHUV DV ³VDFUL¿FHUV´ tre parti che vede i sette danzatori nel ruolo GL ³VDFUL¿FDWRUL´ LQ XQ FDPSR GL WHQVLRQH musicale fra l’opera di Stravinsky e una nuova composizione del musicista Leo Schmidthals, &KpWRXDQH R̆UH OD YLVLRQH GL XQD SRVVLELOH convivenza con l’altro, realizzabile proprio a partire dalla sua incapacità a essere integrato H OD VXD LUUHSUHVHQWDELOLWj LO VDFUL¿FLR GL Le Sacre du Printemps diviene dunque un rito contemporaneo dell’altro-che-rimane-altro. LQWR WKH PXVLFDO WHQVLRQ ¿HOG EHWZHHQ Stravinsky’s opus and a new composition by the musician Leo Schmidthals, Chétouane devises his vision of a development that allows cohabitation with the alien, and makes it possible exactly on the basis of its incapability of being integrated and its XQUHSUHVHQWDELOLW\WKHVDFUL¿FHRILe Sacre du Printemps as a new ritual for the alienleft-alien. 39 APERTO COREOGRAFIA DIRETTORE DELLE PROVE Roy Assaf Malanie Berson DANZATORI E COLLABORATORI CONSIGLIERE ARTISTICO Hadar Yunger e Roy Assaf Sahar Azimi Six Years Later COLONNA SONORA E COSTUMI TESTO PRIMA ITALIANA / ITALIAN PREMIERE ISRAELE / ISRAEL Roy Assaf Amit Kliger MUSICA ORIGINALE FOTOGRAFO 'HHÀ\ Costin Radu/Gadi Dagon EDITING durata 24’ ROy ASSAF Teatro alle Tese 24.06, h 20.30 5HXW<HKXGDLH'HHÀ\ MUSICA Moonlight sonata (Ludwig Van Beethoven, 3LDQR±:LOKHOP.HPS̆  Dove sei amato bene (George Friedric Händel, mezzo soprano – Marilyn Horn), 5HÀHFWLRQVRI0\/LIH (Marmalade) DISEGNO LUCI Dani Fishof e Omer Sheizaf FRQLOVRVWHJQRGHOO¶8̇FLR&XOWXUDOHGHOO¶$PEDVFLDWDG¶,VUDHOH with the support of the Culture Department of the Embassy of Israel Quale evento ha preceduto questo incontro avvenuto sei anni dopo. Sapendo che un certo passato ha portato al nuovo incontro, muovendosi tra il presente mostrato e il passato presunto. Non sappiamo se si sono incontrati, o amati, o se ci saranno altri incontri. Non sappiamo se questi sei anni siano stati importanti per loro, o la ragione per la quale si sono separati. Non possiamo capire cos’è successo nei sei anni precedenti a questo momento se non valutiamo ciò che ci ha separati. Un incontro silenzioso, imbarazzante, attenuato, forse ci ricordiamo, per dimostrare che questi sei anni non sono passati invano. È impossible per una persona FDSLUHTXHVWHLPPDJLQLVHQRQOLKDFUHDWLGDVp Mentre compiono i loro gesti davanti ai nostri occhi, ogni dettaglio del movimento potrebbe confermare le nostre intuizioni o frantumare le nostre supposizioni. Questo è un duetto sul passato e presente, si ascoltano a vicenda, stretti l'uno all'altro, come in un’inevitabile storia d’amore. 40 9. Festival Internazionale di Danza Contemporanea What event preceded this encounter six years later. Knowing that a certain past eventually caused the new encounter, moving between the obvious present and the presumed past. We don’t know if they met, or loved, or if there will be more encounters. We don’t know if these six years were important in their lives or the reason that they separated. We can understand what happened during the six years preceding this moment only by looking at what separated us. A quiet meeting, embarrassing, hushed, perhaps we remember to prove that these six years were not in vain. It’s impossible for a person to know about these images unless he creates them. While their gestures are SDVVLQJ LQ IURQW RI \RXU H\HV HDFK ÀLFNHU RI PRYHPHQW ZLOO HLWKHU FRQ¿UP ZKDW ZH thought or shatter our assumptions. This is a duet about past and present, WKH\OLVWHQWRRQHDQRWKHU¿UPO\ERQGHGWR each other like an inevitable love story. 41 APERTO RAFFAELLA GIORDANO/ MARIA MUñOZ SCRITTURA COREOGRAFICA E INTERPRETAZIONE 0DULD0XxR]H5D̆DHOOD*LRUGDQR COLLABORAZIONE ARTISTICA Pep Ramis ASSISTENTE ASSISTENZA TECNICA Punt de Fuga FOTOGRAFIA Andrea Macchia e Jordi Bover PRODUZIONE ESECUTIVA Eduard Teixidor L’incontro Leo Castro PRIMA ITALIANA / ITALIAN PREMIERE ITALIA - SPAGNA / ITALy - SPAIN 0DULD0XxR]H5D̆DHOD*LRUGDQR 2013 Mal Pelo Girona Spagna, Sosta Palmizi Cortona Italia PAESAGGIO SONORO COPRODUZIONE Pep Ramis Théâtre des Bernardines, Festival Dansem, Marsiglia Francia PAROLE E DIALOGhI Teatro alle Tese 24.06, h 21.30 COLLABORAZIONE MICROPARTITURE MUSICALI Matteo Milani PRODUZIONE IN COLLABORAZIONE CON FRAMMENTI MUSICALI /Ч$UERUHWR7HDWUR'LPRUD0RQGDLQR,WDOLD /ЧDQLPDODOЧHVTXHQD&HOUj6SDJQD J.S. Bach, C.F. Abel durata 65’ IDEAZIONE LUCI Luigi Biondi e August Viladomat COSTUMI CarmepuigdevalliplantéS 0DULD 0XxR] H 5D̆DHOOD *LRUGDQR VL avventurano insieme sulla scena per dare vita a un singolare e intenso quadro poetico. Due DQLPH ¿HUDPHQWH LQGLSHQGHQWL HQWUDPEH autrici e creatrici di universi gestuali, curiose delle molteplici forme d’espressione artistica, QRQFKp IRQGDWULFL GL FRPSDJQLH JLj QHJOL anni ottanta. Lo spazio è vasto, il perimetro incerto IUD O¶HVWHUQR GL XQD QDWXUD SDFL¿FD H l’interno di buia materia in divenire. La semplicità e la riconoscenza generano un tocco reciproco gravido di sostanza non detta, il presente si inscrive nel luogo di incontro, ogni parola e gesto e passaggio lasciano il loro seme nell’aria, raccolto nella sua invisibile percettibilità, frutta e genera il gesto seguente, ognuna custodisce le cose segrete, sapiente è la voce interna che emerge a suo tempo, indiretta e reale. La parola del corpo risuona nello spazio per divenire in un continuo mutamento, movimento successivo, come un quaderno anche sprecato nelle sue SDJLQHELDQFKHFRPHXQD¿QHVWUDDSHUWDVXO cielo, come un lenzuolo ad asciugare, come un pezzo di terra brulla, come una roccia in attesa dell’onda, come un campo di grano nel 42 9. Festival Internazionale di Danza Contemporanea 0DULD 0XxR] DQG 5D̆DHOOD *LRUGDQR venture out on stage together to present a singular and intensely poetic tableau. 7ZR ¿HUFHO\ LQGHSHQGHQW VSLULWV ERWK RI them authors and creators of a universe of gestures, intrigued with the many forms of artistic expression, each of them founded their own company in the 1980s. The space is vast, the perimeter uncertain between the outdoors of nature at peace and the indoors of dark material in evolution. Simplicity and recognition generate a mutual contact that is charged with unspoken substance, the present is inscribed in the place of encounter, every word and gesture and passage leave a seed in the air, captured in its invisible perceptibility, it leads to and generates WKH QH[W JHVWXUH HDFK RQH SUHVHUYHV VHFUHW things, the inner voice that emerges in time is knowing, indirect and real. The body’s words resound in the space to evolve continuously changing, the next movement, like a wasted notebook with white pages, like a window open onto the sky, like a sheet hung out to dry, like a stretch of wasteland, OLNH D URFN EUDFLQJ IRU D ZDYH OLNH D ¿HOG vento inatteso. Ciò che rimane, la forza e la grazia, il rigore di amare senza compromessi la via del corpo, il segreto si accende nella vicinanza, non vuole essere decifrato e rimane nel rispetto di ciò che in ultimo è nascosto. of grain under an unexpected wind. What remains, the power and the grace, the rigour of uncompromisingly loving the way of the body, the secret is sparked in closeness, it does not want to be deciphered and remains within the limits of what is ultimately hidden. 9. Festival Internazionale di Danza Contemporanea 43 COREOGRAFIA Roy Assaf APERTO DANZATORI E COLLABORATORI Igal Furman, Avshalom Latucha e Roy Assaf ROy ASSAF COLONNA SONORA E COSTUMI Roy Assaf The Hill MUSICA ORIGINALE ED EDITING ISRAELE / ISRAEL MUSICA Shlomi Bitton The Israeli Army March (The Israeli Army Band conducted by I. Graziani), Giv’at hatahmoshet (Yoram Taharlev), I started a Joke (Bee Gees) Teatro alle Tese 25.06, h 20.30 DISEGNO LUCI Dani Fishof e Omer Sheizaf DIRETTORE DELLE PROVE Malanie Berson CONSIGLIERE ARTISTICO Ronit ziv TESTO Amit Kliger FRQLOVRVWHJQRGHOO¶8̇FLR&XOWXUDOHGHOO¶$PEDVFLDWDG¶,VUDHOH with the support of the Culture Department of the Embassy of Israel FOTOGRAFO Gadi Dagon durata 23’ Detriti prodotti dall’erosione dell’acqua, una pressione crescente, accumuli di terra o di sabbia… nasce una collina. Un uomo risale una collina di terra, si ferma in cima, e qualcosa lo fa pensare che questa è terra santa. La gente, e gli uomini in particolare, si trovano inspiegabilmente a farsi guerra periodicamente per il possesso di questo cumulo di terra. Le loro azioni convalidano l’importanza che ha per loro TXHVWD FROOLQD H VRQR SURQWL DG D̆URQWDUH OD rabbia, le maledizione e la fede cieca. Si canteranno canzoni, si danzeranno GDQ]H SHU D̆HUPDUH OD IHGH H DVVLFXUDUVL FKH viva in eterno. I tre uomini sulla collina... Non è possibile accertare per quale motivo siano stati messi lì o da chi. La loro danza, un movimento circolare costante, esprime un loop assurdo, un ciclo di paura e una sorta di mascolinità, capace di evocare risate, terrore e lacrime. I loro movimenti rappresentano l’essenza GHOO¶RFFXSD]LRQH VROGDWL GDO SHWWR JRQ¿DWR dalla convinzione. Intossicati dal senso della propria importanza, combattono al suono di eroici antemi che cantano le glorie del passato; durante le celebrazioni delle battaglie si 44 9. Festival Internazionale di Danza Contemporanea Water-borne erosion debris, mounting pressure, accumulations of soil or sand... a hill is born. A man climbs up a hill of earth, he stands at the top, and something makes him think that he is standing on holy ground. People, men to be exact, inexplicably involved in periodic struggles over this mound of earth. By their actions, they validate the VLJQL¿FDQFH RI WKLV KLOO IRU WKHPVHOYHV HYHQ enduring anger, curses and blind faith. Songs will be sung, dances will be GDQFHGWRḊUPWKHLUIDLWKDQGHQVXUHWKDW it will live on forever. The three men on the hill... One cannot tell for what purpose they were positioned there or by whom. And their dance, in a costant circular movement, demonstrates a loop of absurdity, a cycle of fear and masculinity of sorts, evoking laughter, terror and tears. Their movements demonstrate the essence of RFFXSDWLRQ VROGLHUV ZLWK FKHVWV SX̆HG RXW with convinction. Intoxicated by a sense RIVHOILPSRUWDQFHWKH\DUH¿JKWLQJWRWKH sounds of heroic anthems glorifying the SDVW GXULQJ WKH EDWWOH FHOHEUDWLRQV WKH\ muovono in modo meccanico, come se fossero sotto incanto. Una fantomatica danza rituale, un circolo festoso di cameratismo eseguito con una coordinazione perfetta ma inquietante. Si renderanno conto in ultimo che la collina è solo frutto della loro immaginazione? Divise strappate, rivelazioni frantumate, L WUH HURL VL VFKLDQWDQR SHU IDUH ÀXWWXDUH VXO bordo un frammento spezzato: la collina è un inganno. Non poteva essere conquistata, ma nemmeno abbandonata. Dal momento che sono arrivati in cima, erano destinati a rimanerci per sempre, contro la loro volontà; insieme in compagnia. E ora non hanno più nessuno, tranne loro stessi… cominciano a sognare la morbidezza, il solletico, le risate e la fratellanza… lo sforzo per arrivare in cima si è concluso e gli uomini cantano per la collina, ma la collina è sorda. E danzano in onore della collina che freme, e ride con una risata ipogea; detriti prodotti dall’erosione dell’acqua, una pressione crescente, accumuli di terra o di sabbia… nasce una collina. are mechanical, as though under a curse. A type of ritual ghost dance, a festive circle of camaraderie executed in perfect yet GLVWXUELQJ FRRUGLQDWLRQ :LOO WKH\ ¿QDOO\ UHDOL]HWKDWWKHKLOOLVRQO\D¿JPHQWRIWKHLU imagination? Uniforms ripped, revelations shattered, the three heroes crash in order for a broken IUDJPHQWWRÀXWWHURQWKHHGJHWKHKLOOLVD deception. It couldn’t be conquered, yet it also couldn’t be abandoned. From the moment that they reached the summit, they were GHVWLQHG WR VWD\ IRUHYHU DJDLQVW WKHLU ZLOO together in partnership. And now they have no one else, except each other... suddenly they yearn for softness, tickling, laughter and fraternity... their struggle to reach the summit has ended and the men sing to the hill, but the hill is deaf. And they dance in honor of the quivering hill, while it is laughing an underground laugh, water borne erosion debris, mounting pressure, accumulations of soil or sand... a hill is born. 9. Festival Internazionale di Danza Contemporanea 45 APERTO RADhOUANE EL MEDDEB, MATIAS PILET & ALExANDRE FOURNIER PROGETTO CREATO DA REGIA GENERALE Radhouane El Meddeb*, Matias Pilet e Alexandre Fournier Manuel Desfeux DA UNA IDEA ORIGINALE DI CENTQUATRE-Paris Fabrice Champion COREOGRAFIA E DRAMMATURGIA Radhouane El Meddeb CON Nos Limites Alexandre Fournier e Matias Pilet LUCI PRIMA ITALIANA / ITALIAN PREMIERE FRANCIA / FRANCE Xavier Lazarini SUONO Stéphane Gombert Teatro alle Tese 25.06, h 21.30 con il sostegno dell’Institut français / with the support of the Institut français Nos Limites è la storia degli istinti vitali ed esprime la capacità di reagire, di agguantare i nostri corpi e la nostra volontà e di puntare oltre L QRVWUL ULFRUGL D̆HUUDQGROL SHU UHQGHUOL SL vividi. Sotto lo sguardo sapiente del coreografo, due giovani interpreti evocano l'assenza, con discrezione e delicatezza ma anche con incredibile energia, attraverso salti acrobatici alternati con il lavoro a terra. L’essenza di questa proposta è insieme commovente ed energica, e rappresenta una sintesi fra le acrobazie dei due artisti circensi e la visione FRUHRJUD¿FDGL5DGKRXDQH(O0HGGHE La storia Il progetto per lo spettacolo nasce dall’incontro fra Fabrice Champion (già parte della compagnia Arts Sauts) e Matias Pilet e Alexandre Fournier, due studenti delle DUWL FLUFHQVL DOO¶$FDGpPLH )UDWHOOLQL )DEULFH Champion, ex-trapezista con la Arts Sauts Company, insegnava alla ENACR ed era GLUHWWRUH DUWLVWLFR GHOO¶$FDGpPLH )UDWHOOLQL dove ha conosciuto Matias Pilet e Alexandre Fournier, due artisti dotati di particolare talento con i quali ha stretto un rapporto molto stretto. L’amicizia gli ha stimolato il desiderio di ritornare in scena, nonostante la sua disabilità, 46 9. Festival Internazionale di Danza Contemporanea Nos limites is the story of life’s instincts and tells of the ability to bounce back, to grasp our bodies and our will and to reach beyond our memories, seizing them to make them more vivid. Under the choreographer’s knowing eye, two young performers evoke absence, with discretion and delicacy but also with incredible energy, in their acrobatic lifts intermingled ZLWK ÀRRU ZRUN 7KH FRUH RI WKLV SURSRVDO LV both moving and energetic, resulting in a blend between the acrobatics of the two circus performers and the choreographic eye of Radhouane El Meddeb. The background The plan for this show dates back to when Fabrice Champion (formerly with the Arts Sauts) created it with Matias Pilet and Alexandre Fournier, two student circus artists from the Académie Fratellini. Fabrice Champion, a former trapeze artist with the Arts Sauts Company, taught at ENACR and was artistic director at the Académie Fratellini, where he met Matias Pilet and Alexandre Fournier, two particularly talented artists whom he became very close to. From that friendship he felt a desire to come back on the scene, in spite of his disability, and to work e di lavorare con loro per creare uno spettacolo ¿WWR GL SURGH]]H DFUREDWLFKH 'RSR OD PRUWH di Fabrice Champion nel 2011 nel corso di un viaggio all’estero, Matias Pilet e Alexandre Fournier hanno continuato a provare. Per una fortuita piccola, o forse grande, coincidenza il coreografo Radhouane El Meddeb, artista associato al CENTQUATRE, ha assistito a una delle prove. Dopo questo primo incontro, tutti e tre hanno sentito la necessità di portare avanti il progetto. Radhouane El Meddeb si è assunto la responsabilità della produzione e KD LQL]LDWR R̆UHQGR ORUR LO EHQH¿FLR GHOOD VXD VFULWWXUD FRUHRJUD¿FD FRQWHPSRUDQHD /¶LGHD non era quella di continuare esattamente sul VROFR WUDFFLDWR GD )DEULFH SHUFKp XQD IHGHOWj assoluta sarebbe stata impossibile, ma di partire dalle sue idee e di ispirarsi a esse per sviluppare il progetto al meglio. È con tale intento che Matias Pilet, Alexandre Fournier e Radhouane El Meddeb hanno proceduto con il lavoro, creando un mini-formato, a metà strada tra uno spettacolo circense e una danza; la trasposizione in danza è stata assolutamente naturale. Il risultato è uno spettacolo dall’essenza dinamica che fonde l’energia dei salti acrobatici dei due artisti circensi con la YLVLRQHFRUHRJUD¿FDGL5DGKRXDQH(O0HGGHE Il progetto è la storia degli istinti vitali che non si fermano nonostante la disabilità e la morte; è anche la storia dei giovani di fronte all’assenza e soprattutto della loro capacità GLUHDJLUHGLD̆HUUDUHODORURWHFQLFDHODORUR arte per recuperare energia e proseguire nel percorso creativo. PRODUZIONE IN COLLABORAZIONE CON Académie Fratellini, programma di residenza artistica presso La brèche/Pôle Nationale des Arts du Cirque/Cherbourg-Octeville Il progetto fa parte dei corsi di formazione della Académie Fratellini Circus Arts Training Centre durata 50’ * artista associato presso CENTQUATRE-Paris with them to create a show full of acrobatic feats. After the death of Fabrice Champion in late 2011 during a trip abroad, Matias Pilet and Alexandre Fournier continued to rehearse. By the smallest, or perhaps the greatest of coincidences, the choreographer Radhouane El Meddeb, an associate artist at the CENTQUATRE, attended one of them )URPWKLV¿UVWPHHWLQJDOOWKUHHIHOWWKHQHHG to continue with the project, Radhouane El Meddeb took over the show and began by JLYLQJ WKHP WKH EHQH¿W RI KLV FRQWHPSRUDU\ choreographic design. The idea was not to continue exactly as Fabrice began, as it would be impossible to stay completely faithful, but to take his ideas and use them as inspiration to continue the project in the best possible way. The original trio was recomposed but in a GL̆HUHQWPDQQHUDQGE\FRPPRQDJUHHPHQW it was decided that they should continue So it was that Matias Pilet and Alexandre Fournier and Radhouane El Meddeb continued the work. A mini format was created, somewhere EHWZHHQ D FLUFXV DFW DQG D GDQFH WKH transposition into dance is totally natural. The core of the show is dynamic, combining the energetic acrobatic lifts of the two circus performers and the choreographic eye of Radhouane El Meddeb. This project is the story of life’s instincts forging on in spite of GLVDELOLW\ DQG GHDWK LW LV DOVR WKH VWRU\ RI youth in the face of absence and especially their ability to bounce back, to grasp their technique and their art to recover their energy and continue the creative process. 9. Festival Internazionale di Danza Contemporanea 47 APERTO JAN MARTENS COREOGRAFIA Jan Martens CON Kimmy Ligtvoet e Steven Michel Sweat Baby Sweat MUSICA PRIMA ITALIANA / ITALIAN PREMIERE BELGIO - OLANDA / BELGIUM - NEDERLAND VIDEO Teatro alle Tese 26.06, h 21.30 Jaap van Keulen Paul Sixta DIREZIONE TECNICA Michel Spang COACh Peter Seynaeve DISTRIBUZIONE Apropic, Line Rousseau COPRODUZIONE Frascati Productions, TAKT Dommelhof e JAN vzw con il sostegno dell’Ambasciata del Regno dei Paesi Bassi a Roma nell’ambito di Olandiamo in Veneto / with the support of the Embassy of the Kingdom of the Netherlands in Rome as part of ‘Olandiamo in Veneto’ Sweat Baby Sweat parla di un amore divorante, e mostra due persone che non possono, o non vogliono, lasciare andare OЧDOWUR 8QD EUXFLDQWH SURGX]LRQH PLQLPDOH in cui immagini, testo, movimento e musica si completano perfettamente. Sweat Baby Sweat segna il passo successivo nell’approfondimento sulla simbiosi fra racconto e astrazione, iniziato con a small guide on how to treat your lifetime companion di Jan Martens. Per lo spettacolo Martens ha collaborato con un compositore e un video designer, che hanno LQWHJUDWR DOOD FRPSRQHQWH FRUHRJUD¿FD LO ORUR fondamentale apporto visivo e sonoro. Il punto di partenza di Sweat Baby Sweat è il più banale dei temi: il rapporto fra un uomo e una donna. La scelta di testi tratti da canzoni d’amore e di musiche a volte più dolci, suggerirebbe un approccio molto teatrale, ma è vero il contrario. Il risultato è uno spettacolo di un’ora in cui trascorre una vita. Una danza moderna di accoppiamento: naïf, spietata, senza grande speranza, ma viva e bruciante. Un rito moderno di accoppiamento: naïf, sensuale, tenero ma doloroso, insieme confortante e confrontante. 48 9. Festival Internazionale di Danza Contemporanea si ringraziano SummerStudios Brussels, Marc Vanrunxt durata 65’ Sweat Baby Sweat is about all-consuming love, and shows two people who can’t – or won’t – let one another go. A searing, minimal production in which images, text, movement and music complement one another perfectly. Sweat Baby Sweat is a new step into the investigation on the symbiosis of storytelling and abstraction, which started in Jan’s production a small guide on how to treat your lifetime companion. Working together with a video designer and a composer, Sweat Baby Sweat becomes a work in which composed music and projected text take an important role next to the moving composition. The point of departure in Sweat Baby Sweat is the most cliché theme ever: a relationship between a man and a woman. By adding love song lyrics and moments of more mellow music one would expect a very theatrical approach, but the contrary is true. The result is a one hour performance in which a lifetime is passing. A modern mating dance: naïve, callous, a little hopeless, but also apparent and heating. A modern mating ritual: naïve, sensual, tender but painful, at the same time comforting and confronting. APERTO ChRISTIAN RIZZO / L’ASSOCIATION FRAGILE D’après une histoire vraie CONCETTO, COREOGRAFIA, SCENOGRAFIA E COSTUMI Christian Rizzo CON Fabien Almakiewicz, Yaïr Barelli, Massimo Fusco, Miguel Garcia Llorens, Pep Garrigues, Kerem Gelebek, Filipe Lourenço e Roberto Martínez MUSICA ORIGINALE ESEGUITA DAL VIVO Didier Ambact e King Q4 PRIMA ITALIANA / ITALIAN PREMIERE FRANCIA / FRANCE DISEGNO LUCI DIREZIONE LUCI E VIDEO Arnaud Lavisse DIREZIONE LUCI Samuel Dosière AMMINISTRAZIONE, PRODUZIONE E TOURING Bureau Cassiopée Léonor Baudouin, Mélanie Charreton, Isabelle Morel e Camille Rondeau durata 70’ Caty Olive DIREZIONE GENERALE Teatro Piccolo Arsenale 27.06, h 21.30 Jérôme Masson DIREZIONE SUONO Vanessa Court con il sostegno dell’Institut français / with the support of the Institut français 2004, Istanbul. Qualche minuto prima GHOOD¿QHGLXQRVSHWWDFRORGDOQXOODXQJUXSSR di uomini irrompe sul palcoscenico, esegue una breve danza popolare, e immediatamente sparisce. Ciò che resta è un’emozione profonda e quasi arcaica: per la loro danza, o per il vuoto lasciato dalla loro sparizione? Sebbene confusa, questa sensazione è rimasta sin da allora ancorata in me. Il punto di partenza per questo nuovo progetto è stato questo ricordo, o più precisamente, la necessità di scoprire quello che questa memoria aveva lasciato in me. Non mi interessa ricreare interamente una danza già esistente. Preferirei capire SHUFKp KR VHQWLWR XQD WDOH HPSDWLD FRQ TXHO PRPHQWRHFRQTXHOODIRUPDGLGDQ]DHSHUFKp il suo impatto non accenna a diminuire. Si tratta quindi più di ripercorrere i passi nella mia memoria per inventare le basi di una forma astratta di scrittura, nella quale potrebbero inserirsi frammenti possibili di narrazione. Accompagnato da otto danzatori e due musicisti, cerco uno spazio nel quale il movimento e il suo rapporto con la musica giocano con le categorie di ‘popolare’ e di 50 9. Festival Internazionale di Danza Contemporanea 2004, Istanbul. A few minutes before the end of a performance, out of nowhere, a group of men erupt on stage, break out into a very short folk dance, and then immediately disappear. I am overtaken by a deep and almost archaic emotion. Was it their dance, or the void they left after disappearing that overwhelmed me? Though hazy, this sensation has remained anchored in me ever since. The starting point for this new project has been this memory, or more exactly, the quest to ¿QGZKDWWKLVPHPRU\KDGOHIWLQPH I feel no interest in recreating a preexisting dance in its entirety. I would rather understand why I felt such empathy with this very precise moment and with this form of dance and why its impact still resonates to this day. It is therefore more a question of retracing the steps of my memory in order to LQYHQWWKHEDVLVRIDQDEVWUDFWIRUPRIZULWLQJ RQHZKHUHSRVVLEOH¿FWLRQDOVQLSSHWVFRXOG¿QG an inherent place in which to lodge themselves. Accompanied by eight dancers and two musicians, I’ve been looking for a space where movement and its relationship to music plays with the categories of ‘popular’ and ‘contemporaneo’. Immagino una danza che, ispirandosi alle memorie di pratiche folcloristiche, si troverebbe in contrasto con la mia predilezione per il cadere e il toccare, che permetterebbe a ognuno di presentarsi all’altro con grazia, o a stretto contatto con loro. L’osservazione fattuale e decontestualizzata di movimenti e sistemi di composizione, FKHVRQRVSHVVRFRQGLYLVLGDGDQ]HGL̆HUHQWL SL PDVFKLOL H PHGLWHUUDQHL  PL R̆UH XQ WHUUHQR LGHDOH SHU D̆URQWDUH GL QXRYR L WHPL della comunità. Come si forma un gruppo in un dato momento? Stare insieme, in una forma che non appartiene ad alcun preciso gruppo o territorio, e pensare una danza collettiva che scava nella terra mentre cerca allo stesso tempo di elevarsi. Essendo la musica una parte essenziale GHO SURJHWWR KR ḊGDWR OD FRPSRVL]LRQH H l’esecuzione dal vivo) ai batteristi-compositori Didier Ambact e King Q4. Due batterie, al limite estremo fra ritmi tribali e rock psichedelico, manterranno un rapporto tra dialogo e “battaglia” SHU R̆ULUH XQD ]RQD GL WHQVLRQH DOOD GDQ]D H all’illuminazione ambientale di Caty Olive. (Christian Rizzo, giugno 2013) ‘contemporary’. I imagine a dance that, while taking its cues from memories of folkloric SUDFWLFHVZRXOG¿QGIULFWLRQZLWKP\WDVWHIRU falling and touch, allowing each and everyone to stand gracefully in the presence of others, or within his/her immediate contact. The factual and decontextualized observation of movements and systems of composition, often common over several GL̆HUHQW GDQFHV PRUH PDVFXOLQH DQG 0HGLWHUUDQHDQ R̆HUVPHWKHLGHDOWHUUDLQWR once again question the notions of community. How is a group formed at a given moment? Being together, for a form belonging to no determined group or territory, and thinking up a collegial dance that digs into the ground while simultaneously looking for elevation. Since the music is an essential part of the project, I entrusted the composition (and live performance) to drummer-composers Didier Ambact and King Q4. Two drum kits, at the extreme limits of tribal rhythms and psychedelic rock, will maintain a relationship between dialogue and “battling” in order to R̆HUD]RQHRIWHQVLRQWRWKHGDQFHDQGWR&DW\ Olive’s atmospheric lighting. 9. Festival Internazionale di Danza Contemporanea 51 APERTO DEWEy DELL CONCEPT PRODUZIONE Dewey Dell (ITA) / Agata, Demetrio, Teodora Castellucci ed Eugenio Resta Dewey Dell ASSISTENZA ALLA REGIA steirischer herbst / Graz, BUDA Kunstencentrum / Kortrijk for NEXT International Festival, Centrale Fies / Dro Marzo Kuro Tanino (J) PRIMA ITALIANA / ITALIAN PREMIERE ITALIA / ITALy Yuichi Yokoyama (J) DISEGNO COSTUMI IN COLLABORAZIONE CON Agata Castellucci, Teodora Castellucci, Eugenio Resta ed Enrico Ticconi Tanzfabrik Berlin e University of zagreb – Student Centre zagreb – Culture of Change (within APAP – Advancing Performing Arts Projects) COREOGRAFIA si ringrazia Schaubuhne Lindenfels / Leipzig CON Teatro alle Tese 28.06, h 20.30 COPRODUZIONE Teodora Castellucci Black Fanfare / Demetrio Castellucci Dewey Dell è sostenuta da APAP – Advancing Performing Arts Projects ed è parte del progetto Fies Factory / Centrale Fies LUCI E SCENA durata 50’ MUSIChE ORIGINALI Eugenio Resta REALIZZAZIONE COSTUMI )O\,QÀDWH*LRYDQQD$PRURVR e Istvan zimmermann / Plastikart, Atelier Pietro Longhi REALIZZAZIONE SCENA )O\,QÀDWH9LWR0DWHUD Sin dai tempi antichi Marzo è sempre stato considerato il mese della guerra; l’Inverno svanisce e lo sbocciare della Primavera segna il momento di tornare a combattere. In un cratere enorme causato dall’impatto di un meteorite milioni di anni fa, in un pianeta lontano dal nostro, abitano alcune persone. Come microbi colti dall’occhio di un microscopio o come pianeti colti dall’iride di un telescopio, noi osserviamo questi corpi vivere XQGUDPPDFKHVHPEUDFRQWHQHUHWXWWDO¶R̆HVD che il luogo ha subito millenni di anni prima. Lo spazio universale che ci separa da loro è talmente ampio che si attorciglia su se stesso HGLYHQWDWHPSRQRQSRVVLDPRLQIDWWLGH¿QLUH un’era geologica, o capire la fase evolutiva presente, se anche loro guardassero verso di noi, di certo vedrebbero solo dinosauri e una Terra che non c’è più. Osserviamo qualcosa che è destinato a viaggiare nello spazio cosmico per sempre e soli, come Galileo si sentì vedendo e scoprendo per la prima volta i corpi dei pianeti, ci trasformiamo in spettatori depositari di una storia, un dramma che sembra nascere dalla forza violenta di Marzo che investe ogni cosa con la sua acre ambiguità. 52 9. Festival Internazionale di Danza Contemporanea Since ancient times March has always been FRQVLGHUHGWKHPRQWKRIZDU:LQWHUIDGHVDZD\ and Spring blossoms as a reminder that it is time WRUHWXUQWRWKHEDWWOH¿HOG An enormous crater created by the impact of a meteorite millions of years ago on a distant planet, is inhabited by a small number of people. Like microbes captured by the eye of a microscope or planets viewed through the iris of a telescope, we observe these bodies as they experience a drama that seems to contain the ZHLJKWRIWKHGHVWUXFWLRQVX̆HUHGE\WKHSODFH millions of years before. The universal space that separates us from them is so large that LW ZLQGV DURXQG LWVHOI DQG EHFRPHV WLPH ZH FDQQRW GH¿QH D JHRORJLFDO HUD RU XQGHUVWDQG the current phase of evolution, and if they too were looking at us, all they would see are dinosaurs and an Earth that no longer exists. We observe something that is destined to travel through cosmic space forever and alone, the way Galileo felt when he discovered and UHYHDOHG WKH SODQHWV IRU WKH ¿UVW WLPH ZH WXUQ into spectators who become the repositories of history, of a drama that seems to be generated by the violent power of March as it slams against everything with its pungent ambiguity. 53 APERTO MEG STUART/ DAMAGED GOODS Hunter PRIMA ITALIANA / ITALIAN PREMIERE USA - BELGIO / USA - BELGIUM COREOGRAFIA E INTERPRETAZIONE ASSISTENTE DISEGNO COSTUMI Meg Stuart Kahori Furukawa DRAMMATURGIA ASSISTENTE VIDEO Jeroen Peeters Phillip Hohenwarter DISEGNO DEL SUONO PRODUZIONE Vincent Malstaf Damaged Goods (Bruxelles) SCENOGRAFIA CO-PRODUZIONE Barbara Ehnes HAU Hebbel am Ufer (Berlino), La Bâtie-Festival de Genève, Gessnerallee (zurigo), BIT Teatergarasjen (Bergen), Centre Pompidou (Parigi) con il sostegno di Hauptstadtkulturfonds (Berlino) DISEGNO COSTUMI Claudia Hill LUCI Teatro alle Tese 28.06, h 21.30 Jan Maertens VIDEO Chris Kondek ASSISTENTE ALLA COREOGRAFIA Meg Stuart & Damaged Goods sono sostenuti dalle autorità Fiamminghe e dalla Commissione della Comunità Fiamminga durata 90’ Ana Rocha ASSISTENTE ALLA SCENOGRAFIA Giulia Paolucci ©&RPHSRVVRGLJHULUHOHPROWHLQÀXHQ]HH tracce che mi hanno plasmato come persona e come artista? Come può il mio corpo rivelare LQ¿QLWH JHQHDORJLH H VWRULH PDL UHDOL]]DWH"ª In Hunter, primo assolo a serata intera, la coreografa Meg Stuart esplora il proprio corpo come un archivio popolato da ricordi personali e culturali, da antenati ed eroi artistici, da fantasie e forze invisibili. Scoprendone le tracce nel paese delle piccole cose che indugiano attorno al suo corpo, Stuart li traduce in una serie di autoritratti. Ritaglia e ricompone le esperienze sul banco di montaggio per rivelarne le possibili relazioni e forme, quali un corpo fumettistico, uno sciamano che canta un rituale, o una chiassosa scultura sonora. (VWHVLVXVXSHU¿FLGLYHUVHHULPEDO]DQGRGDXQ medium all’altro, gli stati interiori si rifrangono e risuonano in un mondo condiviso. 54 9. Festival Internazionale di Danza Contemporanea ©+RZ FDQ , GLJHVW WKH PDQ\ LQÀXHQFHV and traces that shaped me as a person and artist? How can my body unfold quantum genealogies and unrealized histories?». ,Q KHU ¿UVW HYHQLQJOHQJWK VROR hunter, choreographer Meg Stuart explores her own body as an archive populated with personal and cultural memories, ancestors and artistic heroes, fantasies and invisible forces. Discovering traces in the land of small things that linger around her body, Stuart translates them into a series of self-portraits. Experiences are cut up and spliced together on the editing table to reveal potential connections and forms, such as a cartoonesque body, a shamanist chanting ritual, or a noisy sound VFXOSWXUH 6WUHWFKHG RQWR GL̆HUHQW VXUIDFHV and ricocheting across media, interior states refract and resonate in a shared world. 55 APERTO KEIIN yOShIMURA Wa no Kokoro: Yashima PRIMA ITALIANA / ITALIAN PREMIERE GIAPPONE / JAPAN COREOGRAFIA Keiin Yoshimura DANZATRICE MAI Keiin Yoshimura MUSICISTA So Sugiura VESTIZIONE Keiko Koide PRODUZIONE Kamigatamai Tomonokai durata 20’ Teatrino Palazzo Grassi / Auditorium 26>27.06, h 17.00 In Kamigatamai ci sono molte cose che esprimono poeticamente l’essenza del dramma Noh. Noh rappresenta il Patrimonio Culturale Intangibile del Giappone. Il kamigata-mai yashima è uno di questi, e il soggetto è Noh yashima. yashima è il nome di una piccola isola sul mare interno di Setonaikai. Nel Trecento le famiglie heike H *HQML VL VFRQWUDURQR LQ JXHUUD )LQR DG allora, dominava la gloriosa famiglia heike. 0D L *HQML FUHVFHYDQR LQ SUHVWLJLR H SRWHUH H VFRQ¿VVHUR OD IDPLJOLD +HLNH LQ TXHOOD guerra. Un giorno di primavera, un monaco in pellegrinaggio visita yashima. Si ricorda di questa guerra. Nella notte un giovane generale appare al monaco. È il fantasma di <RVKLWVXQH LO JHQHUDOH GHOOD IDPLJOLD *HQML La sua esperienza in battaglia era grande H FRQVHJQz OD YLWWRULD DL *HQML 5DFFRQWD DO monaco gli episodi coraggiosi di cui era stato protagonista, il tempo passa, e arriva l’alba. Il fantasma di yoshitune svanisce con la brezza del mattino. In Kamigatamai we have many things which express poetically the essence of the drama of Noh. Noh is the Intangible Cultural Heritage of Japan. This kamigatamai Yashima is one of those and the matter is Noh Yashima. Yashima is the name of small island of Setonaikai, an inland sea. In the 12th century, at Yashima there had been a major war between the Heike family and the Genji family. Heike had enjoyed supremacy and glory up to then. The Genji family had been rising and gaining power. In that war Heike was defeated by Genji. One day in spring, a monk who was in pilgrimage, visited Yashima. He remembered that war. In the night one young general came to the monk. He was the ghost of Yoshitsune who had been the general of Genji. He had many combat resources and had won the victory for Genji. He illustrated to the monk how bravely he had fought in many episodes of that war. In the course of time dawn fell. The ghost of Yoshitsune faded away with the morning wind. 9. Festival Internazionale di Danza Contemporanea 57 APERTO KEIIN yOShIMURA Wa no Kokoro: Yuki PRIMA ITALIANA / ITALIAN PREMIERE GIAPPONE / JAPAN COREOGRAFIA Keiin Yoshimura DANZATRICE MAI Keiin Yoshimura MUSICISTA So Sugiura VESTIZIONE Keiko Koide PRODUZIONE Kamigatamai Tomonokai durata 20’ Teatrino Palazzo Grassi / Auditorium 28.06, h 17.00 29.06, h 16.00 <XNLVLJQL¿FDQHYH Quando nevica, tutto ciò che la neve ricopre luccica d’argento bianco. Tutto diventa di un bianco puro. yuki rappresenta la mia preghiera a Dio che l’amore e l’armonia della natura possano SXUL¿FDUH GDNDUPD WXWWHOHDQLPHVXOODWHUUD yuki è la mia preghiera che non ci sarà più DJRQLDHVR̆HUHQ]D _ la mia preghiera che la tristezza, il dolore e il lutto possano scomparire. <XNL q OD PLD SUHJKLHUD FKH WXWWR VL SXUL¿FKL ovunque. <XNL q OD PLD SUHJKLHUD D 'LR LQ¿QH SHU XQ mondo di amore, pace e armonia per tutte le DQLPHGHOODWHUUD¿QDOPHQWH 58 9. Festival Internazionale di Danza Contemporanea Yuki means snow. When it snows, everything covered with snow shines silver white. Everything becomes pure white. Yuki is my prayer to God that the love and harmony of nature will purify (from karma) all the souls on the earth. Yuki is my prayer that there will be no more DJRQ\QRUVX̆HULQJ _my prayer that sadness, sorrows and grief will heal. Yuki is my prayer that everything will be SXUL¿HGHYHU\ZKHUH Yuki is my prayer to God for the world of love, peace and harmony for all the souls on the earth lastly. 9. Festival Internazionale di Danza Contemporanea AURA Sezione dedicata allo sguardo sul dettaglio di alcune opere d’arte a Venezia. Cinque FRUHRJUD¿KDQQRVFHOWRGLLQGDJDUHDOFXQH opere pittoriche veneziane attraverso la vita di un dettaglio come punto di partenza per FUHDUHXQDSURSULDJHRJUD¿DGLJHVWL A section dedicated to the observation of a detail of certain Venetian masterpieces. Five choreographers have chosen to explore VSHFL¿F9HQHWLDQSDLQWLQJVWDNLQJWKHOLIHRI a detail as the point of departure to create a personal geography of gestures. 60 9. Festival Internazionale di Danza Contemporanea 9. Festival Internazionale di Danza Contemporanea 61 AURA JÉRÔME BEL Mondo novo PRIMA ASSOLUTA / WORLD PREMIERE FRANCIA / FRANCE Conservatorio Benedetto Marcello 19.06, h 17.30 20.06, h 18.30 21.06, h 17.00 22.06, h 17.30 omaggio a Il Mondo Novo di Giandomenico 7LHSRORD̆UHVFRVWDFFDWRGDOODYLOODGL=LDQLJR (Mirano) – oggi a Ca’ Rezzonico – 1791 tribute to Il Mondo Novo by Giandomenico Tiepolo, fresco removed from the villa at zianigo (Mirano) – now at Ca’ Rezzonico – 1791 CON Anna Albanese, Anna Altobello, Margherita D’Adamo, Cristina Di Biasio, Martina Di Iulio, Alice Donaggio, Luca Dorizzi, Martina Fileccia, Margherita Fiozzo, Elvira Forestan, Chiara Marcassa, Arianna Marcolini, Silvia Piovan, Francesca Pistolato, Laura Sardo, Arianna Spina, Annachiara Tronchin, Carla Vimercati E CON con il sostegno dell’Institut français / with the support of the Institut français Caterina Basso, Chiara Bersani, Gleni Caci, Matthieu Ehrlacher, Eva Geatti, Jacopo Jenna, Niccolò Meggiato, Paola Stella Minni, Camilla Monga, Mauro Romito, Andrea Sassoli e Yari Stilo PRODUZIONE la Biennale di Venezia durata 30’ 1 : Uno 2 : Due 3 : Tre 4 : Quattro 5 : Cinque 6 : Sei 7 : Sette 8 : Otto 9 : Nove 10 : Dieci 11 : Undici 12 : Dodici 13 : Tredici 14 : Quattordici 15 : Quindici 16 : Sedici 17 : Diciassette 18 : Diciotto 19 : Dicianove 20 : Venti 21 : Ventuno 22 : Ventidue 9HQWLWUp9HQWLTXDWWUR9HQWLFLQTXH9HQWLVHL 27 : Ventisette 28 : Ventotto 29 : Ventinove 30 : Trenta 31 : trentuno…40 : quaranta…50 : cinquanta…60 : sessanta…70 : settanta…80 : ottanta…90 : novanta…100 : cento… 200 : duecento… 300 : trecento… 400 : quattrocento… 500 : cinquecento… 600 : seicento… 700 : settecento… 800 : ottocento… 900 : novecento…1000 : mille 9. Festival Internazionale di Danza Contemporanea 63 AURA JONAThAN BURROWS/ MATTEO FARGION The Madonna Project PRIMA ASSOLUTA / WORLD PREMIERE GRAN BRETAGNA - ITALIA / GB - ITALy &DЧ*LXVWLQLDQ6DORQHÛSLDQR 20.06, h 14.00 21>22.06, h 15.30 The Madonna Project parte dalla Madonna col Bambino e gloria di cherubini rossi, dipinta da Bellini nel Quattrocento, per generare un torrente di Madonne, mappando un paesaggio alterato di immagini e concetti FKH GHOLFDWDPHQWH VPRQWDQR O¶LFRQRJUD¿D convenzionale del quadro. Come l’altro spettacolo di Burrows e Fargion a Venezia, Body Not Fit For Purpose, The Madonna Project si basa sulla struttura di La Folia, un’antica melodia europea che risale allo stesso periodo del quadro di Bellini, e che da allora è stata usata come tema per variazioni da oltre 150 compositori. Questo percorso di traslazione da un medium a un altro costituisce una strategia continuativa e un’ossessione per i due artisti, che creano eventi nei quali il pubblico sente la musica nei movimenti e vede la danza nei testi e nei suoni che ascoltano. 64 9. Festival Internazionale di Danza Contemporanea omaggio alla Madonna col Bambino e gloria di cherubini rossi di Giovanni Bellini, dipinto del 1485 circa – oggi alle Gallerie dell’Accademia a tribute to the Madonna col Bambino e gloria di cherubini rossi by Giovanni Bellini, painted in 1485 circa – now at the Gallerie dell’Accademia PRODUZIONE la Biennale di Venezia COPRODUZIONE Kaaitheater Brussels, PACT zollverein Essen, 6DGOHUЧV:HOOV7KHDWUH/RQGUD e BIT Teatergarasjen Bergen Entrambi sono attualmente artisti in residenza al Nightingale, Brighton Inghilterra e vorrebbero ringraziare anche Canon Richard 0RDWWH6W$QQHЧV&KXUFK/HZHV1LN+D̆HQHU e HzT Berlin durata 15’ 7KH 0DGRQQD 3URMHFW WDNHV %HOOLQLЧV 15th century Madonna col Bambino e gloria di cherubini rossi as the initiator of a torrent of Madonnas, mapping out an altered landscape of images and concepts which gently unpick the conventional iconography of the painting. Like Burrows’ DQG )DUJLRQЧV RWKHU Venice performance Body Not Fit For Purpose, 7KH0DGRQQD3URMHFW is built upon the structure of La Folia, an early European melody which dates from the same century DV%HOOLQLЧVSDLQWLQJDQGKDVEHHQXVHGDVD basis for variations by over 150 composers since. This process of translation across mediums has been an ongoing strategy and obsession of the two artists, creating events where the audience hears music in the movement and sees dance in the texts and sounds they are hearing. AURA omaggio a La Nuda GHO*LRUJLRQHD̆UHVFR staccato dal Fondaco dei Tedeschi – oggi alla Galleria Franchetti Ca’ d’Oro – 1508 SABURO TEShIGAWARA / KARAS a tribute to Giorgione’s La Nuda, a fresco removed from the Fondaco dei Tedeschi – now at the Galleria Franchetti Ca’ d’Oro – 1508 COREOGRAFIA, LUCI, COSTUMI Saburo Teshigawara (\HV2̆ SELEZIONE MUSICALE PRIMA ASSOLUTA / WORLD PREMIERE GIAPPONE / JAPAN CON a cura di Saburo Teshigawara Saburo Teshigawara e Rihoko Sato ASSISTENTE LUCI Sergio Pessanha &DЧ*LXVWLQLDQ6DODGHOOH&RORQQH 21>22.06, h 16.00 e 17.00 PRODUZIONE la Biennale di Venezia durata 20’ OCChI SENZA SGUARDO Cornice in dissoluzione Corpo in evaporazione Tempo che evapora Danza e pittura come una forza vitale che trasforma la sua forma attraverso il tempo EyES OFF Dissolving frame Evaporating body Time evaporates Dance and painting as a life force transforming its form through time 9. Festival Internazionale di Danza Contemporanea 67 AURA LAURENT ChÉTOUANE / ROBERTA MOSCA Solo with R / Perspective (s) omaggio al Miracolo di San Marco di Jacopo Tintoretto, dipinto realizzato per la Scuola Grande di San Marco – oggi alle Gallerie dell’Accademia, 1548 a tribute to The Miracle of Saint Mark by Jacopo Tintoretto, painted for the Scuola Grande di San Marco – now at the Gallerie dell’Accademia, 1548 PRODUZIONE la Biennale di Venezia durata 20’ PRIMA ASSOLUTA / WORLD PREMIERE FRANCIA - GERMANIA / FRANCE - GERMANy Teatrino Palazzo Grassi / Auditorium 26>28.06, h 17.30 29.06, h 16.30 Un incontro ferisce sempre, a sorpresa, FRQ GRORUH SHUFKp DSUH LQ FLDVFXQR GL QRL XQ luogo sconosciuto, una breccia profonda, un nuovo territorio, un luogo estraneo che ci fa perdere i nostri riferimenti abituali, il nostro fragile senso di equilibrio. Ci permette allora di trovare insieme una nuova disposizione, una nuova cognizione del nostro proprio mondo e trasforma ogni proposta in un dono comune che ci facciamo l’un l’altro. Danzare per 5REHUWD 0RVFD H /DXUHQW &KpWRXDQH q DQFKH un incontro con lo spazio, un’apertura al suo YXRWR LQ¿QLWR DOOD VXD LQFRPPHQVXUDELOLWj la sua profondità disorientante, il suo peso impensabile. Qual è questo strano rapporto del corpo danzante con lo spazio se non si considera più la danza come una rappresentazione di “forme” corporee attinte dalla nostra interiorità ma come l’esperienza di un incontro, di un attraversamento del vuoto che ci circonda? Cosa vede dunque lo spettatore seduto davanti DOOD UL SUHVHQWD]LRQH GL XQD FDGXWD LQ¿QLWD aperta, consegnata a forze di gravità che cambiano secondo il nostro desiderio? Forse la realtà del nostro corpo, le sue intensità, le sue pulsioni prima che un senso unico lo cristallizzi LQLPPDJLQL¿VVH 68 9. Festival Internazionale di Danza Contemporanea An encounter is always wounding, surprising, painful because it opens an unfamiliar place within each of us, a profound breach, a new territory, a strange place that causes us to lose our traditional points of reference, our fragile sense of balance. As a result, it makes it possible to work together to ¿QGDQHZGLVSRVLWLRQDQHZXQGHUVWDQGLQJ of our personal world and transforms any proposal into a common gift that each of us makes to the other. For Roberta Mosca and Laurent Chétouane, dance is also a meeting ZLWK VSDFH RSHQLQJ XS WR LWV LQ¿QLWH YRLG its incommensurability, its disorienting depth, its unfathomable weight. What is this strange relationship between the dancing body and space if we no longer consider dance as a representation of bodily “forms” drawn from our inner selves, but as the experience of encounter, of engaging with the void that surrounds us? What is it then that the spectator sees as he sits before the (re) SUHVHQWDWLRQRIDQLQ¿QLWHIUHHIDOOGHOLYHUHG to the forces of gravity that change according to our wishes? Perhaps the reality of our body, its tensions and its urges, before a univocal meaning crystallizes them into still images. AURA MIChELE DI STEFANO/ MARGhERITA MORGANTIN 190 cm ca. omaggio a Il Mondo Novo di Giandomenico 7LHSRORD̆UHVFRVWDFFDWRGDOODYLOODGL=LDQLJR (Mirano) – oggi a Ca’ Rezzonico – 1791 tribute to Il Mondo Novo by Giandomenico Tiepolo, fresco removed from the villa at zianigo (Mirano) – now at Ca’ Rezzonico – 1791 IDEAZIONE Michele Di Stefano e Margherita Morgantin PRODUZIONE la Biennale di Venezia durata 20’ PRIMA ASSOLUTA / WORLD PREMIERE ITALIA / ITALy &D¶*LXVWLQLDQ6DORQHGHOÛSLDQR 27>28.06, h 15.30 Essere attirati dalla proiezione dello sguardo altrui è nell’ordine naturale delle cose. Voltarsi nella stessa direzione è uno dei segreti della coabitazione. Adottare la stessa ottica. Stare vicini. Ma il teatro è regolato da un ciarlatano con l’asta nera che agisce di spalle. Con quell’asta milioni di persone nei secoli hanno rivoltato le meduse morte sul bagnasciuga. Misura delle inquadrature di alcuni istanti nei loro ricordi. To be attracted by the projection of another person’s gaze is in the natural order of things. To look in the same direction is one of the secrets of cohabitation. To adopt the same point of view. To be close. But theatre is controlled by a charlatan with a black stick who stands with his back to us. Millions of people have used that stick over WKH FHQWXULHV WR WXUQ GHDG MHOO\¿VK RYHU RQ the beach. Measure of moments framed in their memories. 9. Festival Internazionale di Danza Contemporanea 71 9. Festival Internazionale di Danza Contemporanea VITA NOVA Progetto inedito di creazione e formazione rivolto a danzatori tra i 10 e i 15 anni. Dopo una prima fase di ricerca sul territorio nazionale, il Festival propone sette creazioni LQFXLLFRUHRJUD¿LQYLWDWLLQFRQWUDQR giovanissimi danzatori, coinvolgendoli in un percorso articolato verso la creazione di QXRYHFRUHRJUD¿HFRQO¶LQWHQWRGLFRVWUXLUH un repertorio di danza contemporanea a loro destinato. An original creation and training project involving dancers between the ages of 10 and 15. Following an initial countrywide phase of research, the Festival presents seven creations in which the guest choreographers meet the very young dancers and involve them in a guided process towards the creation of new choreographic works, with the intent to build a contemporary dance repertoire for this age group. 72 9. Festival Internazionale di Danza Contemporanea 9. Festival Internazionale di Danza Contemporanea 73 VITA NOVA CONCEPT E COREOGRAFIA CRISTINA RIZZO Cristina Rizzo CON Annamaria Ajmone, Alessia Bizzotto, Francesca Costa, Linda De Pellegrin, Giulio Forlani, Giorgia Lazzari, Giorgia Luisetto e Alice Pubulin MUSICA Bolerò %ROpUR di M. Ravel nell’esecuzione della Berliner Philharmoniker diretta da Pierre Boulez ITALIA / ITALy ASSISTENTE Carlotta Plebs Ca’ Giustinian/Sala delle Colonne 19.06, h 16.30 25.06, h 17.00 26>28.06, h 16.00 CURA E DISTRIBUZIONE Chiara Trezzani PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON CAB008 con il sostegno di Regione Toscana e MiBACT durata 20’ «Il Bolero raveliano ci trascina, senza particolari allusioni, senza nostalgia, a uno stato di esaltazione inibita, in un felice coinvolgimento collettivo». Questo nuovo progetto, è un oggetto FRUHRJUD¿FR FKH VL VYLOXSSD SDUWHQGR dall’assunto esplicito che il Bolero di Ravel è la partitura orchestrale più popolare esistente al mondo, una musica che tutti conoscono e riconoscono. Scritto nel 1928, quando 0DXULFH 5DYHO DYHYD  DQQL H VR̆ULYD GHL primi sintomi del FTD (frontotemporal dementia), l’intero pezzo è costruito su una singola melodia – divisa in due frasi – che si ripete nove volte. 0D FKH FRVD q H̆HWWLYDPHQWH XQ %ROHUR" È come un isola deserta, lontana dai continenti. Un luogo dove ri-cominciare. Un luogo dalle molte risonanze esistenziali. Bolerò, pensato appositamente per la Biennale Danza di Venezia, vede coinvolto un gruppo di giovanissimi interpreti dai 10 ai 13 anni che VLFRQIURQWDQRFRQXQDVFULWWXUDFRUHRJUD¿FD contemporanea composta sulla musica originale. Dato questo punto di partenza è SRVVLELOH YHUL¿FDUH XQD FRQGL]LRQH GLQDPLFD in ‘apertura massima’, forzare la traiettoria 74 9. Festival Internazionale di Danza Contemporanea «Ravel’s Bolero carries us away, with no particular allusions, without nostalgia, towards a state of inhibited exaltation, in a joyous collective experience». This new project is a choreographic object developed on the basis of the explicit premise that Ravel’s Bolero is the most popular orchestral work in the world, a piece of music that everyone knows and recognizes. Written in 1928, when Ravel ZDV  \HDUV ROG DQG EHJLQQLQJ WR VX̆HU WKH ¿UVW V\PSWRPV RI )7' frontotemporal dementia), the entire piece is built on a single melody – divided into two phrases – that is repeated nine times. But what is a Bolero, really? It is like a desert island, located far away from the continents. A place to start over. A place with many existential echoes. Bolerò, conceived VSHFL¿FDOO\IRUWKH'DQFH%LHQQDOHLQ9HQLFH involves a group of very young performers between the ages of 10 and 13 who will work with a contemporary choreographic composition set to original music. This starting point makes it possible to create a dynamic condition of ‘total openness’, to force the sinuosamente accattivante di una massa eccitata, praticare delle turbolenze corporee tese a rompere il quadro della compostezza spingendosi verso altre dimensioni. Qui si tratta d’immaginare la trasmissione di SUDWLFKH PROWR VSHFL¿FKH SHU FRUSL FKH VL preparano a una trasformazione, immaginare l’attivazione di un lume interno, qualcosa di simile a un fuoco luminoso capace di spostare il paradigma dal dominio alla disposizione. sinuously entrancing trajectory of an excited crowd, to practice bodily turbulences that seek to shatter the atmosphere of composure to break out towards other dimensions. The purpose here is to imagine the transmission RIKLJKO\VSHFL¿FSUDFWLFHVIRUERGLHVWKDWDUH preparing for a transformation, to imagine sparking an inner light, something similar to DJORZLQJ¿UHWKDWVKLIWVWKHSDUDGLJPIURP dominion to disposition. 75 VITA NOVA ADRIANA BORRIELLO COREOGRAFIA Adriana Borriello CON Gaia Benassi, Andrea Bretti, Elisabetta Bordoni e Susanna Pinalto MUSICISTA Tacita Muta Letizia Renzini ITALIA / ITALy Valeria Diana ASSISTENTE PRODUZIONE Teatro alle Tese 20.06, h 20.00 la Biennale di Venezia IN COLLABORAZIONE CON Fondazione Romaeuropa, attività di promozione danza durata 20’ Era un’antica dea infera romana, FHOHEUDWD FRPH GHD GHO 6LOHQ]LR SHUFKp OD parola come valore doveva appartenere solo agli uomini, il silenzio alle donne. Ma Tacita Muta è semplicemente uno spunto. Con i giovanissimi danzatori di quest’avventura immaginiamo una sorta di rito di passaggio, nel silenzio, nel corpo, nel suono del corpo: ludica trasmissione di saperi, sapori e umori, condivisione di uno spazio-tempo, con le sue regole del gioco. She was an ancient Roman goddess, celebrated as the goddess of Silence, because the value of the word was the domain of men, and the silence for women. But Tacita Muta is simply a cue. With the very young dancers of this adventure we imagine a sort of rite of passage, in silence into the body, in the sound of the body: a playful WUDQVPLVVLRQ RI NQRZOHGJH ÀDYRXUV DQG moods, sharing space and time to follow the rules of the game. 9. Festival Internazionale di Danza Contemporanea 77 VITA NOVA hELEN CERINA COREOGRAFIA Helen Cerina CON Post grammatica Serena Boccaccini, Daria Del Moro, Alexia Giaconi, Elisa Grandicelli, Elisabetta Poeta e Iacopo Maria Troiano ITALIA / ITALy MUSICA Luca Losacco Teatro alle Tese 21.06, h 20.00 PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON AMAT & Civitanova Danza per Civitanova Casa della Danza durata 20’ 5LÀHWWR VXO SDUDGRVVR GHO JLRFR XQD simulazione più concreta e intensa della realtà. Penso a una grammatica che condiziona tempo, spazio e relazioni. Credo che il gioco sia veramente gioco solo nel superamento della sua stessa grammatica, lì dove si liberano l’energia e l’emozione antica della sopravvivenza. Vedo l’aderenza totale dei bambini a queste simulazioni, tale che nello stesso campo più giochi si intersecano senza ostacolarsi. Immagino la foga tracciare articolati disegni. 78 9. Festival Internazionale di Danza Contemporanea ,UHÀHFWRQWKHSDUDGR[RISOD\DPRUH down-to-earth and intense simulation of reality. I think of a grammar that regulates time, space and relations. I believe that a game is a game only when it transcends its own grammar, to go where it can release energy and the ancient emotion of survival. I see the total participation of children in these VLPXODWLRQV PDNLQJ LW SRVVLEOH IRU GL̆HUHQW JDPHV WR LQWHUVHFW LQ WKH VDPH SOD\LQJ ¿HOG without being an obstacle to one another. I imagine the excitement of tracing intricate patterns. VITA NOVA VIRGILIO SIENI La stanza del fauno ITALIA / ITALy COREOGRAFIA Virgilio Sieni CON Serena Carella e Giordano Signorile ASSISTENTI AL PROGETTO Giulio De Leo ed Erika Guastamacchia PRODUZIONE la Biennale di Venezia Teatro alle Tese 24.06, h 20.00 IN COLLABORAZIONE CON Teatroscalo – Menhir – Teatri Abitati – Unione Europea – Regione Puglia – Teatro Pubblico Pugliese – Comune di Santeramo In Colle – Innovazione nella rete delle residenze WHDWUDOL,QWHUYHQWRFR¿QDQ]LDWRGDO)(6532 PUGLIA 2007/2013, Asse IV – Azione 4.3.2, ḊGDWRGDOOD5HJLRQH3XJOLDDO7HDWUR3XEEOLFR Pugliese durata 20’ I due giovanissimi interpreti tracciano una danza composta da duetti e sguardi, vicinanze e segni, oggetti e ritmi, che lasciano ḊRUDUH OD SUHVHQ]D GHO ULWR FKH GLYLHQH gioco e viceversa. The two teenage performers outline a dance made of duets and glances, proximity and signs, objects and rhythms, which bring the ritual to the surface transforming it into play and viceversa. 9. Festival Internazionale di Danza Contemporanea 81 VITA NOVA COREOGRAFIA SIMONA BERTOZZI/ NExUS Simona Bertozzi CON Nanni Capecchi, Alice Crocioni, Laura Lombardi, Carlotta Martellini, Andrea Suero e Diletta Taddei MUSICA A. Vivaldi Andante da Concerto in D minor for 2 Mandolins, J. Barrière Allegro Prestissimo da Sonata for 2 Cellos (feat. Yo-Yo Ma & Bobby McFerrin) Guardare ad altezza d’erba ASSISTENTE ALLA COREOGRAFIA Lucia Guarino PRODUZIONE ITALIA / ITALy la Biennale di Venezia IN COLLABORAZIONE CON Teatro alle Tese 25.06, h 20.00 Teatro Stabile dell’Umbria PROGETTO A CURA DI Associazione Culturale Nexus Si ringraziano Centro Danza, Centro Studi Danza Umbro, Dance Gallery, School of Dancing Spring durata 20’ «tutto è rivelazione, tutto lo sarebbe se fosse accolto allo stato nascente» «everything is revelation, everything would be if it were accepted at the moment of birth» Maria Zambrano Maria Zambrano Osservare. Scoprire. 6SLQJHUVL¿QRDOOLPLWH Tornare a ripetere. Riformulare le regole del gioco. Perpetrare lo sforzo, la frenesia e farne esercizio di ascolto, il compito anatomico SHUXQGLDORJRGLVJXDUGLGL¿JXUHSHUXQDSUDWLFDGLLQFRQWURHFRQRVFHQ]DUHFLSURFD To observe. To discover. To push one’s self to the limit. To rehearse again. To rewrite the rules of the game. 7RUHLWHUDWHWKHH̆RUWWKHIUHQ]\DQGWXUQLWLQWRDQH[HUFLVHLQOLVWHQLQJWKHDQDWRPLFDOWDVN IRUDGLDORJXHRIJODQFHV¿JXUHVIRUDSUDFWLFHRIHQFRXQWHUDQGPXWXDOXQGHUVWDQGLQJ Guardare ad altezza d’erba, è un invito a mutare la verticalità delle posture e dei camminamenti per esercitare l’immediatezza della visione. Looking at grass-level, is an invitation to modify the verticality of postures and walking paths to exercise the immediacy of vision. Secondo uno schema di attraversamenti H FRQ¿JXUD]LRQL JHRPHWULFKH L JLRYDQL interpreti compongono una partitura di gesti e pulsazioni dinamiche in cui l’avvicendarsi di ruoli e mimetismi rimanda alla narrazione del folklore ludico infantile. La tensione interna DOODVWUXWWXUDFRUHRJUD¿FDYXROHFRQLXJDUHOD VHULHWjHO¶LPSLHJR¿VLFRFKHFDUDWWHUL]]DQRLO gioco, con la capacità di rinnovamento delle D]LRQLFKHORFRQ¿JXUDQR$ELOLWjGHVWUH]]D DWWHVD ULÀHVVLRQH VL DSURQR DOO¶D]]DUGR H 82 9. Festival Internazionale di Danza Contemporanea all’esplorazione. A ogni giovane partecipante il compito di appassionarsi alle regole e alla loro reversibilità, dialogando con la scelta dei tempi e la mappatura dello spazio. Una ritualità vertiginosa del “minuscolo” che, tra andature, battiti e ripetizioni, riscopre uno stato originario, primordiale, della condivisione e consegna ai giovanissimi corpi un transito verso l’invenzione e l’esercizio della fantasia. In a pattern of crossings and geometric FRQ¿JXUDWLRQVWKH\RXQJSHUIRUPHUVEXLOG a score composed of gestures and dynamic pulsations in which the sequence of roles and mimicking alludes to the stories in children’s ludic folklore. The inner tension of the choreographic structure attempts to combine the seriousness and physical H̆RUW WKDW FKDUDFWHUL]H SOD\ ZLWK WKH capacity to reinvent the actions it is made of. Skill, dexterity, waiting, thinking are open to challenge and exploration. Every young participant should get excited about the rules and about reversing them, in a dialogue with the timing and the mapping of the space. A dizzying rituality of the “minuscule” that, in an experience of pace, beat and repetition, discovers an original, primordial condition of sharing and sets these young bodies on the road to invention and the exercise of the imagination. 9. Festival Internazionale di Danza Contemporanea 83 VITA NOVA STIAN DANIELSEN COREOGRAFIA Stian Danielsen CON Alice Cattelan, Giulia Fregonese, Emma Piotto ed Elisa Settin PRODUZIONE Let’s play la Biennale di Venezia NORVEGIA / NORWAy CSC Centro per la Scena Contemporanea / Casa della danza di Bassano del Grappa sostenuto dalla Regione del Veneto Teatro alle Tese 26.06, h 20.30 IN COLLABORAZIONE CON La residenza di creazione al CSC di Bassano del Grappa è stata sostenuta dalla Reale Ambasciata di Norvegia durata 20’ La creazione si svilupperà prevalentemente insieme ai giovani danzatori veneti, come risposta ad alcune proposte del coreografo norvegese. Il punto di partenza della ricerca sarà un gioco dal quale si svilupperà un vocabolario di movimenti, avrà dunque una dimensione transnazionale e si baserà sulla capacità di instaurare un dialogo interculturale. The creation will be developed mainly with the young dancers from the Veneto region, in response to a series of proposals from the Norwegian choreographer. The starting point for the experimentation will be a game that generates a vocabulary of movements, and will therefore be transnational in nature and based on the capacity to establish an intercultural dialogue. 9. Festival Internazionale di Danza Contemporanea 85 VITA NOVA VIRGILIO SIENI Indigene_ prima parte ITALIA / ITALy Teatro alle Tese 28.06, h 20.00 COREOGRAFIA Virgilio Sieni ASSISTENTI ALLA COREOGRAFIA Chelo zoppi e Giulia Mureddu CON Bettina Bernardi, Naomi Biancotti, Virginia Cervelli Montel e Linda Pierucci MUSICA ORIGINALE Giovanni Dario Manzini ESECUZIONE DAL VIVO Ensemble De Rerum Mechanica ÀDXWR)UDQFHVFR&KHFFKLQL violino: Pietro Montemagni viola: Emanuele Caligiuri violoncello: Giorgio Marino direttore: Giovanni Dario Manzini PRODUZIONE la Biennale di Venezia, Settori Danza e Musica IN COLLABORAZIONE CON in collaborazione con Biennale Musica / in collaboration with Music Biennale MiBACT, Regione Toscana, Accademia sull’arte del gesto durata 20’ Biennale Danza instaurerà quest’anno una intensa collaborazione con Biennale Musica diretta dal maestro Ivan Fedele. Lo scopo è quello di condividere alcune pratiche che mettano in relazione il gesto del corpo col gesto della musica, il suono con la danza. Indigene è il primo frutto di questa collaborazione. Le quattro giovanissime interpreti, che dal 2013 fanno parte del JUXSSR %XWWHUÀ\ &RUQHU GjQQR OXRJR D XQD FRUHRJUD¿D VWUXWWXUDWD VHFRQGR LO JLRFR combinatorio del duetto, per terminare in un quartetto “boschivo”. Otto brani che costituiranno il terreno d’indagine del gesto in forma di gioco. 86 9. Festival Internazionale di Danza Contemporanea The Dance Biennale this year will begin an intense collaboration with the Music Biennale directed by Maestro Ivan Fedele. The purpose is to share practices that foster a relationship between the gesture of the body and the gesture of music, between sound and dance. Indigene LV WKH ¿UVW SURGXFW RI WKLV collaboration. The four young performers, ZKR KDYH EHHQ PHPEHUV RI WKH %XWWHUÀ\ Corner group since 2013, will bring to the stage a choreography structured according to the combination devices of the duet, and end in a “sylvan” quartet. Eight pieces that will constitute the grounds for exploring gesture in the form of play. 9. Festival Internazionale di Danza Contemporanea INVENzIONI Tre nuove creazioni sono nate dal lavoro di WUHFRUHRJUD¿ULPDVWLLQUHVLGHQ]DD9HQH]LD per circa due settimane. Le opere create appositamente per il Festival propongono tre GL̆HUHQWLULÀHVVLRQLVXOODJHQHVLGHOJHVWR Three new creations are the result of the work of three choreographers who were in residency in Venice for about two weeks. 7KHSLHFHVFUHDWHGVSHFL¿FDOO\IRUWKH )HVWLYDOR̆HUWKUHHGL̆HUHQWUHÀHFWLRQVRQ the genesis of the gesture. 88 9. Festival Internazionale di Danza Contemporanea 9. Festival Internazionale di Danza Contemporanea 89 INVENZIONI JÉRÔME BEL Senza titolo PRIMA ASSOLUTA / WORLD PREMIERE FRANCIA / FRANCE COREOGRAFIA Jérôme Bel CON Caterina Basso, Chiara Bersani, Gleni Caci, Matthieu Ehrlacher, Eva Geatti, Jacopo Jenna, Nicolò Meggiato, Paola Stella Minni, Camilla Monga, Mauro Romito, Andrea Sassoli e Yari Stilo PRODUZIONE la Biennale di Venezia Teatrino Palazzo Grassi / Foyer 19.06, h 19.45 20.06, h 16.45 21>22.06, h 11.45 durata 20’ con il sostegno dell’Institut français / with the support of the Institut français La possibilità di un opera d’arte oggi, R GL XQD FRUHRJUD¿D QRQ q TXHOOD GL IDUH XQ¶D̆HUPD]LRQH PD GL LQYLWDUH OR VSHWWDWRUH a reinventarsi, o in modo meno utopico, di ricercare la propria ideologia dello sguardo o GHOODFRVWUX]LRQHGL6pRO¶DUWLFROD]LRQHGHOOD propria sicurezza. /¶RSHUDG¶DUWHQRQSXzGLUHQXOODLQVpSXz rappresentare un’idea politica o un concetto, ma oggi l’opera d’arte è la formulazione di se stessa. L’opera d’arte non può che indagare, o ri-cercare, il proprio dominio, e acquisire la FRVFLHQ]D GL Vp DWWUDYHUVR OD ULÀHVVLRQH SHU speculum in aenigmae) e attraverso questa consapevolezza diventare un’esperienza del 6p OR VSHWWDWRUH  PD PDL XQ¶HVSHULHQ]D GL qualcosa di diverso. Far parte di un’esperienza G¶DUWHqVHPSUHHVRORXQ¶HVSHULHQ]DGLVp Marten Spangberg 90 9. Festival Internazionale di Danza Contemporanea The possibility of an art-piece, even a choreography, today is not to propose an utterance, but to invite the spectator to reinvent him/herself, or perhaps less utopic, to re-search his/her ideology of watching, of constructing Self, or articulating security. The artwork cannot say anything in itself, it can represent a political idea or concept, but today the artwork is a formulation of itself. The artwork can only investigate, or re-search, its own domain, and become selfFRQVFLRXVWKURXJKUHÀHFWLRQ SHUVSHFXOXP in aenigmae) and through this awareness it can become an experience of the Self (the spectator) but never an experience of something else. To be part of an artexperience is always only the experience of the self. Marten Spangberg INVENZIONI ROy ASSAF Dance Grammar PRIMA ASSOLUTA / WORLD PREMIERE ISRAELE / ISRAEL COREOGRAFIA Roy Assaf CON Geneviève Boulet, Francesca Caselli, Daria Greco, Laura Montanari, Alessandra Padelletti Coda, Silvia Pezzarossi, Dana Terracina ed Elisa zelani PRODUZIONE la Biennale di Venezia Corderie dell’Arsenale 27>29.06, h 16.00 FRQLOVRVWHJQRGHOO¶8̇FLR&XOWXUDOHGHOO¶$PEDVFLDWDG¶,VUDHOH with the support of the Culture Department of the Embassy of Israel &RVuFRPHODJUDPPDWLFDGjVLJQL¿FDWRDOOH nostre parole aiutando il pubblico a capire, così piegare, torcere, infrangere e scompaginare la grammatica può creare confusione. Arriviamo dal mondo conosciuto dell’opera, un’opera che è stata sottoposta a una miriade di scelte VSHFL¿FKH GHO FRUHRJUDIR H GHL GDQ]DWRUL HG è stata presentata al pubblico come un testo compiuto. Scegliere quindi la grammatica come variabile nella creazione di una nuova RSHUDVLJQL¿FDODQFLDUVLQHOODFRQIXVLRQHQHOOD SHUGLWDGLFKLDUH]]DHTXLQGLGLD̆DFFLDUVLDXQ momento ricco e gravido, dove tutte le strade sono aperte. Creare scompiglio, chiedere di giocare con la grammatica di una danza, VLJQL¿FD VFDUGLQDUH LO JLRFR H LOOXPLQDUH LO campo di gioco con un vasto ignoto. Questo atto di distruzione, essendo instabile, è terreno fertile e sinonimo dell’atto di creazione. Le regole, le strutture e i precetti di base cessano di essere vincolanti e diventano invece giocattoli fra le mani. Qui, si scoprono il coraggio e l’umorismo dei giocatori. As grammar gives meaning to our words and comprehension to our audience, so too can the bending, twisting, breaking and scattering of grammar confuse. We come from the known world of a work, one WKDWKDVEHHQVXEMHFWWRDP\ULDGRIVSHFL¿F choices by choreographer and dancers alike and has been presented to an audience as a complete text. To then choose its grammar as the variable in creating a new work, is to plunge into confusion, into loss of comprehension, and thus to to face a rich and pregnant moment, where all roads are open. To wreak havoc, to demand play with the grammar of a dance, is to crack the game wide open and allow for a vast unknown WR LOOXPLQDWH WKH SOD\LQJ ¿HOG 7KLV DFW RI destruction, by virtue of its instability, is fertile ground and is synonymous with the act of creation. Rules, structures and underlying assumptions cease to bind and are instead toys in the hand. Here, the courage and humor of the players are discovered. 9. Festival Internazionale di Danza Contemporanea 93 INVENZIONI COREOGRAFIA ALESSANDRO SCIARRONI CON You don’t know how lucky you are PRIMA ASSOLUTA / WORLD PREMIERE ITALIA / ITALy Alessandro Sciarroni Anna Bragagnolo, Hannah Buckley, Mariano Cipriani, Sharon Estacio, Marta Lucchini, Chiara Lucisano, Leon Maric, Matteo Ramponi, Cinzia Schincariol, Giovanni Trono, Elisa Vassena E CON Stefano Tassi, Davide Vianello e Linda zennaro ESERCIZI E CONSULENZA DRAMMATURGICA Elena Giannotti TRAINING E SOUNDSCAPE ORIGINALE Pablo Esbert Lillenfeld Conservatorio Benedetto Marcello 26>28.06, h 19.00 29.06, h 15.00 CURA E PROMOZIONE Lisa Gilardino ORGANIZZAZIONE E AMMINISTRAZIONE Chiara Fava PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON D.ID dance identity – Pinkafeld durata 45’ L’idea della ricerca è quella di esplorare il concetto di salto inteso come elevazione ¿VLFD LQHOXWWDELOH FDGXWD H PHWDIRUD GHOOH forze che possiedono l’esistenza. Per questa ragione l’artista intende creare un laboratorio integrato con interpreti provenienti da diversi background: Ginnastica, Danza contemporanea, Acrobatica e Parkour. All’abilità del danzatore contemporaneo, capace di vivere il tempo presente e di comporre lo spazio temporale tra l’elevazione e la ricaduta WUDGXFHQGRORLQYLWDYHUUjḊDQFDWDODVDSLHQWH mobilità articolare dei ginnasti, la rituale ed HOHYDWD GL̇FROWj GHJOL HVHUFL]L GHOO¶DFUREDWD e la consapevolezza nell’interpretazione dei propri limiti di chi pratica la disciplina del Parkour. <RX GRQЧW NQRZ KRZ OXFN\ \RX DUH nasce dagli stessi concetti contenuti nel più DPSLR SURJHWWR GHOOЧDUWLVWD LQWLWRODWR Will you still love me tomorow? – disciplina, resistenza, concentrazione e ripetizione. Questo studio realizzato durante tre settimane di residenza DOOD %LHQQDOH VL ḊDQFD DOOR VSHWWDFROR Folk-s del 2012, sulla pratica della danza popolare, a Untitled del 2013 sulla pratica della giocoleria H FRQWLQXHUj QHO  FRQ XQЧXOWHULRUH produzione sulle pratiche sportive: Aurora. 94 9. Festival Internazionale di Danza Contemporanea The idea behind this experimentation is to explore the concept of leap understood as physical elevation, inevitable fall and a metaphor of the forces that possess existence. For this reason the artist intends to create an integrated workshop with performers coming from various backgrounds: Gymnastics, Contemporary Dance, Acrobatics and Parkour. The skill of the contemporary dancer, who lives the present time and organizes the temporal space between elevation and fall to translate it into life, will be complemented by the expert articular mobility of the gymnasts, WKHH[WUHPHULWXDOGL̇FXOW\RIWKHDFUREDW¶VIHDWV and the conscientious interpretation of their own limits in the practitioners of the discipline of Parkour. you don’t know how lucky you are is based on the same concepts contained in the artist’s more ample project entitled Will you still love me tomorrow? – discipline, resistance, concentration and repetition. This study realized during three weeks of residency to La Biennale together with the 2012 production Folk-s, about the practice of folk dance, with the 2013 Untitled on the practice of juggling and will continue in 2015 with another production concerning sports practices: Aurora. 9. Festival Internazionale di Danza Contemporanea AGORÀ Sezione dedicata all’aperto e alla dimensione del vuoto nei campi veneziani. Cinque creazioni sono pensate per abitare alcuni campi. Si scopre così una nuova demarcazione della città: spazi di attesa in cui il gesto della danza dialoga con i tempi e i luoghi del quotidiano. A section dedicated to the outdoors and to the dimension of the void in Venetian campi. Five creations have been conceived WRLQKDELWVSHFL¿FFDPSLWKHUHE\UHYHDOLQJ a new demarcation of the city: spaces for waiting in which the gesture of dance dialogues with the pace and the places of everyday life. 96 9. Festival Internazionale di Danza Contemporanea 9. Festival Internazionale di Danza Contemporanea 97 AGORÀ COREOGRAFIA MIChELE DI STEFANO_MK Sahara Para Todos PRIMA ASSOLUTA / WORLD PREMIERE ITALIA / ITALy Michele Di Stefano CON Alberto Baraghini, Mauro Bernardi, Marta Biddau, Stefania Carvisiglia, Eugenia Coscarella, Elisa D’Amico, Chiara Gamberini, Anna Marocco, Donatella Morrone, James Phillips e Annalisa Rainoldi PRODUZIONE la Biennale di Venezia durata 20’ Campo San Maurizio 20.06, h 17.30 21.06, h 18.30 1HOODGH¿QL]LRQHGLXQDWWHJJLDPHQWRGHO corpo (postura) che serva da base a un lavoro improntato sulla conoscenza reciproca tra un coreografo e un gruppo occasionale di persone disponibili a questo incontro, mi si parano davanti due possibilità: ,Q GH¿QLQJ DQ DWWLWXGH RI WKH ERG\ (posture) to serve as the basis for a work founded on the mutual understanding between a choreographer and a random group of people open to this encounter, I have two choices: 1) Introdurre un linguaggio funzionale a un’idea compositiva. 2) Concentrarmi esclusivamente sull’incontro. 1) To introduce a language that is functional to a choreographic idea. 2) To concentrate exclusively on the encounter. Opto per la numero due. La postura che ha la capacità di tenere vivo nel tempo il momento dell’incontro è quella che determinerà la metrica del lavoro che presenteremo. Per essere più precisi, il lavoro che presenteremo parla della capacità di RULHQWDPHQWR QHO PRQGR HVWHUQR ± D̆ROODWR non c’è dubbio – a scopo non utilitaristico, forse neanche esplorativo (siamo già stati dappertutto, no?). È una postura che in fondo non ha altro scopo che la postura. Uno spazio maggiore tra le vertebre, una prensilità più accentuata delle mani e dei piedi, i talloni e la nuca segretamente connessi da un canale I choose number two. The posture that has the capacity to keep the moment of encounter alive over time is the one that will determine the metrics of the work we present. 7R EH PRUH VSHFL¿F WKH ZRUN ZH ZLOO SUHVHQWLVDERXWWKHDELOLW\WR¿QGRULHQWDWLRQ in the outside world – crowded, to be sure – for reasons that are hardly utilitarian, or even exploratory for that matter (we have already been everywhere, haven’t we?). This is a posture that fundamentally has no purpose other than posture. Greater space EHWZHHQ WKH YHUWHEUDH PRUH VLJQL¿FDQW prehensility of hands and feet, the heels and the neck secretly connected by an energetic 98 9. Festival Internazionale di Danza Contemporanea energetico che si occupa del dietro così come dell’avanti e trasferisce tutta la nostra tattilità QHOOR VSD]LR HVWHUQR ROWUH OD VXSHU¿FLH GHO corpo e fuori dal predominio dell’ottica. All’aperto non funzioniamo come al chiuso; tra casa nostra e il bosco la muscolatura ha tutto il tempo di reinventare il proprio equilibrio generale in previsione dei lupi. E nel deserto, il corpo canta. Consapevolmente si trasforma, nella mancanza del termine di SDUDJRQH FKH OR GH¿QLVFH XQ DOWUR FRUSR  costruisce il ritmo della propria presenza attraverso se stesso, utilizzando le proprie parti come strumento. Il pacchetto-deserto è molto selezionato in agenzia, l’esperienza di conoscenza è assicurata. 0D TXL LQYHFH SHU D̆URQWDUH VH VWHVVL VL LSRWL]]D OD IXRULXVFLWD WRWDOH O¶ḊGDPHQWR selvaggio al corpo di qualcun altro, di tutti. Per mantenere vivo il momento dell’incontro. channel that focuses attention on both the back and the front and transfers our tactility to the outdoor space, beyond the surface of the body and outside of the optical realm. :H DFW GL̆HUHQWO\ RXWGRRUV WKDW ZH GR LQGRRUVEHWZHHQRXUKRXVHDQGWKHIRUHVWWKH muscles have all the time they need to reinvent their overall balance in anticipation of the wolves. And in the desert, the body sings. Consciously it is transformed, and having QREDVLVIRUFRPSDULVRQWRGH¿QHLW DQRWKHU body) it builds the rhythm of its own presence by itself, using its own parts as the means. The desert-package is very popular in travel agencies, the experience of knowledge is a sure thing. But here, to come to terms with the self, we postulate total abandonment and the random assignment to someone else’s body, for everyone. To keep the moment of encounter alive. 9. Festival Internazionale di Danza Contemporanea 99 AGORÀ ANTON LAChKy A demain PRIMA ASSOLUTA / WORLD PREMIERE BELGIO / BELGIUM COREOGRAFIA Anton Lachki CON Giulia Cenni, Francesca Chiodi Latini, Nicola Cisternino, Michela Cotterchio, Cristina D’Alberto, Riccardo De Simone, Silvia Filippi, Laura Ghelli, Luisa Memmola, $OLFH5D̆DHOOL/DXUHOLQH5LFKDUG e Amalia Ruocco PRODUZIONE Campo Pisani 19.06, h 18.00 20.06, h 19.00 21.06, h 17.30 Abbiamo inventato dei personaggi da fumetto durante il periodo di creazione. Personaggi non esistenti ma interamente inventati. Lo spettacolo surrealista A demain è basato sull’energia, sulla celebrazione della danza di questi strani personaggi. Cosa succede fra di loro e quali sono le loro storie? La ricerca del movimento nasce da un systema complesso che chiamo puzzlework. Cerco di scoprire i punti di forza e di debolezza di ciascun danzatore e di valorizzare queste qualità. Lavoreremo con musica classica. la Biennale di Venezia durata 20’ We invented cartoon personalities discovered over the period of creation. Not existing ones but invented ones. The surrealistic performance A demain is based on energy, a celebration of dance by those weird characters. What happens between them and what are their stories? The research of the movement comes from a complex system called puzzlework. I try to discover DQG¿QGWKHVWURQJDQGZHDNSRLQWVRIHDFK dancer and to highlight those qualities. We will be working with classical musical pieces. 9. Festival Internazionale di Danza Contemporanea 101 AGORÀ CONCEPT E COREOGRAFIA CRISTINA RIZZO Cristina Rizzo CON Cristina Rizzo e Annamaria Ajmone, Marta Bellu, Alessandra Bordino, Marina Donatone, Francesca Duranti, Elisa Frasson, Marcella Valentina Mancini, Helena Martos Ramírez, Laura Pante, Roberta Racis ed Elisa Scarselli Bolero Variazioni PRIMA ASSOLUTA / WORLD PREMIERE ITALIA / ITALy ELABORAZIONE SONORA E DJING Simone Bertuzzi aka PALM WINE CURA E DISTRIBUZIONE Campo Novo 20.06, h 19.30 21>22.06, h 12.30 Chiara Trezzani PRODUZIONE la Biennale di Venezia, CAB008 con il sostegno di Regione Toscana e MiBACT IN COLLABORAZIONE CON Terni Festival Internazionale della Creazione Contemporanea 3ULPRVWXGLRGHOSURJHWWR%ROHUR(̆HFW durata 40’ «Il Bolero raveliano ci trascina, senza particolari allusioni, senza nostalgia, a uno stato di esaltazione inibita, in un felice coinvolgimento collettivo». Questo nuovo progetto, è un oggetto FRUHRJUD¿FR FKH VL VYLOXSSD SDUWHQGR dall’assunto esplicito che il Bolero di Ravel è la partitura orchestrale più popolare esistente al mondo, una musica che tutti conoscono e riconoscono. Scritto nel 1928, quando 0DXULFH 5DYHO DYHYD  DQQL H VR̆ULYD GHL primi sintomi del FTD (frontotemporal dementia), l’intero pezzo è costruito su una singola melodia – divisa in due frasi – che si ripete nove volte. 0D FKH FRVD q H̆HWWLYDPHQWH XQ Bolero? È come un’isola deserta, lontana dai continenti. Un campo espressivo esteso, un gesto d’iscrizione nel mondo. Il progetto si estende dunque per Biennale College a un formato più aperto, Bolero Variazioni, in cui la dimensione PXVLFDOH VL DPSOL¿FD FRPH GHWRQDWRUH GL HVSUHVVLRQH/DULFHUFDFRUHRJUD¿FDVLDUWLFROD su sonorità border-crossing di ritmiche da ballo, pensate come una corsa archeologica a partire dal BoleroGL5DYHOHFRVWUXLWHVXÀXVVL 102 9. Festival Internazionale di Danza Contemporanea «Ravel’s Bolero carries us away, with no particular allusions, without nostalgia, into a state of inhibited exaltation, in a joyous collective experience». This new project is a choreographic object that is based on the explicit premise that Ravel’s Bolero is the most popular orchestral work in the world, a piece of music that everyone knows and recognizes. Written in 1928, when Ravel was 53 years old and EHJLQQLQJWRVKRZWKH¿UVWV\PSWRPVRI)7' (frontotemporal dementia), the entire piece is built on a single melody – divided into two phrases – that is repeated nine times. But what is a Bolero, really? It is like a desert island, far away from the continents. $ ZLGH RSHQ ¿HOG RI H[SUHVVLRQ D gesture of registration in the world. The project has therefore been extended for the Biennale College into a more open format, Bolero Variazioni, in which the musical GLPHQVLRQ LV DPSOL¿HG WR EHFRPH WKH detonator of expression. The choreographic experimentation explores the border-crossing sounds of dance rhythms, conceived as an archaeological journey that starts with Ravel’s Bolero DQG LV EXLOW RQ ZDQLQJ ÀX[HV decrescenti e dilatazioni. L’urgenza è quella GL IDU ḊRUDUH XQD WHQVLRQH DVLVWHPDWLFD rispetto alla normalizzazione delle identità e ricercare luoghi di dispersione. Qui, si tratta d’immaginare la scena come un ‘luogo utopico’ in cui è possibile produrre un altro tipo di economia. Un luogo dove praticare l’erotica del corpo. Procedere per rapide dissolvenze, fosforescenze e pulviscoli. and dilations. The urgency is to bring to the surface a tension that is non-systemic with respect to the standardization of identities and to search for places to disperse it. The stage must be imagined as a ‘utopian place’ ZKHUH D GL̆HUHQW VRUW RI HFRQRP\ FDQ EH produced. A place to practice the eroticism of the body. Proceed with rapid fade-outs, phosphorescence and powders. 103 AGORÀ CONCEPT E COREOGRAFIA DAVID ZAMBRANO David zambrano MUSICA DAL VIVO Michel Debrulle CON Valentina Cortese, Jessica D’Angelo, Simone Evangelisti, Mattia Gandini, Paul Gomez, Ehsan Hemat, Luca Jesi, Samuel Johann Kirschner, Stefano Marletta, Alice Martucci, Ângelo Miguel Cid Neto, Anna Romeo, Roberta Ruggiero, Virginia Scudeletti, Tommaso Serratore, Eleonora Soricaro, Giulia Sposito, Demian Troiano, Luca zanni, Silvia zanta e Andrea zardi Passing-Through VENEZUELA - OLANDA / VENEZUELA - NEDERLAND Campo Pisani 26>28.06, h 20.00 29.06, h 11.30 PRODUZIONE la Biennale di Venezia durata 45’ con il sostegno dell’Ambasciata del Regno dei Paesi Bassi a Roma nell’ambito di Olandiamo in Veneto / with the support of the Embassy of the Kingdom of the Netherlands in Rome as part of ‘Olandiamo in Veneto’ &HUFKLDPR LQ TXHVWR ODYRUR GL GH¿QLUH uno spazio condiviso ma invisibile e punteggiato da “sentieri”: il gruppo di danzatori crea XQ SURSULR OLQJXDJJLR GLQDPLFR ÀHVVLELOH e complesso senza necessità di una guida. Molti corpi interagiscono spontaneamente e armoniosamente, come se una sola coscienza li stesse conducendo. Passing Through fa compiere ai danzatori una serie di esercizi che rendono manifesta OD ¿ORVR¿D GL =DPEUDQR VHFRQGR OD TXDOH LO movimento non necessita di una guida per la creazione. I danzatori svilupperanno delle dinamiche che saranno allo stesso tempo ÀHVVLELOLHFRPSOHVVHSHUIRUPDUHXQJUXSSR molto unito, ma che lascia sempre la porta 104 9. Festival Internazionale di Danza Contemporanea :H ZRUN WRZDUG GH¿QLQJ D VKDUHG but invisible space punctuated by “pathways”, the group of dancers creates LWV RZQ G\QDPLF ÀH[LEOH DQG FRPSOH[ language without needing to designate a leader. Bodies interact spontaneously and harmoniously, as if they were being propelled by a single conscience. The Passing Through takes the dancers through various exercises to manifest zambrano’s philosophy that movement needs no leader in creation. The dancers ZLOO FUHDWH G\QDPLFV WKDW ZLOO EH ÀH[LEOH and complex at the same time, getting WKH JURXS WR ¿W WLJKW WRJHWKHU \HW DOZD\V keeping doors open for the unpredictable. aperta all’imprevisto. Il gruppo si muove continuamente, trasformando l’ambiente della danza, cercando di sentire i percorsi sinuosi e invisibili che riempiono la stanza. Questi percorsi diventano visibili appena i danzatori cominciano a muoversi nella stanza. Così Passing Through si crea attraverso una scrittura spontanea. Quando il gruppo si coalizza in una sola mente, non può perdersi, va sempre da qualche parte. Non c’è mai una persona che guida o che segue, ciascuno guida o segue, a seconda della situazione. L’intero gruppo viaggia costantemente praticando LQ¿QLWH SRVVLELOLWj DOO¶LQWHUQR GL XQ DPELHQWH delimitato. The group moves constantly, transforming the environment of the dance. The dancers work to sense the room full of invisible curved pathways. These pathways become visible as soon as the dancers start moving through the room. Thus the Passing Through is created into a spontaneous composition. When the group becomes one mind, it can never get lost, it is always going somewhere. There is never one person leading or following, every one is leading or following, depending on the situation. The whole group is constantly WUDYHOOLQJ SUDFWLFLQJ LQ¿QLWH SRVVLELOLWLHV LQVLGHDGH¿QHGHQYLURQPHQW 105 AGORÀ IRIS EREZ Public Intimacy PRIMA ASSOLUTA / WORLD PREMIERE ISRAELE / ISRAEL COREOGRAFIA Iris Erez CON Francesco Collavino, Marco D’Agostin, Valentina Dal Mas, Amanda Kmett’ Pendry, Francesca Lastella, Camilla Parini, 5DIDá3LHU]\ĔVNL6DEULQD5LJRQL e Barbara Stimoli PRODUZIONE la Biennale di Venezia Campo San Maurizio 26>27.06, h 18.30 28>29.06, h 12.30 durata 20’ FRQLOVRVWHJQRGHOOЧ8̇FLR&XOWXUDOHGHOO¶$PEDVFLDWDG¶,VUDHOH with the support of the Culture Department of the Embassy of Israel In un mondo nel quale tutta la comunicazione passa attraverso gli smartphone e i tablet, dove il mondo esterno, senza limitazione alcuna, invade ogni giorno il nostro spazio domestico, e le sfere pubbliche, dall’autobus a facebook, si mescolano alla vita privata degli altri, si sente il ELVRJQRGLULGH¿QLUHLOUDSSRUWRIUDOHGXHVIHUH &RPHVLFRPXQLFDOЧLQWLPLWj"&RVЧqOЧLQWLPLWj" La tecnologia è un’ossessione o al contrario apre nuove strade verso la consapevolezza e OD UHFLSURFLWj" ,Q XQR VSHWWDFROR DOOЧDSHUWR cercheremo di approfondire alcuni di questi temi attraverso il corpo, il campo e il pubblico. In a world in which smartphones and tablets evade all communication, where the outer world evades daily, with no restrictions, our homey space, and the public spheres, from the bus to facebook, are mixed with the private lives of the others we need to rexamine the relationship between the 2 spheres. How we communicate intimacy? what is intimacy? Are we haunted by technology or does it open new ways of conciousness and reciprocity. In an outdoor performance we will try to touch some of this questions through our body, the square and the audience. 9. Festival Internazionale di Danza Contemporanea 107 AGORÀ ACCADEMIA ITALIANA ShIATSU DO La Via dello Shiatsu: formazione professionale e centro trattamenti TRATTAMENTO ShIATSU / GRATUITO ShIATSU TREATMENT / FREE Gaggiandre dell’Arsenale 21.06, 24.06, 25.06, 26.06 e 28.06 h 19.30>21.30 Le Gaggiandre dell’Arsenale segnano per lo spettatore un momento di sosta per il corpo e lo sguardo: una dilatazione verso l’esterno, combinata di elementi primari quali l’acqua e il prato. L’idea di una sosta per un massaggio VKLDWVX q OHJDWD DOOD ¿ORVR¿D GHO )HVWLYDO FKH ha nella tattilità l’esercizio principale per una nuova sensibilizzazione del corpo. Il massaggio è allora una cesura al continuum degli sguardi partecipi del pubblico. Un esercizio dello sguardo che necessita anche di un momento aereo e di sospensione. Un sostare come metafora dell’ozio. 108 9. Festival Internazionale di Danza Contemporanea For the spectator, the Gaggiandre at WKH$UVHQDOHR̆HUDSDXVHIRUWKHERG\DQG the gaze: an expansion towards the outside, a combination of primary elements such as water and grass. The idea of pausing IRUDVKLDWVXPDVVDJHUHÀHFWVWKH)HVWLYDO¶V philosophy, which considers tactility the primary exercise for a new sensitization of the body. The massage is therefore a break in the continuum of the participative gazes of the spectators. An exercise of the gaze that also requires a moment of air and suspension. A pause as a metaphor for idleness. 9. Festival Internazionale di Danza Contemporanea PRIMA DANzA Due coreografe e interpreti presentano il risultato dell’incontro tra il loro lavoro e la residenza in più spazi di Venezia: le performance completano il rispettivo SHUFRUVRGLFUHD]LRQHHYHUL¿FDFRQWLQXDJLj in corso alle Corderie dell’Arsenale. Two choreographers and performers present the result of the encounter between their work and residency in various spaces in Venice: the performances complete their respective processes of creation and continuous evaluation already in progress at the Corderie dell’Arsenale. 9. Festival Internazionale di Danza Contemporanea 111 PRIMA DANZA MARINA GIOVANNINI COREOGRAFIA Marina Giovannini CON Marta Capaccioli, Veronica Cornacchini, Marina Giovannini e Lucrezia Palandri MUSICA Meditation on beauty 1, 2, 3 ITALIA / ITALy &D¶*LXVWLQLDQ6DORQHGHOÛSLDQR 24.06, h 17.00 e 18.30 Nina Simone PRODUZIONE CAB008 RESIDENZE ARTISTIChE Cango Cantieri Goldonetta Firenze e Spazio K Prato IN COLLABORAZIONE CON Regione Toscana e MiBACT durata 55’ Composto di frammenti complementari GL XQD PHGHVLPD ULÀHVVLRQH Meditation on Beauty è un lavoro che nasce a partire dalla fascinazione per le geometrie, come forma di misurazione dello spazio e base del rigore per ardui esercizi di equilibrio, movimenti tesi e SRVH FKH LPSRQJRQR OD ¿GXFLD DVVROXWD QHO corpo, nella stabilità dell’altro. Il femminile, tratteggiato dai gesti e dalla JUD]LDqLOIXOFURGHOO¶LQWHURODYRUROH¿JXUHGL riferimento sono donne e in particolare lo sono OHGL̆HUHQWLDUWLGL1LQD6LPRQHH0D\D'HUHQ Spazio e tempo sono assi cartesiani della danza, scanditi dal corpo, considerati in una visione femminile di costante e rotondo mutamento, di fragilità e fermezza, di posizioni prese e lasciate scorrere. Meditation on Beauty è una metafora del mondo alla ricerca continua di un equilibrio precario eppure solido, di un mutamento necessario e scandito dalla costante messa in discussione della propria posizione, che diventa così il luogo dell’indagine e di una meditazione, appunto, sull’esistenza e sull’identità di donna, di danzatrice, di persona, sull’idea stessa del femminile, fragile e potente, sulla relazione con ciò che è bello, sulla necessità della grazia, sulla ricerca dell’equilibrio. Composed of the complementary IUDJPHQWVRIRQHVLQJOHUHÀHFWLRQMeditation on Beauty stems from a fascination for geometry, as a form of measuring space DQG D ULJRURXV EDVLV IRU GL̇FXOW H[HUFLVHV in balance, tense movements and poses that UHTXLUH WRWDO FRQ¿GHQFH LQ WKH ERG\ LQ WKH stability of the other. Femininity, traced in gestures and grace, is the fulcrum of the entire ZRUN WKH UHIHUHQWLDO ¿JXUHV DUH ZRPHQ DQG SDUWLFXODUO\ IHPLQLQH DUH WKH GL̆HUHQW arts of Nina Simone and Maya Deren. Space and time are the Cartesian axes of dance, the body marking the rhythm, considered from a feminine viewpoint of constant all-round change, fragility and strength, of positions taken or allowed to slip past. Meditation on Beauty is a metaphor of the world continuously seeking a precarious yet stable balance, a necessary mutation accompanied by constant questioning of one’s own position, which thus becomes the place of investigation and indeed meditation on the existence and identity of woman, of a ballerina, a person, the very idea of the feminine, fragile and powerful, on the relation with what is beautiful, on the need for gracefulness, on the search for equilibrium. 9. Festival Internazionale di Danza Contemporanea 113 PRIMA DANZA DI E CON LUISA CORTESI Luisa Cortesi PRODUZIONE CAB008 L’appuntamento IN COLLABORAZIONE CON Regione Toscana e MiBACT ITALIA / ITALy durata 15’ Ca’ Giustinian/Laboratorio delle Arti 21>22.06, h 15.00 25.06, h 16.00 26>28.06, h 15.00 Il tempo che intercorre tra la richiesta d’appuntamento e il suo compiersi è ciò FKH GL̆HUHQ]LD XQ TXDOVLDVL DSSXQWDPHQWR da un altro. Allo stesso tempo l’origine dell’appuntamento e il suo compiersi trova unità e verosimiglianza in qualsiasi tipo di appuntamento. Sostanzialmente ciò che GL̆HUHQ]LD H DFFRPXQD RJQL DSSXQWDPHQWR è il tempo in stallo, l’attesa. All’interno della massima variabilità di questo tempo, l’appuntamento è motivo d’indicizzazione ed è meta e obiettivo. Si può anche dire che ogni passaggio in questo tempo di attesa non è altro che una accumulazione di appuntamenti. Ogni persona quotidianamente ha una ¿WWDOLVWDGLDSSXQWDPHQWLQHOODSURSULDDJHQGD anche se quella persona non ha mai posseduto una agenda e non ha mai dato o gli è stato chiesto un appuntamento. L’appuntamento è il luogo della visione e di costruzione di drammaturgie. L’appuntamento sono io. La velocità di un gatto rispetto a quella di una tartaruga non è confermata dal fatto che il gatto abbia molti più appuntamenti di una tartaruga. Quando il gatto arriva all’albero, l’albero è l’appuntamento o l’albero stesso ha avuto e avrà molti appuntamenti? 114 9. Festival Internazionale di Danza Contemporanea The time that elapses between when an appointment is made and when it actually takes place is what distinguishes one appointment from another. At the same time the origin of the appointment and its WDNLQJ SODFH ¿QG XQLW\ DQG SODXVLELOLW\ LQ any type of appointment. Substantially what distinguishes and connects every appointment is the delay, the waiting period. Within the maximum range of variability of this delay, the appointment may be indexed, and is both an endpoint and a goal. One might also say that each moment during this waiting period is nothing but an accumulation of appointments. Every day, every person has a crowded schedule of appointments in his datebook even if that person has never owned a datebook and has never made or been asked for an appointment. The appointment is the place of vision and the construction of dramaturgies. The appointment is me. The speed of a cat compared to that of a turtle is not substantiated by the fact that the cat has many more appointments than the turtle. When the cat gets to the tree, is the tree the appointment or has the tree itself had many appointments past and future? Se fossi il gatto, per arrivare all’albero e se l’albero fosse il mio appuntamento, e dal momento che ho distanziato abbondantemente la tartaruga, in venti minuti avrei dato forma a tutta una sorta di azioni e immagini che avrebbero composto l’intera scena, appuntamento compreso. Se fossi l’albero e mettiamo che il gatto sia arrivato da me a novembre, quindi in autunno, avrei ancora quantità di foglie da scaricare a terra. Dovrei ospitare sopra di me per tutto l’inverno i soliti ospiti per aspettare la primavera e rivedermi appunto nascere le foglie addosso mentre quelle a terra durante quei mesi erano già tutte marcite. Se fossi la tartaruga me ne fregherei del JDWWR FKH KD VSUHFDWR ¿Q WURSSD IDWLFD PH ne fregherei dell’albero e di tutti i suoi mesi invernali che io intanto me li dormo in letargo. Ma soprattutto essendo riservata non starei certo a raccontare a voi quanto ci ho messo ad arrivare all’appuntamento ma soprattutto se all’appuntamento ci sono andata o no. ,R QRQ VRQR Qp LO JDWWR Qp O¶DOEHUR Qp OD tartaruga, io sono l’appuntamento. If I were the cat, to get to the tree and if the tree were my appointment, and since I was so far ahead of the turtle anyway, I would have taken the twenty minutes to give form to all sorts of actions and images that would have composed the entire scene, including the appointment. If I were the tree and let’s say the cat had come to me in November, hence in autumn, I would still have lots of leaves to drop to the ground. All winter long I would have had to accommodate the same old guests on me as they waited for springtime to arrive, then new leaves would grow on me while those that lay on the ground all those months would already have rotted away. If I were the turtle, I wouldn’t care about WKHFDWZKRZDVWHGWRRPXFKH̆RUWDQ\ZD\ I wouldn’t care about the tree and all its winter months because I go into hibernation anyway. But most of all, because I am quite reserved, I wouldn’t waste any of my time telling you how long it took me to get to the appointment and especially if I went to the appointment at all. I am neither the cat nor the tree nor the turtle, I am the appointment. 9. Festival Internazionale di Danza Contemporanea 115 9. Festival Internazionale di Danza Contemporanea BOSCHETTO 116 9. Festival Internazionale di Danza Contemporanea 9. Festival Internazionale di Danza Contemporanea 117 BOSChETTO RAMONA CAIA E SARA SGUOTTI ITALIA / ITALy Campo Sant’Angelo 19>28.06, h 18.00>22.00 durata 240’ Lo spazio è una sorta di libera incursione QHOOD WRSRJUD¿D GHOOD FLWWj LO ERVFKHWWR SHU tutto il periodo del Festival sarà abitato da due danzatrici che lavorano sul concetto di YDULD]LRQH H LPSURYYLVD]LRQH QHOOD ¿JXUD ¿DEHVFD8QHYHQWRTXRWLGLDQRGLTXDWWURRUH a cui il pubblico potrà continuamente tornare nel suo vagare, sostare e frequentare i vari percorsi proposti. 118 9. Festival Internazionale di Danza Contemporanea This space is a sort of free-for-all incursion into the city’s topography: the forest will be inhabited for the duration of the Festival by two dancers working on the concept of variation and improvisation in WKHIDLU\WDOH¿JXUH$GDLO\IRXUKRXUHYHQW to which the audience may return again and again as it wanders, stops and enjoys the various experiences being presented. 9. Festival Internazionale di Danza Contemporanea 119 MOSTRA ExhIBITION L’idea del corpo The Idea of the Body Merce Cunningham, Steve Paxton, Julian Beck, Meredith Monk e Simone Forti GDOOЧ$UFKLYLRGHOOD%LHQQDOH Merce Cunningham, Steve Paxton, Julian Beck, Meredith Monk and Simone Forti From the Archives of La Biennale 1960 – 1976 a cura di by Virgilio Sieni con with Archivio Storico delle Arti Contemporanee ricerche di research by Lia Durante Ca’ Giustinian dal 3.06, h 09.00>21.00 ingresso gratuito free entrance /H GL̆HUHQWL HVSHULHQ]H GHO FRUSR documentate nella mostra sono metafore di altrettante aperture della città al corpo. Il materiale visivo ritrovato nell’Archivio della Biennale documenta esperienze fondamentali avvenute fuori dai teatri, e che portano l’attenzione di performer e spettatori VXOO¶XUEDQLVWLFD H VXOOD JHRJUD¿D GHL OXRJKL della città. Questi artisti non solo hanno scelto uno spazio alternativo a quelli abituali, ma soprattutto hanno fatto della natura del luogo l’asse portante della loro drammaturgia. A partire soprattutto dal memorabile Event in piazza San Marco che la compagnia di Merce Cunningham realizzò il 14 settembre 1972, ospite nei programmi di Biennale Musica, fra lo stupore degli astanti e la quasi generale incomprensione della critica. I materiali esposti documentano artisti la cui ricerca negli anni si è svolta a 360 gradi, chiedendo al pubblico un’attenzione e una lettura della SURSULD DUWH LQHGLWD ¿QR DG DOORUD Merce Cunningham introduce a una apertura del codice in cui la struttura, ossia la cornice, diventa come una esplosione di tanti elementi minimi, come fossero molecole libere: una FRVWUX]LRQH FRUHRJUD¿FD FKH VL EDVD VXOOD 7KH GL̆HUHQW H[SHULHQFHV RI WKH ERG\ documented in this exhibition are metaphors IRU WKH GL̆HUHQW ZD\V WKDW WKH FLW\ RSHQV to the body. The visual material found in the Archives of La Biennale documents fundamental experiences which took place outside of theatres, and which drew the attention of performers and spectators to the urban design and the geography of places in the city. These artists not only chose spaces that were alternative to traditional venues, but most of all they made the nature of place the keystone of their dramaturgy. Starting, above all, with the memorable Event held in Piazza San Marco by Merce Cunningham’s company on September 14th 1972, a guest in the programme of the Music Biennale, which astounded the viewers and generally ED̈HGWKHFULWLFV7KHPDWHULDOVRQGLVSOD\ document artists who experimented across the spectrum, demanding from their audience an attention and reading of their art that had never been seen before. Merce Cunningham sought to break open the code by turning the structure, i.e. the frame, into an explosion of minimal elements, like loose molecules: a choreographic 9. Festival Internazionale di Danza Contemporanea 121 liberazione dalla struttura pur rimanendo dentro la struttura. Steve Paxton propone invece un lavoro rivolto all’interno del cosmo dell’uomo per riuscire a far ‘cadere’ una ¿JXUD LQ XQ FRQWLQXR VPDUJLQDPHQWR GHL sensi e del sentire. Simone Forti, nel video presente in mostra, incarna l’idea di una nomade che persegue un’idea di corpo anche QHOOD VXD LPPHGLDWD ¿VLFLWj H GXQTXH O¶LGHD che il pensiero possa apparire attraverso la carne. Così la forza politica e profetica dei corpi di Julian Beck e del Living Theatre, o la vocalità rituale di Meredith Monk, riportano alla nostra attenzione un nuovo concetto di spettacolo che in quegli anni ha approfondito l’idea di happening e di performance ¿QR D XQD GXUD PDWXULWj GHO corpo che si è trasformata in un modo di vita. 122 9. Festival Internazionale di Danza Contemporanea construction based on the liberation of the structure while remaining within the structure. Steven Paxton on the other hand worked within the cosmos of man to WU\ DQG PDNH D ¿JXUH µIDOO¶ FRQWLQXRXVO\ forcing the boundaries of the senses and of feeling. In the video presented in the exhibition, Simone Forti incarnates the idea of a nomad who pursues the idea of body with its immediate physicality, and the idea that thought can even materialize WKURXJK WKH ÀHVK 7KH SROLWLFDO DQG prophetic power of the bodies of Julian Beck and the Living Theatre, like the ritual vocals of Meredith Monk, draw our attention back to a new concept of spectacle, which in those years explored the idea of happenings and performance art, to achieve a hard maturity of the body which was transformed into a way of life. 9. Festival Internazionale di Danza Contemporanea 123 DANzA & ARCHITETTURA In dialogo con la 14. Mostra Internazionale di Architettura Corderie dell’Arsenale 7>29.06.2014 orari di apertura della mostra exhibition opening hours 124 9. Festival Internazionale di Danza Contemporanea 9. Festival Internazionale di Danza Contemporanea 125 Quando il gesto abita When the gesture inhabits Stefania Di Paolo La polisFRVuFRPHOЧagorà non sono spazi vuoti, ma luoghi che esistono in funzione di una relazione che essi instaurano con i corpi FKH OH DELWDQR (VLVWRQR SRLFKp DELWDWH FRVu FRPHOЧXRPRFRPHGLFHYD/HURL*RXUKDQ©q uomo solamente se lo è fra gli altri, rivestito GDLVLPEROLGHOODVXDUDJLRQGЧHVVHUHª /ЧXRPRFRPXQHHOЧXRPRGЧLQJHJQRQRQ sono più tali fuori da uno spazio e da un tempo nel quale si riconoscono. Allo stesso modo, una pratica come la danza che non compete al quotidiano, ha a che fare con la natura simbolica della società, con la sua capacità GL LQWHVVHUH VSHFL¿FKH UHOD]LRQL WUD OH FRVH di evocare credenze e di addomesticare lo spazio e il tempo secondo modi a essa propri. Non esiste il movimento anarchico del corpo “biologico”, che sia cioè esente da una forma di educazione, proprio come non esiste uno spazio che non sia umanizzato. 1HOOD VWRULD GHOOЧXPDQLWj OH SULPH IRUPH GL abitazione e i primi segni incisi compaiono in contemporanea alle prime forme di rappresentazioni ritmiche: luogo, tempo e movimento sono sempre andati assieme nella costituzione di quella realtà complessa che oggi chiamiamo uomo. 126 Danza & Architettura The polis, and the agorà, are not empty spaces, but places that exist as a function of the relationship that they establish with the bodies that inhabit them. They exist because they are inhabited, just as man, wrote Leroi-Gourhan, «is a man only if he is such among others, clad in the symbols of his reason for being». Common man and ingenious man cease to exist as such outside a space and a time in which they recognize themselves. In the same way, a practice such as dance which is not part of everyday life, involves the symbolic nature RIVRFLHW\ZLWKLWVFDSDFLW\WRHVWDEOLVKVSHFL¿F relations between things, to evoke beliefs and to tame space and time in its own way. There is no such thing as anarchic movement of the “biological” body, a movement that is devoid of any form of training, just as there is no space that has not been humanized. ,Q WKH KLVWRU\ RI KXPDQLW\ WKH ¿UVW IRUPV RI KDELWDWLRQDQGWKH¿UVWFDUYHGVLJQVFRLQFLGH KLVWRULFDOO\ ZLWK WKH ¿UVW IRUPV RI UK\WKPLF representation: place, time and movement have always been inseparable in constituting the complex reality that we now call man. Just as the movement of the stars led the earliest civilizations to invent measuring Così come il movimento degli astri ha condotto le prime civiltà a inventare strumenti di misurazione che riducessero LO FLHOR D XQD PDSSD OЧRULJLQH GHO PRQGR abitato, così come oggi lo conosciamo, è da rintracciarsi nelle pratiche che lo hanno generato. Succede così che le polis siano la forma più evoluta della necessità umana di crearsi uno spazio protetto e che l’antica agorà nasca nel momento in cui sempre più cittadini decidono di riunirsi periodicamente e discutere. In entrambi i casi si tratta del risultato visibile di una medesima decisione: il restare. I modi del restare non sono però sempre gli stessi. Un corpo statico conosce il mondo osservandolo da un punto preciso, immaginando un orizzonte cui contrapporre XQЧHVWHQVLRQH PLVXUDELOH D YLVWD GЧRFFKLR /D FLWWj q SHU DQWRQRPDVLD TXHO SXQWR ¿VVR attorno al quale costruire cardi e decumani e sul quale organizzare il quotidiano. Il corpo in movimento, al contrario, impara lo spazio nei suoi spostamenti, costruendo sentieri e SHUGHQGRYLVLDOOЧLQWHUQRYDJOLDQGROHTXDOLWj materiali degli oggetti che lo abitano. Virgilio Sieni sembra essersi chiesto se tools that reduced the heavens to a map, the origin of the inhabited world, as we know it today, may be found in the practices that generated it. Thus the polis has become the most highly evolved form of man’s need to create a protected space, and the ancient agorà emerged at the time when a growing number of citizens chose to meet periodically to discuss matters. In both cases, these were the visible results of the same decision: to stay. But the ways one stays are not always the same. A static body comes to understand WKH ZRUOG E\ REVHUYLQJ LW IURP D VSHFL¿F point, imagining a horizon to which it can oppose a measurable extension as far as the eye can see. The city is quintessentially WKH¿[HGSRLQWDURXQGZKLFKWKHFDUGRDQG decumanus can be built and on which to organize everyday life. The body in motion, on the contrary, studies space as its travels, building paths and getting lost therein, evaluating the material qualities of the objects that dwell within it. Virgilio Sieni seems to have wondered whether within the measured space of the city, dance might be considered as a form of dwelling that can generate a new idea Danza & Architettura 127 DOOЧLQWHUQR GHOOR VSD]LR PLVXUDWR GHOOD FLWWj sia possibile considerare la danza come una forma di abitazione che generi una nuova idea di polis 1HOOH &RUGHULH GHOOЧ$UVHQDOH egli risponde a questo interrogativo dando XQ OXRJR DO JHVWR XQR VSD]LR ¿VLFR FKH VLD metafora di un incontro e che conceda le proprie stanze a un dialogo, quello con i corpi degli interpreti, inevitabilmente declinato al tempo presente. Tra gli oggetti degli spazi espositivi della Biennale Architettura, la danza manifesta chiaramente la sua natura mobile, che la rende inadatta ad abitare esclusivamente un palcoscenico e la induce a mescolarsi nei percorsi pedonali dei visitatori, creando improvvise attese, gesti e risonanze tra corpi FKH RVVHUYDQR H FRUSL FKH DJLVFRQR 8QЧLGHD di prossimità tra esperienze diverse che parla di un ritorno all’altro, dove il movimento R̆UH OD SRVVLELOLWj GL SHUGHUH TXDOFRVD H LQ questa mescolanza, impedisce una visione GЧLQVLHPH /ЧLQWHQ]LRQH GL 6LHQL q XQ JHVWR GL̆XVR nello spazio e nel tempo, che richiede una perlustrazione e induce a una raccolta di LQ¿QLWL GHWWDJOL GHWWDJOL GL FRUSL ULWPL 128 Danza & Architettura of polis. In the Corderie dell’Arsenale he answers this question by giving gesture a venue: a physical space that is the metaphor for an encounter and which concedes its rooms to a dialogue with the bodies of the performers, a dialogue inevitably articulated in the present tense. Amidst the objects in the exhibition spaces of the Architecture Biennale, dance clearly manifests its nature as movement, PDNLQJ LW XQ¿W WR EH UHVWULFWHG H[FOXVLYHO\ to the stage, and inducing it to blend into the pedestrian routes of the visitors, creating unexpected pauses, gestures and resonances between the bodies that observe and the bodies in action. An idea RI SUR[LPLW\ EHWZHHQ GL̆HUHQW H[SHULHQFHV that is about returning towards the other, ZKHUH PRYHPHQW R̆HUV WKH SRVVLELOLW\ RI discarding something, and in mixing things this way, prevents a comprehensive vision. Sieni seeks a gesture spread out over space and time, which requires a process of exploration leading to the acquisition of an LQ¿QLWHQXPEHURIGHWDLOVGHWDLOVRIERGLHV rhythms of objects, improvised dances, random openings to dance. This is true for di oggetti, ballate improvvisate, aperture casuali alla danza. Questo vale tanto per OЧRVVHUYDWRUH TXDQWR SHU JOL DUWLVWL LQYLWDWL a coabitare lo spazio: lo stare nel luogo e OЧDSULUH LO ODYRUR GL FUHD]LRQH DOOD FRQWLQXD RVVHUYD]LRQHGHOSXEEOLFRPRGL¿FDLOSURSULR sentire e genera una pratica che si fonda principalmente su questa nuova relazione. Far incontrare in uno stesso luogo FRUHRJUD¿ GDQ]DWRUL QRQ SURIHVVLRQLVWL H visitatori vuol dire dar vita a un cenacolo di esperienze e pratiche LQ¿HUL, che trovano una UDJLRQ GЧHVVHUH QHOOD ORUR QDWXUD GLDORJLFD e mai conclusa, sempre aperta. Questa decisione induce a pensare che lo spazio delle Corderie sia un esperimento attraverso LO TXDOH ULÀHWWHUH VXL OXRJKL SURSUL GHOOD danza e sulla necessità di stabilire un diverso rapporto con lo spazio della comunità. Quello immaginato è l’uomo alla ricerca di nuovi riti di avvicinamento a se stesso, in cui la danza coincida con quel movimento di scoperta del mondo che non si accontenta della distanza, FKHUL¿XWDOD¿VVLWjGLXQVRORSXQWRGLYLVWD e desidera frammentare le abitudini del TXRWLGLDQR q OЧXRPR YHFFKLR FKH WHQWD GL disegnare un uomo – e un mondo – nuovo. both the observer and the artists invited to inhabit the space with them: being in the place and opening the process of creation to the continual observation of the public PRGL¿HV RQH¶V SHUFHSWLRQ DQG JHQHUDWHV D practice that is founded primarily on this new relationship. To bring together in one place choreographers, dancers, non-professionals and visitors means to create a congregation of experiences and practices LQ ¿HUL, which ¿QGWKHLUHVVHQFHLQWKHLUQDWXUHDVDQHYHU ending and always open dialogue. This decision leads one to think that the space of the Corderie is an experiment to spark D UHÀHFWLRQ RQ WKH VSDFHV WKDW EH¿W GDQFH DQG RQ WKH QHHG WR HVWDEOLVK D GL̆HUHQW kind of relationship with the space of the community. The one that we imagine is man in search of new rituals to achieve closer contact with his self, in which dance coincides with a movement to discover the world that LV QRW VDWLV¿HG ZLWK GLVWDQFH WKDW UHIXVHV WKHLQÀH[LELOLW\RIDVLQJOHSRLQWRIYLHZDQG desires to fragment the habits of everyday life: it is old man trying to design a new man, and a new world. Danza & Architettura 129 KINKALERI Found Dances & Everyone Gets Lighter/All! PROGETTO Kinkaleri / Massimo Conti, Marco Mazzoni e Gina Monaco IN COLLABORAZIONE CON MiBACT – settore spettacolo, Regione Toscana ITALIA / ITALy Corderie dell’Arsenale pratiche 19>29.06 performance 19>29.06, h 15.00 Kinkaleri negli ultimi anni ha sviluppato un progetto sul linguaggio dal titolo All! strutturando SHUFRUVL ¿VLFL YHUEDOL YLVLYL VRQRUL PLUDWL allo sviluppo di un pensiero nella totale libertà espressiva. Punto di riferimento culturale di questa ULFHUFD q VWDWD OD ¿JXUD GL :LOOLDP 6 %XUURXJKV che del linguaggio ha sempre fatto un luogo di frontiera, atto politico e creativo; non si tratta di un progetto su W.S.B. ma con W.S.B. e con tutti gli artisti che in quegli anni hanno indagato la parola QHOOD SRVVLELOLWj GL HVVHUH DOWUR /ЧLQYHQ]LRQH GL un codice che permette di trascrivere il simbolo alfabetico direttamente sul proprio corpo, in continua dinamica nello spazio e nel tempo, è stato un vero e proprio atto fondante del progetto; XQD SUDWLFD FRUHRJUD¿FD GRYH XQD JULJOLD ULJLGD di traduzione tra alfabeto e gesto spalanca un luogo di libertà individuale e sviluppa tutte le funzioni di un corpo compreso in un movimento. Una pura invenzione per far assumere a qualsiasi performer la scrittura come dato compositivo da interpretare qui e ora, adottando un codice DUELWUDULR FKH QHOOD VXD DSSOLFD]LRQH FDOOLJUD¿FD ha la possibilità di divenire altro, travalicando la SDUROD VWHVVD H ULGH¿QHQGR O¶LGHD GL FRUHRJUD¿D Il progetto concepito per la Biennale Danza 2014 parte da una serie di pratiche che si fanno danza HQHOORURGLVSLHJDUVLPRVWUDQRUHVWLHULÀHVVLRQL La performance Everyone Gets Lighter | All! è O¶HOHPHQWR FDUGLQH GL GL̆XVLRQH H WUDVIHULPHQWR del codice presentato regolarmente per tutto il periodo della manifestazione parallelamente a un abitare continuo, dove il performer mette in atto TXHLUDSSRUWL¿VLFLHWHRULFLFKHGHOYLUXVFRGLFHQH indagano costantemente la forma in tutte le sue potenzialità. Il pubblico si troverà casualmente o in maniera premeditata a contemplare un corpo che nella sua presenza si fa danza, performance, voce, parola, scrittura, ritmo. Dance is a virus! In recent years Kinkaleri has been developing a project about language entitled All!, giving structure to physical, verbal, visual and sound processes the aim of which is to develop thought with total freedom of expression. The cultural point of reference for this H[SHULPHQWDWLRQLVWKH¿JXUHRI:LOOLDP6%XUURXJKV who always considered language a frontier, a SROLWLFDODQGFUHDWLYHDFWWKLVLVQRWDSURMHFWDERXW W.S.B. but with W.S.B. and with all the other artists of those years who explored the potential of the word to be something else. The invention of a code that makes it possible to transcribe an alphabetical symbol directly onto the body, in a continual dynamic exchange between space and time, was WKHWUXHIRXQGLQJDFWRIWKHSURMHFWDFKRUHRJUDSKLF practice in which a rigid grid for translating the alphabet into gesture opens a space of individual freedom and develops all the functions of a body engaged in motion. Pure invention conceived so that a performer can acquire writing as an element of composition to perform here and now, adopting an arbitrary code that when applied as calligraphy can become something else, reaching beyond the word LWVHOI WR UHGH¿QH WKH LGHD RI FKRUHRJUDSK\« 7KH project conceived for the 2014 Dance Biennale starts with a series of practices that become dance and as they unfold, display remains and considerations. The performance Everyone Gets Lighter | All! is WKH NH\ HOHPHQW IRU WKH GL̆XVLRQ DQG WUDQVIHUUDO of a code presented periodically for the entire duration of the event in parallel with a continuous inhabitation, during which the performer engages in all the physical and theoretical relationships that constantly investigate the full potential of the virus/ FRGH¶VIRUP7KHDXGLHQFHZLOO¿QGLWVHOIUDQGRPO\RU deliberately contemplating a body whose presence becomes dance, performance, voice, word, writing, rhythm. Dance is a virus! Danza & Architettura 133 MIChELE DI STEFANO_MK Sahara Para Todos ITALIA / ITALy Corderie dell’Arsenale pratiche 7>20.06 performance 19.06, h 12.00 COREOGRAFIA Michele Di Stefano CON Alberto Baraghini, Mauro Bernardi, Marta Biddau, Stefania Carvisiglia, Eugenia Coscarella, Elisa D’Amico, Chiara Gamberini, Anna Marocco, Donatella Morrone, James Phillips e Annalisa Rainoldi PRODUZIONE la Biennale di Venezia 134 Danza & Architettura CRISTINA RIZZO Bolero Variazioni ITALIA / ITALy Corderie dell’Arsenale pratiche 9>18.06 CONCEPT E COREOGRAFIA Cristina Rizzo CON Annamaria Ajmone, Alessia Bizzotto, Francesca Costa, Linda De Pellegrin, Giulio Forlani, Giorgia Lazzari, Giorgia Luisetto e Alice Pubulin MUSICA %ROpUR di M. Ravel nell’esecuzione della Berliner Philharmoniker diretta da Pierre Boulez ASSISTENTE Carlotta Plebs CURA E DISTRIBUZIONE Chiara Trezzani PRODUZIONE la Biennale di Venezia, CAB008 con il sostegno di Regione Toscana e MiBACT IN COLLABORAZIONE CON Terni Festival Internazionale della Creazione Contemporanea Danza & Architettura 137 ROy ASSAF Dance Grammar ISRAELE / ISRAEL Corderie dell’Arsenale pratiche 15>26.06 performance 27>29.06, h 16.00 COREOGRAFIA Roy Assaf CON Geneviève Boulet, Francesca Caselli, Daria Greco, Laura Montanari, Silvia Pezzarossi, Dana Terracina ed Elisa zelani PRODUZIONE la Biennale di Venezia FRQLOVRVWHJQRGHOO¶8̇FLR&XOWXUDOHGHOO¶$PEDVFLDWDG¶,VUDHOH with the support of the Culture Department of the Embassy of Israel 138 Danza & Architettura VIRGILIO SIENI COREOGRAFIA 1) RESURREzIONE RESURRECTION Virgilio Sieni CON MUSIChE ESEGUITE DAL VIVO ASSISTENTI Elisa Barison, Sergio Bastianetto, Lorenzo Botter, Veronica Botter, Lisa Ferrazzi, Lorenzo Galiazzo, Veronica Palmarin, Giulia Angelo Raniero, Emma Troni, Valentina zane e Beatrice zennaro Francesco Grigoletto, Carla Marazzato, Laura Moro, Giulia Mureddu e Marta zollet  3,(7È0DGULH¿JOLPIETÁ Mothers and children CURA COSTUMI CON Giulia Bonaldi Diarra Faye, Concepcion Garcia Sanchez, Maria Lanaro, Sara Lonardi, Diego Alvise Mariuzzo, Elaziz – Simone Ponticelli, Emanuela Rovedo, Lorenzo Boldrin, Angela Santin e Giulio zago dalla corale G. Savani e dagli autori Naomi Berrill e Daniele Roccato Appunti per il Vangelo secondo Matteo ITALIA / ITALy Corderie dell’Arsenale 7>29.06, orari di apertura della mostra PRODUZIONE la Biennale di Venezia 3) PIETÁ coppie PIETÁ couples CON Giovanna Bottacin, Vinicio Chamorro, Elisa Fioravanti, Valter Paties, Maria Cristina Vianello e Lorenzo Vittori 4) INGRESSO A GERUSALEMME ENTERING JERUSALEM CON $SDUWLUHGDXQЧLGHDGLwork in progress e da un sistema di pratiche che precedono la creazione, nascono queste fasi di realizzazione di 9 quadri come Appunti per il Vangelo secondo Matteo. Una anticipazione del più vasto lavoro che prenderà corpo GH¿QLWLYR LQ OXJOLR XQ SURJHWWR VSHFLDOH di Virgilio Sieni che coinvolgerà duecento interpreti di ogni età e professione. Questi Appunti prenderanno vita durante la 14. Mostra Internazionale di Architettura e si svolgeranno anche con la frequentazione dei visitatori. An idea for a work in progress and a system of practices that precede creation bring to light these phases in the realization of 9 tableaux as Appunti per il Vangelo secondo Matteo, Notes on the Gospel according to Matthew. A preview of the more ample ZRUN WKDW ZLOO WDNH GH¿QLWLYH VKDSH LQ -XO\ a special project by Virgilio Sieni that will involve two hundred performers of every age and profession. These Appunti will be developed during the 14th International Architecture Exhibition and will also include forms of engagement with the visitors. Rita Borga, Simonetta Borrelli, Bianca Carlesso, Vitalba D’Aguanno, Carmela Poma, Sandra Rallo, Anna Romeo, Rosanna Tasso e Michela Turetta 5) BATTESIMO BAPTISM CON Rossella Agnolin, Danilo Alessi, Attilia Pittarella e Cristina zanetti 6) GETSEMANI GEThSEMANE CON Giuseppe Francechi, Aurelio Latella, Bruna Marazzato, Ada Strada, Silvia Tognazzo e Mara Vian 7) MAGI ThE KINGS CON Annabella Doni, Leda Quintavalle, Amalia Rossi e Paola Maria Tonello 8) INSEGNAMENTO E PREDICAzIONI TEAChINGS AND PREAChINGS CON Sarah Bignaschi, Mariangela Cassano, Arianna Elvironi, Elisa Moscato, Graziella zuccorato E CON Patrizia Becchetti, Chiara Castaldini, Bianca Lisa De Chirico, Ramona Caia, Giulia Mureddu ed Elisa zelani 9) CROCIFISSIONE CRUCIFIxION 140 Danza & Architettura 141 GIUSEPPE COMUNIELLO Danze leggermente diverse ITALIA / ITALy Corderie dell’Arsenale 7>29.06, orari di apertura della mostra COREOGRAFIA Giuseppe Comuniello e Virgilio Sieni CON Giuseppe Comuniello ASSISTENTE Gaia Germanà PRODUZIONE la Biennale di Venezia Queste danze di un interprete non vedente non avranno orari prestabiliti ma accadranno in maniera indeterminata nei luoghi. Ogni danza presenterà un personaggio immaginario WUDWWR GD ¿DEH UDFFRQWL H SLWWXUH H VDUj XQ dialogo sottovoce col corpo, con la luce e con lo spazio. These dances by a blind performer will QRW EH VFKHGXOHG DW VSHFL¿F WLPHV EXW ZLOO take place sporadically in the spaces. Each dance will present an imaginary character inspired by fairytales, stories and paintings, and will be a whispered dialogue with the body, with the light and the space. Danza & Architettura 143 In dialogo con la 14. Mostra Internazionale di Architettura DANzE PER CAPIRE a cura di by Virgilio Sieni, Gaia Germanà e Giuseppe Comuniello Danze per capire è un percorso di trasmissione tra non vedenti e danzatori che porterà quotidianamente all’elaborazione di EUHYLEUDQLFRUHRJUD¿FLLQIRUPDGLGXHWWR trio e quartetto, ricercando/ricreando lo spazio della rappresentazione tra i visitatori della mostra. Danze per capire is a process of transmission between blind people and dancers that will lead to a daily elaboration of short choreographic pieces in the form of duets, trios and quartets, seeking/recreating the space of the performance among the visitors to the exhibition. Corderie dell’Arsenale pratiche 10>29.06 144 Danza & Architettura Danza & Architettura 145 In dialogo con la 14. Mostra Internazionale di Architettura VITA NOVA 6HLFRUHRJUD¿FRQGXFRQRFRQJLRYDQLVVLPL danzatori tra i 10 e 15 anni un percorso di SURYHHGLYHUL¿FKHDSHUWHDOODYLVLRQHGHO pubblico. Six choreographers lead young dancers between the ages of 10 and 15 through a process of rehearsals and evaluations open to public viewing. 146 Danza & Architettura Danza & Architettura 147 VITA NOVA ADRIANA BORRIELLO Tacita Muta ITALIA / ITALy Corderie dell’Arsenale pratiche 20.06, h 10.00>13.00 COREOGRAFIA Adriana Borriello CON Gaia Benassi, Andrea Bretti, Elisabetta Bordoni e Susanna Pinalto MUSICISTA Letizia Renzini ASSISTENTE Valeria Diana PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON Fondazione Romaeuropa, attività di promozione danza 148 Danza & Architettura VITA NOVA hELEN CERINA Post grammatica ITALIA / ITALy Corderie dell’Arsenale pratiche 21.06, h 10.00>13.00 COREOGRAFIA Helen Cerina CON Serena Boccaccini, Daria Del Moro, Alexia Giaconi, Elisa Grandicelli, Elisabetta Poeta e Iacopo Maria Troiano MUSICA Luca Losacco PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON AMAT & Civitanova Danza per Civitanova Casa della Danza Danza & Architettura 151 VITA NOVA VIRGILIO SIENI La stanza del fauno ITALIA / ITALy Corderie dell’Arsenale pratiche 24.06, h 10.00>13.00 COREOGRAFIA Virgilio Sieni CON Serena Carella e Giordano Signorile ASSISTENTI AL PROGETTO Giulio De Leo ed Erika Guastamacchia PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON Teatroscalo – Menhir – Teatri Abitati – Unione Europea – Regione Puglia – Teatro Pubblico Pugliese – Comune di Santeramo In Colle – Innovazione nella rete delle residenze WHDWUDOL,QWHUYHQWRFR¿QDQ]LDWRGDO)(6532 38*/,$$VVH,9±$]LRQHḊGDWR dalla Regione Puglia al Teatro Pubblico Pugliese 152 Danza & Architettura VITA NOVA SIMONA BERTOZZI/ NExUS Guardare ad altezza d’erba ITALIA / ITALy Corderie dell’Arsenale pratiche 25.06, h 10.00>13.00 COREOGRAFIA Simona Bertozzi CON Nanni Capecchi, Alice Crocioni, Laura Lombardi, Carlotta Martellini, Andrea Suero e Diletta Taddei MUSICA A. Vivaldi Andante da Concerto in D minor for 2 Mandolins, J. Barrière Allegro Prestissimo da Sonata for 2 Cellos (feat. Yo-Yo Ma & Bobby McFerrin) ASSISTENTE ALLA COREOGRAFIA Lucia Guarino PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON Teatro Stabile dell’Umbria PROGETTO A CURA DI Associazione Culturale Nexus Si ringraziano Centro Danza, Centro Studi Danza Umbro, Dance Gallery, School of Dancing Spring Danza & Architettura 155 VITA NOVA STIAN DANIELSEN Let’s play NORVEGIA / NORWAy Corderie dell’Arsenale pratiche 26.06, h 10.00>13.00 COREOGRAFIA Stian Danielsen CON Alice Cattelan, Giulia Fregonese, Emma Piotto ed Elisa Settin PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON CSC Centro per la Scena Contemporanea / Casa della danza di Bassano del Grappa sostenuto dalla Regione del Veneto La residenza di creazione al CSC di Bassano del Grappa è stata sostenuta dalla Reale Ambasciata di Norvegia 156 Danza & Architettura VITA NOVA VIRGILIO SIENI Indigene_prima parte ITALIA / ITALy Corderie dell’Arsenale pratiche 28.06, h 10.00>13.00 COREOGRAFIA Virgilio Sieni ASSISTENTE Chelo zoppi CON Bettina Bernardi, Naomi Biancotti, Virginia Cervelli Montel e Linda Pierucci MUSICA ORIGINALE Giovanni Dario Manzini ESECUZIONE DAL VIVO Ensemble De Rerum Mechanica ÀDXWR)UDQFHVFR&KHFFKLQL violino: Pietro Montemagni viola: Emanuele Caligiuri violoncello: Giorgio Marino direttore: Giovanni Dario Manzini PRODUZIONE la Biennale di Venezia, Settori Danza e Musica IN COLLABORAZIONE CON Regione Toscana, Accademia sull’arte del gesto Danza & Architettura 159 In dialogo con la 14. Mostra Internazionale di Architettura PRIMA DANzA Due coreografe e interpreti aprono l’intera fase della loro creazione al pubblico della 14. Mostra Internazionale di Architettura. Two choreographers and performers open their entire phase of creation to the public of the 14th International Architecture Exhibition. 160 Danza & Architettura Danza & Architettura 161 PRIMA DANZA MARINA GIOVANNINI Punto sulla forma ITALIA / ITALy COREOGRAFIA Marina Giovannini CON Marina Giovannini PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON CAB008, Regione Toscana e MiBACT Corderie dell’Arsenale pratiche 7>26.06 performance 27>29.06, h 14.00 /D SUHSDUD]LRQH ¿VLFD OH SURYH OH HVHU citazioni, la scelta di ogni singolo movimento, il rapporto con il suono, la relazione con il mondo e con l’io: da questo nasce un assolo. Punto sulla forma è la narrazione aperta di una creazione, il luogo privilegiato dentro il quale si costruisce una danza che prende spunto GDOO¶RJJHWWLYD VLWXD]LRQH ¿VLFD LO SUHVXSSRVWR e la sostanza stessa del corpo che dà vita a una ELRJUD¿DGDQ]DWD Come nasce una danza? Questo è quello FKHVLSXzYHGHUHDWWUDYHUVRXQD¿QHVWUDDSHUWD che consente al pubblico di assistere a ogni IDVHGLFRVWUX]LRQHGHOODSDUWLWXUDFRUHRJUD¿FD L’assolo nasce dal desiderio di indagare il concetto di fragilità, attraverso le terminazioni nervose di un corpo che diventa costruttore di senso, che si permea di suggestioni, che trova il bello in ciò che è fragile, e virtù nel coraggio e nella determinazione. È questo un luogo di mezzo, uno spazio in bilico dove è il corpo stesso a costruire un VLJQL¿FDWRDWWUDYHUVDQGRODGLPHQVLRQHLQWLPDH quella pubblica, mescolandole, creando un ponte tra arte e vita. La misura dello stato del danzatore qLOSULQFLSLRFKHFRQVHQWHDOFRUSRGLFUHDUH¿QR al completamento dell’autoritratto d’artista. 162 Danza & Architettura Physical training, rehearsals, exercises, the choice of each and every movement, the relationship with sound, the relationship with the world and with the self, all contribute to the creation of a solo. Punto sulla forma is the open story of a creation, the privileged place in which to build a dance inspired by an objective physical situation, the premise and the very substance of the body that gives life to a danced biography. How is a dance created? That is what will be visible through an open window that will allow the audience to participate in every phase of construction of the choreographic score. The solo is born out of the desire to explore the concept of fragility, through the nerve endings of a body that becomes a builder of meaning, that EHFRPHVSHUPHDWHGZLWKVXJJHVWLRQWKDW¿QGV beauty in what is fragile, and virtue in courage and determination. This is a space in-between, a precariously balanced space where the body itself builds meaning as it moves through both the intimate and public dimensions, blending them and creating a bridge between art and life. The measure of the condition of the dancer is the principle that allows the body to create, until the self-portrait of the artist is complete. PRIMA DANZA DI E CON LUISA CORTESI Luisa Cortesi PRODUZIONE la Biennale di Venezia La trappola IN COLLABORAZIONE CON CAB008, Regione Toscana e MiBACT ITALIA / ITALy Corderie dell’Arsenale pratiche 7>20.06, 24.06 e 29.06 L’appuntamento. La trappola. L’appuntamento e La trappola sono una ULÀHVVLRQHVXOWHPSRHODUDSSUHVHQWD]LRQHVXO corpo ospitato ad abitare performativamente due diversi spazi architettonici con diverse modalità temporali. La presenza performativa del corpo nello spazio vive come in un tempo di quiete, in un luogo in cui il corpo come scaricato dalla SURSULDELRORJLDVLR̆UHDOODUDSSUHVHQWD]LRQH letteraria del movimento. In un distacco totale dalla realtà contingente il corpo costruisce una narrazione in un altro territorio della realtà temporale, biologica e quindi anche motoria. La trappola è un’azione concepita in un tempo dilatato in un luogo predisposto architettonicamente per una visione ed esposizione al pubblico del corpo della durata di quattro ore al giorno per venti giorni. Uno spazio aperto di costruzione e rappresentazione. L’appuntamento compatta ed esibisce le azioni e le partiture costruite ne La trappola in un tempo performativo limitato e trasferendosi in un altro luogo. Che cosa determina il tempo della rappresentazione e il concetto di rappresentabilità? 164 Danza & Architettura L’appuntamento. La trappola. L’appuntamento and La trappola are a UHÀHFWLRQ RQ WLPH DQG SHUIRUPDQFH RQ WKH body invited to inhabit, in performing terms, WZR GL̆HUHQW DUFKLWHFWXUDO VSDFHV ZLWK WZR GL̆HUHQWWLPHIUDPHV The performing presence of the body in space seemingly exists within a time of tranquility, in a place in which the body appears disencumbered of its biology and R̆HUV LWVHOI IRU D OLWHUDU\ UHSUHVHQWDWLRQ RI movement. Totally out of touch with everyday reality, the body constructs a narration in D GL̆HUHQW WHUULWRU\ RI WKH UHDOLW\ RI WLPH biology and hence motion. La trappola is an action conceived in a diluted time in a place architecturally suited for viewing and displaying the body to the public for four hours a day over a twenty-day period. An open space for construction and representation. L’appuntamento concentrates and exhibits the actions and scores built in La trappola within a limited performance time and with a change of venue. What is it that determines the time of representation and the concept of being open to representation? Nella vita quotidiana la temporalità è scandita da ritmi biologici ed emozionali variabili attivi e passivi nel rapporto intimo tra il corpo e il pensiero e tra la persona e l’ambiente. Lo scorrere del tempo è relativo alla capacità e alla possibilità di abitarlo. Il tempo delle azioni è scandito dai ritmi del riposo, dell’alimentazione, dell’interazione, della reazione. Che cosa manifesta il corpo nella quotidianità? La quotidianità stessa con la sua attività determina la possibilità delle attività di altri corpi, delle cose e la possibilità di condizionamento naturale. Il corpo d’altra parte ha anche la capacità contraria di poter essere non partecipe alla giornata, di non incidere in nessun modo riguardo all’equilibrio naturale o attivamente nei confronti degli oggetti e delle altre persone. Il corpo può anche non reagire. Nella vita performativa tutto viene come ridotto a una diversa biologia del tempo all’interno del quale tutto si struttura diversamente. Ogni necessità capitola nel baratro della rappresentazione o della performabilità. A proposito del tempo sembra quasi che si possano stabilire delle proporzioni, un minuto e un’ora, un’ora e un giorno, un giorno e un anno, un anno e l’intera vita. In everyday life, time is determined by variable biological and emotional rhythms that are active and passive in the intimate relationship between the body and thought and between the person and the environment. The passing of time is related to the capacity and possibility of inhabiting it. What does the body manifest in everyday life? Everyday life itself, by means of its activities, determines the possible activities of other bodies, of things, and the possibility RIEHLQJLQÀXHQFHGE\QDWXUH The body on the other hand has the opposite capacity to decline participation in the day, to avoid any sort of impact on the balance of nature or active engagement with objects and other people. The body can also choose not to react. In the performing life, everything VHHPVWREHUHGXFHGWRDGL̆HUHQWELRORJ\RI time within which everything is structured LQ D GL̆HUHQW ZD\ (YHU\ QHHG VHHPV WR surrender to the abyss of representation or performability. In the matter of time, it seems possible to establish proportions, a minute and an hour, an hour and a day, a day and a year, a year and an entire lifetime. Danza & Architettura 165 In dialogo con la 14. Mostra Internazionale di Architettura BALLATE Ciclo di danze che segnano l’incontro tra coreografo, danzatore e le altre tipologie di interpreti: musicista, cantante, anziano, bambino, artigiano, donne, uomini, giovani, SURIHVVLRQLVWLHGLOHWWDQWLPDGUL¿JOLSDGUL un catalogo inedito tra antropologia, gioco, LQWXLWRD̆H]LRQLFDSDFHGLWUDFFLDUHXQD JHRJUD¿DLQDVSHWWDWDGLJHVWLSURLHWWDWLYHUVR l’incontro e l’ascolto reciproco. A cycle of dances that will be a meeting between choreographer, dancer and other typologies of performers: musician, singer, elderly person, child, craftsman, women, men, young people, professionals and amateurs, mothers, children, fathers: an original catalogue that brings together anthropology, play, intuition, personal bonds that can trace an unexpected geography of gestures projected towards mutual encounter and the openness to listen. Corderie dell’Arsenale 7>29.06, orari di apertura della mostra 166 Danza & Architettura Danza & Architettura 167 9. Festival Internazionale di Danza Contemporanea – Biennale College - Danza – Progetto Speciale VANGELO SECONDO MATTEO 27 quadri 4>18.07.2014 168 Vangelo secondo Matteo Vangelo secondo Matteo 169 Vangelo secondo Matteo Vangelo secondo Matteo Stefania Di Paolo Le parole, le immagini e i gesti ci informano sulla nostra visione del mondo, ci ULFRUGDQR FKL VLDPR H FL LQYLWDQR D ULÀHWWHUH sul modo con cui scegliamo di rappresentarci. Questo vale tanto per la storia individuale quanto per quella di un popolo o di una civiltà. /H IRUPH GL HVSUHVVLRQH GHOOЧXRPR KDQQR il potere di svelare i nostri valori e le nostre credenze, così come ognuno ha la possibilità GL ULÀHWWHUVL H ULFRQRVFHUVL QHL ORUR SURGRWWL che si tratti di un quadro o di un testo e, in casi fortunati, porsi degli interrogativi. Virgilio Sieni riconosce alla danza OR VWHVVR YDORUH VLPEROLFR GHOOЧLPPDJLQH H GHOOD SDUROD SHUFKp FLDVFXQR GL HVVL performa – scegliendo mezzi differenti – i PRGL SURSUL GHOOЧXRPR GЧHVVHUH H GЧDJLUH Questo discorso è ancor più valido se – in questo gioco di specchi – il coreografo ci LQYLWD D PHGLWDUH VXOOЧHUHGLWj FXOWXUDOH GL uno dei soggetti che più ha definito il nostro modo di sentirci figli e devoti, di vivere la morte e il corpo, di intendere il dolore e di espiarlo: la figura di Cristo. Vangelo secondo Matteo conduce OЧRVVHUYDWRUH D ULFRQRVFHUH OH LQWULFDWH WUDPH che disegnano i rapporti tra ciò che è scritto, FLz FKH VL YHGH H LO JHVWR *Lj QHOOЧDWWR GHO nominare si comprende la poetica di un artista pensatore come Virgilio Sieni: le YHQWLVHWWH D]LRQL FRUHRJUD¿FKH SUHQGRQR LO nome di “quadri”, in cui la ricerca sul gesto è in dialogo con la tradizione visiva legata alle vicende narrate dagli Apostoli. Sieni sceglie inoltre il Vangelo che fra tutti fu il più popolare, quello di Matteo, e investiga 170 Vangelo secondo Matteo Words, images and gestures inform us of our vision of the world, they remind us who we are and invite us to think about how we choose to represent ourselves. This is true both for the history of an individual and for that of a people or civilization. 0DQЧV IRUPV RI H[SUHVVLRQ KDYH WKH SRZHU to reveal our values and our beliefs, just as everyone has the possibility of being UHÀHFWHG DQG UHFRJQL]HG LQ WKHLU SURGXFWV be they a painting or a text and, in the best of cases, raise questions. Virgilio Sieni attributes the same symbolic value to dance as to the image and word, because each of them performs ±FKRRVLQJGL̆HUHQWPHGLD±PDQЧVVSHFL¿F ways of being and acting. This is especially true when – in this play of mirrors – the choreographer invites us to meditate on WKHFXOWXUDOOHJDF\RID¿JXUHWKDWKDVEHHQ PRVW LQÀXHQWLDO LQ GH¿QLQJ WKH ZD\ ZH consider ourselves children and faithful, experience death and the body, understand DQGH[SLDWHSDLQWKH¿JXUHRI&KULVW Vangelo secondo Matteo encourages the observer to recognize the intricate patterns that describe the relationship between what is written, what is seen and gesture. In the very choice of the name one can understand the poetics of an artist and thinker such as Virgilio Sieni: the twentyseven choreographic actions take the name of “tableaux”, as the research into the gesture opens a dialogue with the visual tradition linked to the stories narrated by the Apostles. DWWUDYHUVR GL HVVR VXOOЧHUHGLWj FXOWXUDOH GHOOD storia di Cristo, intesa come esperienza collettiva di confronto col tema della morte e GHOODIXJDFLWjGHOOЧHVLVWHQ]DXPDQD , TXDGUL FRUHRJUD¿FL VRQR GXQTXH variamente abitati da danzatori e non SURIHVVLRQLVWL XQLWL QHOOЧDWWR FRUDOH GHOOD danza. Sieni porta a Venezia una serie di esperienze che trovano la loro origine in GLYHUVL OXRJKL GЧ,WDOLD VYLOXSSDWH LQ WHPSL piuttosto lunghi: questo vuol dire porre OЧDFFHQWR VXO SURFHVVR GL FUHD]LRQH GL XQD D]LRQH FRUHRJUD¿FD LQWHVD FRPH HVSHULHQ]D LQ FRQWLQXR GLYHQLUH 4XHVWD ULÀHVVLRQH q ancora più evidente nella decisione di aprire LOPRPHQWRGLFUHD]LRQHHYHUL¿FDGHOOHD]LRQL nella forma di Appunti per il Vangelo secondo Matteo, alla presenza dei visitatori negli spazi GHOOH &RUGHULH GHOOЧ$UVHQDOH XQ FRQIURQWR dialettico tra il farsi mai concluso del gesto e la compiutezza della storia di Cristo. In ogni quadro il gesto degli interpreti VL ID VLPEROR H DQQXQFLR GHOOЧLQWHUD LSHUEROH cristologica, dove la condanna del corpo GHO )LJOLR LQVHJQD DOOЧXRPR XQ PRGR SHU D̆URQWDUH OH WDSSH LQHYLWDELOL GHOOЧHVLVWHQ]D I tanti corpi degli interpreti – colti nelle peculiarità articolari delle loro età e delle loro abitudini – abitano il territorio del gesto: attraverso di essi Sieni sembra voler cogliere JOL LQ¿QLWL PRGL GL ³LQFDUQDUH´ OD VWRULD GHOOD Passione e allo stesso tempo meditare sulla storia biologica del corpo. 8QDUDGXUDGLDWWHVHV¿RUDPHQWLGHWWDJOL e improvvisi slanci introduce gli interpreti LQ XQЧHVSHULHQ]D GL FRQRVFHQ]D GHO FRUSR GHOOЧDOWUR FKH SDVVD DWWUDYHUVR XQD GLYHUVD forma di tattilità e di educazione dello sguardo. *OL LQ¿QLWL JHVWL GHJOL LQWHUSUHWL FUHDQR XQ vocabolario che attinge nella nostra memoria H LQYLWDQR D FRVWUXLUH DOOЧLQWHUQR GL TXHVWD HSLIDQLDFKHKDOXRJRDOOH7HVHGHOOЧ$UVHQDOHXQ proprio percorso fatto di pause, camminamenti e cambiamenti di punti di vista, e a rintracciare XQD SHUVRQDOH QDUUD]LRQH JHVWXDOH DO ¿QH GL intraprendere un viaggio alla ricerca dei motivi del farsi uomo. Sieni also chooses the most popular of the Gospels, Matthew’s, and uses it to explore the cultural legacy of the story of Christ, understood as a collective experience that addresses the subject of death and the ÀHHWLQJQDWXUHRIKXPDQH[LVWHQFH The choreographic tableaux are therefore variously inhabited by dancers and non-professionals, united in the unanimous act of dance. Sieni brings to Venice a series of experiences that originate in various places throughout Italy and have been developed across rather long periods of time: this means placing the accent on the process of creation of a choreographic action understood as a constantly evolving experience. This consideration becomes even more evident in the decision to open the moment of creation and the evaluation of the actions, in the form of Appunti per il Vangelo secondo Matteo, to the presence of the visitors to the spaces of the Corderie dell’Arsenale: a dialectical engagement between the never-ending execution of the gesture and the perfection of the story of Christ. In each tableau the gesture of the performers becomes the symbol and announcement of the entire Christological hyperbole, where the sentence passed on the body of the Son teaches man to confront the inevitable phases of existence. The many bodies of the performers – highlighting the VSHFL¿FLW\RIDUWLFXODWLRQVEDVHGRQDJHDQG habits – inhabit the territory of gesture: Sieni seems to use them to capture the LQ¿QLWH ZD\V RI ³LQFDUQDWLQJ´ WKH VWRU\ RI the Passion and to simultaneously meditate on the biological history of the body. A clearing of pauses, light touches, details and sudden leaps introduces the performers to a cognitive experience of the RWKHU¶V ERG\ ZKLFK HQWDLOV D GL̆HUHQW IRUP of tactility and training of the gaze. The LQ¿QLWH JHVWXUHV RI WKH SHUIRUPHUV FUHDWH a vocabulary borrowed from our memory and invite us to build, within this epiphany that takes place in the Tese dell’Arsenale, a personal itinerary that encourages us to pause, to walk, to change our points of view, and to seek a personal narration of gestures with the purpose of undertaking a journey in search of the reasons for becoming man. Vangelo secondo Matteo 171 REGIA E COREOGRAFIA VIRGILIO SIENI Vangelo secondo Matteo ITALIA / ITALy 27 quadri, 4>18.07 4>6 luglio 2014 Primo ciclo, Quadri 1 - 9 Spettacoli: Teatro alle Tese venerdì e sabato ore 20, domenica h 12 11>13 luglio 2014 Secondo ciclo, Quadri 10 - 1 8 Spettacoli: Teatro alle Tese venerdì e sabato ore 20, domenica h 12 17>18 luglio 2014 Terzo ciclo, Quadri 19 - 27 Spettacoli: Teatro alle Tese giovedì e venerdì h 20 Virgilio Sieni MUSIChE ORIGINALI ESEGUITE DAL VIVO Corale G. Savani, Naomi Berrill e Daniele Roccato PRODUZIONE la Biennale di Venezia IN COLLABORAZIONE CON CID Centro Internazionale della Danza e Festival Oriente Occidente, ERT Emilia Romagna Teatro, Comune di Matera Comitato Matera 2019 Soprintendenza BSAE della Basilicata e Basilicata 1799 / Festival Città delle 100 scale, Fondazione I Teatri di Reggio Emilia, Regione Toscana, Accademia sull’Arte del gesto, CREST e Teatro Scalo / Menhir (progetto Teatri Abitati in Puglia) Si ringrazia per il sostegno alla realizzazione Teatro Pubblico Pugliese e Dansystem – The Puglia Dance Network (PO FESR Puglia 2007-13 Asse IV Azione 4.3.2) Si ringraziano inoltre Associazione Culturale Presepe Vivente Pezze di Greco – Fasano di Puglia, Associazione Produttori Pomodoro Regina di Torre Canne_Presidio Slow Food, Parco Naturale Regionale delle Dune Costiere da Torre Canne a Torre San Leonardo 9HUL¿FKHHSUDWLFKHDSHUWHDOSXEEOLFRDOO LQWHUQR della 14. Mostra Internazionale di Architettura Corderie dell'Arsenale Un viaggio nelle pieghe dei volti e nella verità del gesto. Il progetto sarà articolato in 27 quadri interpretati da danzatori, anziani, bambini, gente comune, non vedenti, DUWLJLDQL PDGUL SDGUL H ¿JOL LQWHUSUHWL provenienti da varie regioni italiane e da altri continenti. Ogni azione nasce seguendo un processo di ascolto e trasmissione. 1HOO¶D̆URQWDUH TXHOOH FKH VDUDQQR YHUH H SURSULHD]LRQLFRUHRJUD¿FKHJOLDVSHWWLGHOOD PLVXUDGHOULWPRGHOODTXDOLWjGHOOD¿JXUDH GHOJHVWRGLDORJKHUDQQRFRQO¶LFRQRJUD¿DGHO racconto evangelico. A journey into the folds of the faces and the truth of gesture. The project will be divided into 27 scenes performed by dancers, elderly people, children, common people, blind people, craftsmen, mothers, fathers and sons, performers from various regions of Italy and other continents. Every action arises from a process of awareness and transmission. In engaging in what will be genuine choreographic actions, the aspects of measure, rhythm, the quality of WKH¿JXUHDQGWKHJHVWXUHZLOOGLDORJXHZLWK the iconography of the Gospel’s narrative. Vangelo secondo Matteo 175 BIENNALE COLLEGE – DANZA Per una nuova ecologia dell’incontro ©8QIDWWRWUDUUjOXFHGDOO¶DOWURQpOD cieca notte ti impedirà il cammino, sì che tu non giunga a vedere gli ultimi FRQ¿QLGHOODQDWXUDWDQWROHFRVH accenderanno lume alle cose». For a new ecology of encounter «For one thing after other will grow clear, nor shall the blind night rob thee of the road, to hinder thy gaze on nature's Farthest-forth. Thus things for things shall kindle torches new». Lucrezio, De rerum natura (I, 1114-7) Come in Lucrezio la luce è soprattutto risonanza delle cose, così le pratiche di formazione verso la creazione, che Virgilio Sieni ha posto alla base delle attività di Biennale College – Danza, riecheggiano nella trasmissione del gesto la materialità dell’esperienza. Soltanto ripensando a fondo la relazione tra pratica e trasmissione è possibile costruire una nuova relazione in grado di trasformare il gesto capace in gesto sapiente. In queste pratiche pensate apposta per Biennale College – Danza si producono inedite tecniche di relazione, come veri e propri sistemi aperti che non dànno semplicemente le misure al movimento dei corpi, ma creano un continuo divenire dei corpi attraverso il movimento. Se è possibile pensare a un repertorio di danza contemporanea per giovanissimi interpreti, e dunque a una idea di formazione, occorre farlo entro i margini di questa indeterminatezza, nei passaggi aperti di queste inedite relazioni che sono il risultato di una nuova ecologia dell’incontro. Così come gli spazi aperti dei campi, che alcune di queste esperienze invaderanno, comporranno XQDJHRJUD¿DGHOVHQWLUHLQVFULYHUDQQRQHOOR spazio la percezione di nuove intensità. 176 Just as in Lucretius, the light is above all a reverberation of things, the educational practices for creation, on which Virgilio Sieni has based the activities of the Biennale College – Dance, echo the material nature of the experience through the transmission of gesture. It is only by deeply reconsidering the relationship between practice and transmission that it is possible to build a new relationship that can transform the capable gesture into the meaningful gesture. 7KHVH SUDFWLFHV FRQFHLYHG VSHFL¿FDOO\ IRU the Biennale College – Dance, produce new and original relation techniques, truly open systems that do not simply establish measure for the movement of bodies, but create a continuous evolution of the bodies through movement. So if it possible to conceive of a contemporary dance repertory for very young dancers, and hence an idea of education, it is important to do so within the boundaries of this indeterminacy, in the open channels of these new relations which are the product of a new ecology of the encounter. Like the open spaces of the city squares, which some of these experiences will invade, they will compose a geography Le pratiche che hanno dato vita a Biennale College – Danza del 2013, Abitare il Mondo, sono state quest’anno ripercorse H DPSOL¿FDWH SHU FUHDUH XQ continuum di relazioni con gli artisti ospiti e gli spazi prescelti. Una attività che ha compreso anche performance e spettacoli aperti al pubblico e visibili per tutto l’arco dell’anno. Le pratiche di formazione verso la creazione di Biennale College – Danza sono presenti in forma organica nel programma del 9. Festival Internazionale di Danza Contemporanea, e ULJXDUGDQR GL̆HUHQWL WLSRORJLH GL SURJHWWL FKH si irradiano nelle varie sezioni che compongono il Festival. Un programma molto articolato di pratiche che coinvolgono un’intera comunità di danzatori e giovani, anziani, artigiani, madri, SDGULH¿JOLFKHLQFRQWUDQRLFRUHRJUD¿FKLDPDWL a condurre i diversi percorsi. Il contributo dei YDUL FRUHRJUD¿ LQYLWDWL DO )HVWLYDO VL YHGDQR le rispettive note introduttive nel presente catalogo), e in stretta relazione con Biennale College – Danza, si articola unitamente anche a un ciclo di lezioni quotidiane di tecnica e composizione tenute da Marina Giovannini (3>8 giugno), Anton Lachky (9>22 giugno), Beniamin Boar (9>14 giugno), Paul Blackman (9>15 giugno), Edivaldo Ernesto (16>22 giugno), Iris Erez (16>22 giugno), Christine Gouzelis (23>29 giugno) e David Zambrano (16>29 giugno). Ma l’attività di Biennale College – Danza ha avuto il suo avvio già nel gennaio 2014 con il progetto La casina dei biscotti di Virgilio Sieni per il 5. Carnevale Internazionale dei Ragazzi della Biennale di Venezia, attraverso un percorso sulla interpretazione di personaggi GL¿DEH/¶HYHQWRKDFUHDWRXQSRORGLHQHUJLD ¿DEHVFDULYROWRDJLRYDQLVVLPLLQWHUSUHWLHKD preso origine dal gesto “gnomico” e ricercato dei danzatori. Il progetto di Biennale College – Danza si completerà a ottobre, all’interno dei programmi di Biennale Musica, diretta dal maestro Ivan Fedele, con la seconda parte di Indigene di Virgilio Sieni (Vita Nova) e la collaborazione per ODUHDOL]]D]LRQHFRUHRJUD¿FDGL-DUL%ROGULQLSHU Vesalii Icones di Peter Maxwell Davies. of feeling, they will inscribe the perception of new forms of intensity into the space. The practices that brought to life the 2013 Biennale College – Dance, Abitare il Mondo KDYH EHHQ UHYLHZHG DQG DPSOL¿HG this year to create a continuum of relations with the guest artists and the selected spaces. This activity also included performances and productions open to the public and visible throughout the year. The educational practices for creation of the Biennale College – Dance are organically incorporated into the programme of the 9th International Contemporary Dance Festival, DQG LQYROYH GL̆HUHQW W\SRORJLHV RI SURMHFWV WKDW UDGLDWH RXWZDUGV LQWR WKH GL̆HUHQW sections that make up the Festival. A detailed programme of practices that involve an entire community of dancers and young people, elderly people, craftsmen, mothers, fathers and children who meet the choreographers LQYLWHG WR OHDG WKH GL̆HUHQW SURFHVVHV 7KH contribution of the many choreographers invited to the Festival (see the respective introductory notes in this catalogue) and in strict relation with the Biennale College – Dance, will be accompanied by a cycle of daily classes in technique and composition held by Marina Giovannini (3>8 June), Anton Lachky (9>22 June), Beniamin Boar (9>14 June), Paul Blackman (9>15 June), Edivaldo Ernesto (16>22 June), Iris Erez (16>22 June), Christine Gouzelis (23>29 June) and David zambrano (16>29 June). But the work of the Biennale College – Dance began earlier this year in January 2014 with the project for the The Cookie Cottage by Virgilio Sieni for the 5th International Kids’ Carnival of La Biennale di Venezia, which focused on the interpretation of fairytale characters. The event created a nucleus of IDLU\WDOH HQHUJ\ VSHFL¿FDOO\ IRU YHU\ \RXQJ performers, and was based on the cultivated ³HO¿Q´JHVWXUHRIWKHGDQFHUV The project for the Biennale College – Dance will be completed in October, as part of the programme of the Music Biennale, directed by maestro Ivan Fedele, with the second part of Indigene by Virgilio Sieni (Vita Nova) and the collaboration in Jari Boldrini’s choreographic production for Vesalii Icones by Peter Maxwell Davies. 177 DANzA & ARCHITETTURA 7.06 > 29.06.2014 CORDERIE DELL’ARSENALE Ingresso libero per i visitatori della 14. Mostra Internazionale di Architettura ‡K! ‡K!VRORYHQHVDE¿QRDO 9. FESTIVAL INT.LE DI DANzA CONTEMPORANEA 19.06 > 29.06.2014 Riduzioni Over 65, under 26, Biennale Card 2014, CTS, ITIC, ISIC, COOP, Touring Club, FAI, ARCA-Enel, Venice Card (Junior/ Adult/San Marco), Rolling Venice Card, Carta Giovani, Cinema Più, su presentazione del biglietto della 14. Mostra Internazionale di Architettura Accompagnatori degli spettatori con LQDELOLWjPRWRULDHEDPELQL¿QRDLDQQL ingresso gratuito Carnet giornaliero &$Ч*,867,1,$16DOD&RORQQH TEATRINO PALAZZO GRASSI / Auditorium CONSERVATORIO / Sala Prove Teatro alle Tese ‡VSHWWDFROL ¼ ‡VSHWWDFROL ¼ &$Ч*,867,1,$16DOD&RORQQH TEATRINO PALAZZO GRASSI / Auditorium CONSERVATORIO / Sala Prove ‡VSHWWDFROL ¼ ‡VSHWWDFROL ¼ 6FHOWDGDH̆HWWXDUVLDOPRPHQWR dell’acquisto. Date non sostituibili. Non rimborsabile. Biglietto Unico Abbonamenti TEATRO MALIBRAN Intero 25 € Ridotto 23 € 10 € TEATRO ALLE TESE Navata II / Navata IV Intero 15 € Ridotto 13 € Intero 20 € * Ridotto 18 € * * Marzo di Dewey Dell (28.06 h 20.30) Navata III Intero 20 € Ridotto 18 € TEATRO PICCOLO ARSENALE Intero 20 € Ridotto 18 € DANCE & ARCHITECTURE 7.06 > 29.06.2014 CORDERIE DELL’ARSENALE Free admission for the 14th International Architecture Exhibition’s visitors ‡K! ‡K!IULDQGVDWRQO\XQWLO 9TH INTL. FESTIVAL OF CONTEMPORARY DANCE 19.06 > 29.06.2014 Teatro alle Tese Navata II 50 € Navata III 80 € Navata IV 70 € Full 160 € WEEK END (ven-sab-dom) 90 € ¿QRDHVDXULPHQWRSRVWLGLVSRQLELOL Formula ARChITETTURA+Danza 35 € Reductions Over 65, under 26, Biennale Card 2014, CTS, ITIC, ISIC, COOP, Touring Club, FAI, ARCA-Enel, Venice Card (Junior/ Adult/San Marco), Rolling Venice Card, Carta Giovani, Cinema Più, upon presentation of a ticket for the 14th International Architecture Exhibition Adults accompanying disabile visitors, and children up to the age of 6 (included): free admission Daily One Price Subscriptions 10 € TEATRO ALLE TESE Navata II / Navata IV Full price 15 € Reduced 13 € Full price 20 € * Reduced 18 € * * Marzo by Dewey Dell (28.06 h 20.30) Navata III Full price 20 € Reduced 18 € TEATRO PICCOLO ARSENALE Full price 20 € Reduced 18 € Incontri ,QJUHVVROLEHUR¿QRDHVDXULPHQWRSRVWL Info e prevendite Tel. + 39 041 5218828, fax 041 5218732 promozione@labiennale.org www.labiennale.org Rialto Informazioni e prevendite biglietti tramite il circuito Vivaticket Online su www.vivaticket.it nei punti vendita in tutta Italia al Call Center 892.234 oppure 89.24.24 YLDPRELOHFRQDOOЧDSS9LYDWLFNHW Tutte le info su www.vivaticket.it S. Angelo Teatrino Palazzo Grassi Auditorium e Foyer Punto vendita &DЧ*LXVWLQLDQ San Marco 1364/a – Venezia 26.05>29.06, lun>sab h 15.00>19.00 Punti vendita hellovenezia Venezia – P.le Roma, Infopoint p.le antistante Ferrovia, Tronchetto, Lido – S.M. Elisabetta Mestre – Via Verdi 14/D Dolo – Via Mazzini, 108 Sottomarina – P.le Europa 2/c Campo Novo Campo Sant’Angelo S. Samuele Campo San Maurizio Conservatorio B. Marcello Campo Pisani Accademia Ca’ Giustinian S.M. Giglio Ingresso su invito ritirabile presso &DЧ*LXVWLQLDQDSDUWLUHGDOƒJLRUQR DQWHFHGHQWHORVSHWWDFRORH¿QRD esaurimento posti disponibili &$Ч*,867,1,$16DOD&RORQQH TEATRINO PALAZZO GRASSI / Auditorium CONSERVATORIO / Sala Prove Full price 25 € Reduced 23 € Teatro Malibran Ingresso libero &$Ч*,867,1,$1/DEGHOOH$UWL &$Ч*,867,1,$16DORQHƒSLDQR TEATRINO PALAZZO GRASSI / Foyer Teatro alle Tese ‡VKRZV ¼ ‡VKRZV ¼ &$Ч*,867,1,$16DOD&RORQQH TEATRINO PALAZZO GRASSI / Auditorium CONSERVATORIO / Sala Prove ‡VKRZV ¼ ‡VKRZV ¼ The choice must be made at the moment RISXUFKDVHDQGPD\QRWEHPRGL¿HG No refunds. TEATRO MALIBRAN CAMPO PISANI CAMPO S. MAURIZIO CAMPO NOVO CAMPO S. ANGELO Teatro alle Tese Navata II 50 € Navata III 80 € Navata IV 70 € Full 160 € WEEK END (fri-sat-sun) 90 € VXEMHFWWRVHDWLQJDYDLODELOLW\ ARChITECTURE+DanCE Formula 35 € &$Ч*,867,1,$1/DEGHOOH$UWL &$Ч*,867,1,$16DORQHƒSLDQR TEATRINO PALAZZO GRASSI / Foyer Admission by invitation which may be FROOHFWHGDW&DЧ*LXVWLQLDQEHJLQQLQJRQ the 4th day before the show while seats are available CAMPO PISANI CAMPO S. MAURIZIO CAMPO NOVO CAMPO S. ANGELO Free admission Meetings )UHHHQWUDQFHVXEMHFWWRVHDWLQJ availability Info and advance sales Tel. + 39 041 5218828, fax 041 5218732 promozione@labiennale.org www.labiennale.org Information and tickets advance sale with Vivaticket Online at www.vivaticket.it by the stores all over Italy by the Call Center 892.234 or 89.24.24 via mobile with the Vivaticket app All information available at www.vivaticket.it Teatro alle Tese Sales point &DЧ*LXVWLQLDQ San Marco 1364/a – Venezia 26.05>29.06, mon>sat h 15.00>19.00 Teatro Piccolo Arsenale hellovenezia sales points Venezia – P.le Roma, Railways Station Infopoint, Tronchetto, Lido – S.M. Elisabetta Mestre – Via Verdi 14/D Dolo – Via Mazzini, 108 Sottomarina – P.le Europa 2/c Arsenale Corderie dell’Arsenale S. Marco Vallaresso catalogo a cura di Virgilio Sieni con la collaborazione di Stefano Tomassini foto e disegni di Virgilio Sieni SURJHWWRJUD¿FRHUHDOL]]D]LRQH la Biennale di Venezia coordinamento redazionale a cura della Biennale di Venezia traduzioni Olga Barmine stampa /¶$UWHJUD¿FDGL=DLD3H&VQF © la Biennale di Venezia 2014