Multi V 5
Multi V 5
Multi V 5
INSTALLATION MANUAL
For continual product development, LG Electronics U.S.A., Inc. reserves the right to change specifications without notice.
© LG Electronics U.S.A., Inc.
TABLE OF CONTENTS
WITH
The instructions below must be followed to prevent product malfunction, property damage, injury or death to the user or other people. Incor-
rect operation due to ignoring any instructions will cause harm or damage. The level of seriousness is classified by the symbols described
below.
TABLE OF SYMBOLS
DANGER This symbol indicates an imminently hazardous situation which, if not avoided, will result in death or serious injury.
WARNING This symbol indicates a potentially hazardous situation which, if not avoided, could result in death or serious injury.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
CAUTION This symbol indicates a potentially hazardous situation which, if not avoided, may result in minor or moderate injury.
NOTE This symbol indicates situations that may result in equipment or property damage accidents only.
Note: This symbol indicates information related to the current procedure.
INSTALLATION
DANGER
'RQRWVWRUHRUXVHÀDPPDEOHJDVRUFRPEXVWLEOHVQHDU Do not supply power to the unit until all wiring and piping
the unit. are completed or reconnected and checked.
7KHUHLVULVNRI¿UHH[SORVLRQDQGSK\VLFDOLQMXU\RUGHDWK There is risk of physical injury or death due to electric shock.
WARNING
Do not install or remove the unit by yourself (end user). If the air conditioner is installed in a small space, take
Ask the dealer or an LG trained technician to install the unit. measures to prevent the refrigerant concentration from
,PSURSHULQVWDOODWLRQE\WKHXVHUZLOOUHVXOWLQ¿UHH[SORVLRQHOHFWULF exceeding safety limits in the event of a refrigerant leak.
shock, physical injury or death. Consult the latest edition of American Society of Heating,
Refrigerating, and Air Conditioning Engineers (ASHRAE) Standard 15.
For replacement of an installed unit, always contact an LG If the refrigerant leaks and safety limits are exceeded, it could result in
trained service provider. personal injuries or death from oxygen depletion.
7KHUHLVULVNRI¿UHHOHFWULFVKRFNH[SORVLRQDQGSK\VLFDOLQMXU\RU
death. The heat recovery unit must be installed indoors; do not
install the heat recovery unit in a highly humid environment.
Wear protective gloves when handling equipment. Sharp There is risk of physical injury or death due to electric shock.
edges will cause personal injury.
Dispose of the packing materials safely.
Do not change the settings of the protection devices. • Packing materials, such as nails and other metal or wooden parts,
If the protection devices have been bypassed or are forced to operate will cause puncture wounds or other injuries.
LPSURSHUO\RUSDUWVRWKHUWKDQWKRVHVSHFL¿HGE\/*DUHXVHGWKHUHLV • Tear apart and throw away plastic packaging bags so that children
ULVNRI¿UHHOHFWULFVKRFNH[SORVLRQDQGSK\VLFDOLQMXU\RUGHDWK will not play with them and risk suffocation and death.
Replace all control box and panel covers. Install the unit considering the potential for strong winds or
If cover panels are not securely installed, dust, water, and animals will earthquakes.
HQWHUWKHRXWGRRUXQLWFDXVLQJ¿UHHOHFWULFVKRFNDQGSK\VLFDOLQMXU\RU Improper installation will cause the unit to fall over, resulting in physical
death. injury or death.
Always check for system refrigerant leaks after the unit has Install the unit in a safe location where nobody can step on,
been installed or serviced. fall onto it, or place objects on it. Do not install the unit on
Exposure to high concentration levels of refrigerant gas will lead to a defective stand.
illness or death. It will result in an accident that causes physical injury or death.
Due to our policy of continuous product innovation, some specifications may change without notification.
4
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SAFETY PRECAUTIONS
WITH
WARNING
Properly insulate all cold surfaces to prevent “sweating.”
Cold surfaces such as uninsulated piping can generate condensate that could drip, causing a slippery surface that creates a risk of slipping, falling,
and personal injury.
CAUTION
Be very careful when transporting the product. There is a risk of the product falling and causing physical injury.
• Use appropriate moving equipment to transport each frame; ensure the equipment is capable of supporting the weights listed.
• Some products use polypropylene bands for packaging. Do not use polypropylene bands to lift the unit.
• Suspend the outdoor unit from the base at specified positions (at a minimum of six [6] points) to avoid slippage from rigging apparatus.
LG Electronics U.S.A., Inc., is not responsible for any piping Keep the unit upright during installation to avoid vibration or
calculations, refrigerant leaks, degradation of performance, water leakage.
or any other potential problems or damages as a result of
interconnecting piping, their joint connections, isolation When installing the unit in a hospital, mechanical room, or
Safety Precautions
valves, introduced debris inside the piping system, or other VLPLODUHOHFWURPDJQHWLF¿HOG (0) VHQVLWLYHHQYLURQPHQW
problems caused by the interconnecting piping system. SURYLGHVXႈFLHQWSURWHFWLRQDJDLQVWHOHFWULFDOQRLVH
Inverter equipment, power generators, high-frequency medical equip-
Do not install the product where it is exposed directly to ment or radio communication equipment will cause the air conditioner to
ocean winds. operate improperly. The unit will also affect such equipment by creating
Sea salt in the air will cause the product to corrode. Corrosion, par- electrical noise that disturbs medical treatment or image broadcasting.
WLFXODUO\RQWKHFRQGHQVHUDQGHYDSRUDWRU¿QVFRXOGFDXVHSURGXFW
PDOIXQFWLRQRULQHI¿FLHQWRSHUDWLRQ The heat recovery box must be installed indoors; do not
install the heat recovery box in a highly humid environment.
When installing the outdoor unit in a low-lying area, or a lo- There is risk of product failure and property damage.
cation that is not level, use a raised concrete pad or concrete
blocks to provide a solid, level foundation. When connecting refrigerant piping, remember to allow for
This prevents water damage and abnormal vibration. pipe expansion.
Improper piping installation will cause system malfunction.
Properly insulate all cold surfaces to prevent “sweating.”
Cold surfaces such as uninsulated piping can generate condensate that Do not install the outdoor unit or heat recovery unit in a
will drip and cause a slippery surface condition and / or water damage to noise-sensitive area.
walls.
Take appropriate actions at the end of HVAC equipment life
Always check for system refrigerant leaks after the unit has to recover, recycle, reclaim, or destroy R410A refrigerant
been installed or serviced. according to applicable U.S. Environmental Protection
Low refrigerant levels will cause product failure. Agency (EPA) rules.
Do not make refrigerant substitutions. Use R410A only. Periodically check that the outdoor frame is not damaged.
If a different refrigerant is used, or air mixes with original refrigerant, the There is a risk of equipment damage.
unit will malfunction and damage will occur.
Install the unit in a safe location where no one can step on or
'RQRWVWRUHRUXVHÀDPPDEOHJDVFRPEXVWLEOHVQHDU fall onto it. Do not install the unit on a defective stand.
the unit. There is a risk of unit and property damage.
There is a risk of product failure.
Install the drain hose to ensure adequate drainage.
Do not use the product for mission critical or special pur- There is a risk of water leakage and property damage.
pose applications such as preserving foods, works of art, or
other precision air conditioning applications. The equipment
is designed to provide comfort cooling and heating.
There is risk of property damage.
Due to our policy of continuous product innovation, some specifications may change without notification. 5
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SAFETY PRECAUTIONS
WITH
WIRING
DANGER
High voltage electricity is required to operate this system. Properly size all circuit breakers or fuses.
Adhere to the U.S. National Electric Codes (NEC) and these 7KHUHLVULVNRI¿UHHOHFWULFVKRFNH[SORVLRQSK\VLFDOLQMXU\RUGHDWK
instructions when wiring.
Improper connections and inadequate grounding can cause accidental Do not share the electrical circuit with other devices.
injury or death. 7KHUHLVULVNRI¿UHHOHFWULFVKRFNDQGSK\VLFDOLQMXU\RUGHDWKGXHWR
heat generation.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Always ground the unit following local, state, and NEC codes.
7KHUHLVULVNRI¿UHHOHFWULFVKRFNDQGSK\VLFDOLQMXU\RUGHDWK Do not use damaged or loose power wiring. Do not
modify or extend the outdoor unit’s power wiring. Ensure that
7XUQWKHSRZHURႇDWWKHQHDUHVWGLVFRQQHFWEHIRUHVHUYLFLQJ the power wiring will not be pulled nor weight be placed on
the equipment. the power wiring during operation.
Electrical shock can cause physical injury or death. 7KHUHLVULVNRI¿UHHOHFWULFVKRFNDQGSK\VLFDOLQMXU\RUGHDWK
WARNING
The information contained in this manual is intended for use 6HFXUHDOO¿HOGZLULQJFRQQHFWLRQVZLWKDSSURSULDWHZLUH
E\DQLQGXVWU\TXDOL¿HGH[SHULHQFHGWUDLQHGHOHFWULFLDQ strain relief.
familiar with the NEC who is equipped with the proper tools Improperly securing wires will create undue stress on equipment power
and test instruments. FRQQHFWLRQV,QDGHTXDWHFRQQHFWLRQVZLOOJHQHUDWHKHDWFDXVHD¿UH
Failure to carefully read and follow all instructions in this manual can and physical injury or death.
result in personal injury or death.
Ensure the system is connected to a dedicated power source
All electric work must be performed by a licensed electrician that provides adequate power.
and conform to local building codes or, in the absence of If the power source capacity is inadequate or the electric work is not
local codes, with the NEC, and the instructions given in this SHUIRUPHGSURSHUO\LWZLOOUHVXOWLQ¿UHHOHFWULFVKRFNSK\VLFDOLQMXU\RU
manual. death.
If the power source capacity is inadequate or the electric work is not
SHUIRUPHGSURSHUO\LWZLOOUHVXOWLQ¿UHHOHFWULFVKRFNSK\VLFDOLQMXU\RU Properly tighten all power connections.
death. /RRVHZLULQJZLOORYHUKHDWDWFRQQHFWLRQSRLQWVFDXVLQJD¿UHSK\VLFDO
injury or death.
Refer to local, state, and federal codes, and use power wires
RIVXႈFLHQWFXUUHQWFDSDFLW\DQGUDWLQJ Do not change the settings of the protection devices.
:LUHVWKDWDUHWRRVPDOOZLOOJHQHUDWHKHDWDQGFDXVHD¿UHDQGSK\VLFDO If the protection devices have been bypassed or is forced to operate
injury or death. LPSURSHUO\RUSDUWVRWKHUWKDQWKRVHVSHFL¿HGE\/*DUHXVHGWKHUHLV
ULVNRI¿UHHOHFWULFVKRFNH[SORVLRQDQGSK\VLFDOLQMXU\RUGHDWK
Do not supply power to the unit until all electrical wiring, The information contained in this manual is intended for use
controls wiring, piping, installation, and refrigerant system E\DQLQGXVWU\TXDOL¿HGH[SHULHQFHGOLFHQVHGHOHFWULFLDQ
evacuation are completed. familiar with the NEC who is equipped with the proper tools
The system will malfunction. and test instruments.
Failure to carefully read and follow all instructions in this manual can
result in equipment malfunction and property damage.
Due to our policy of continuous product innovation, some specifications may change without notification.
6
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SAFETY PRECAUTIONS
WITH
OPERATION
DANGER
'RQRWSURYLGHSRZHUWRRURSHUDWHWKHXQLWLILWLVÀRRGHG Use inert (nitrogen) gas when performing leak tests or air
or submerged. purges. 'RQRWXVHFRPSUHVVHGDLUR[\JHQRUÀDPPDEOH
7KHUHLVULVNRI¿UHHOHFWULFVKRFNSK\VLFDOLQMXU\RUGHDWK gases.
8VLQJWKHVHVXEVWDQFHVZLOOFDXVH¿UHH[SORVLRQDQGSK\VLFDOLQMXU\RU
Use a dedicated breaker for this product. death.
7KHUHLVULVNRI¿UHHOHFWULFVKRFNSK\VLFDOLQMXU\RUGHDWK
If refrigerant leaks out, ventilate the area before operating the
Do not operate the disconnect switch with wet hands. unit.
7KHUHLVULVNRI¿UHHOHFWULFVKRFNSK\VLFDOLQMXU\RUGHDWK If the unit is mounted in an enclosed, low-lying, or poorly ventilated area,
DQGWKHV\VWHPGHYHORSVDUHIULJHUDQWOHDNLWZLOOFDXVHD¿UHHOHFWULF
Periodically verify the equipment mounts have not shock, explosion, physical injury or death.
deteriorated.
If the base collapses, the unit could fall and cause physical injury or death.
WARNING
Do not allow water, dirt, or animals to enter the unit. Do not touch the refrigerant piping during or after
7KHUHLVULVNRI¿UHHOHFWULFVKRFNSK\VLFDOLQMXU\RUGHDWK operation.
Safety Precautions
It can cause burns or frostbite.
Do not operate the unit with the panel(s) or protective
FRYHU V UHPRYHGNHHS¿QJHUVDQGFORWKLQJDZD\IURP Do not open the inlet during operation.
moving parts. There is risk of electric shock, physical injury or death.
The rotating, hot, cold, and high-voltage parts of the unit can cause
physical injury or death.
CAUTION
To avoid physical injury, use caution when cleaning or servicing the air conditioner.
There is risk of electric shock, physical injury or death.
&OHDQXSWKHVLWHDIWHUVHUYLFLQJLV¿QLVKHGDQGFKHFNWKDW Use only a soft cloth to clean the air conditioner. Do not
no metal scraps, screws, or bits of wiring have been left use wax, thinner, or strong detergents.
inside or surrounding the unit. Strong cleaning products will damage the surface of the air conditioner,
Do not use the product for mission critical or special pur- or cause its appearance to deteriorate.
pose applications such as preserving food, works of art, or Provide power to the outdoor unit to warn the compressor
other precision air conditioning applications. The equipment crankcase at least six (6) hours before operation begins.
is designed to provide comfort cooling and heating. Starting operation with a cold compressor sump(s) will result in severe
There is risk of property damage. bearing damage to the compressor(s). Keep the power switch on during
Do not allow water, dirt, or animals to enter the unit. the operational season.
There is risk of unit failure. 'RQRWWXUQRႇWKHPDLQSRZHUVZLWFKDIWHURSHUDWLRQKDV
Do not open the inlet during operation. been stopped.
There is risk of unit failure. :DLWDWOHDVW¿YH PLQXWHVEHIRUHWXUQLQJRIIWKHPDLQSRZHUVZLWFK
otherwise it will result in product malfunction.
Do not operate the unit with the panel(s) or protective
FRYHU V UHPRYHGNHHS¿QJHUVDQGFORWKLQJDZD\IURP Do not block the inlet or outlet.
moving parts. Unit will malfunction.
Non-secured covers can result in malfunction due to dust or water in the Auto-addressing must be performed after connecting the
service panel. power of all indoor and outdoor units.
Periodically verify the equipment mounts have not Auto-addressing must also be performed after servicing an indoor unit.
deteriorated.
If the base collapses, the unit could fall and cause property damage or
product failure.
Due to our policy of continuous product innovation, some specifications may change without notification. 7
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
UNIT NOMENCLATURE
WITH
Outdoor Units and Heat Recovery Units
ARU M 072 B T E 5
Family
ARU = Multi V Outdoor Unit (Refrigerant R410A)
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Type
M = Combination (Heat Pump or Heat Recovery)
Capacity (Mbh)
072 = 72 192 = 192 312/313 = 312 432 = 432
096 = 96 216 = 216 336/337 = 336 456 = 456
121 = 121 241 = 240 360 = 360 480 = 480
144 = 144 264 = 264 384 = 384 504 = 504
168 = 168 288 = 288 408 = 408
Electrical Ratings
B = 208–230V/60Hz/3Ph
D = 460V/60Hz/3Ph
Airflow Configuration
T = Top Discharge
Efficiency
E = High Efficiency
Generation
5 = Fifth
Number of Ports
02 = Two Ports 06 = Six Ports
03 = Three Ports 08 = Eight Ports
04 = Four Ports
Series Number
2A
3A
Due to our policy of continuous product innovation, some specifications may change without notification.
8
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
208-230V Outdoor Units
Product Data
Motor Output (kW) x Qty. 1.5 x 1 0.9 x 2 0.9 x 2 0.9 x 2
Motor/Drive Brushless Digitally Controlled / Direct
Cooling 0 - 1,000 0 - 1,150 0 - 1,150 0 - 1,150
Operating Range (RPM)
Heating 80 - 1,000 80 - 1,150 80 - 1,150 80 - 1,150
Maximum Air Volume (CFM) 8,470 11,300 11,300 11,300
ESP (in. w.g., Selectable Range) 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32
Unit Data
Refrigerant Type R410A R410A R410A R410A
Refrigerant Control/Location EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit
Factory Charge lbs. of R410A 14.3 23.2 23.2 26.5
Max. No. Indoor Units/System2 13 16 20 24
Sound Pressure dB(A)3 58.0 58.0 59.0 60.0
Net Unit Weight (lbs.) 430 507 507 639
Shipping Weight (lbs.) 452 534 534 666
Communication Cables4,5 2 x 18 2 x 18 2 x 18 2 x 18
Heat Exchanger
Material and Fin Coating Copper Tube / Aluminum Fin and Black Fin™ II Coated / Hydrophilic
Rows / Fins per inch 2 / 17 2 / 17 2 / 17 3 / 17
Piping for Heat Recovery Operation6
Liquid Line Connection (in., OD) 3/8 Braze 3/8 Braze 1/2 Braze 1/2 Braze
Low Pressure Vapor Line Connection (in., OD) 3/4 Braze 7/8 Braze 1-1/8 Braze 1-1/8 Braze
High Pressure Vapor Line Connection (in., OD) 5/8 Braze 3/4 Braze 3/4 Braze 7/8 Braze
Piping for Heat Pump Operation6
Liquid Line Connection (in., OD) 3/8 Braze 3/8 Braze 1/2 Braze 1/2 Braze
Vapor Line Connection (in., OD) 3/4 Braze 7/8 Braze 1-1/8 Braze 1-1/8 Braze
1
5DWHGFDSDFLW\LVFHUWL¿HGXQGHU$+5,6WDQGDUG5DWLQJVDUHVXEMHFWWRFKDQJH IDUs / HRUs communication cable at any other point. Wiring must comply with all applica-
ZLWKRXWQRWLFH&XUUHQWFHUWL¿HGUDWLQJVDUHDYDLODEOHDWZZZDKULGLUHFWRU\RUJ ble local and national codes.
2
The System Combination Ratio must be between 50–130%. 5
3RZHUZLULQJLV¿HOGSURYLGHGVROLGRUVWUDQGHGDQGPXVWFRPSO\ZLWKWKHDSSOLFDEOH
3
Sound pressure levels are tested in an anechoic chamber under ISO Standard 3745. local and national codes. See page 19 for detailed electrical data.
4
Communication cable between Main ODU to Sub ODU(s), and Main ODU to IDUs / HRUs
6
LG requires that LATS software be used on all projects to ensure correct line sizing.
to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the communication cable Designer must verify the shop drawing design against the as built design using LATS.
shield is properly grounded to the Main ODU chassis only. Do not ground the ODU to Contractor must also use LG manufactured Y-Branch and Header Kits only.
Due to our policy of continuous product innovation, some specifications may change without notification. 9
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
208 / 230V Outdoor Units
1
5DWHGFDSDFLW\LVFHUWL¿HGXQGHU$+5,6WDQGDUG5DWLQJVDUHVXEMHFWWRFKDQJH IDUs / HRUs communication cable at any other point. Wiring must comply with all applica-
ZLWKRXWQRWLFH&XUUHQWFHUWL¿HGUDWLQJVDUHDYDLODEOHDWZZZDKULGLUHFWRU\RUJ ble local and national codes.
2
The System Combination Ratio must be between 50–130%. 5
3RZHUZLULQJLV¿HOGSURYLGHGVROLGRUVWUDQGHGDQGPXVWFRPSO\ZLWKWKHDSSOLFDEOH
3
Sound pressure levels are tested in an anechoic chamber under ISO Standard 3745. local and national codes. See page 19 for detailed electrical data.
4
Communication cable between Main ODU to Sub ODU(s), and Main ODU to IDUs / HRUs
6
LG requires that LATS software be used on all projects to ensure correct line sizing.
to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the communication cable Designer must verify the shop drawing design against the as built design using LATS.
shield is properly grounded to the Main ODU chassis only. Do not ground the ODU to Contractor must also use LG manufactured Y-Branch and Header Kits only.
Due to our policy of continuous product innovation, some specifications may change without notification.
10
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
208-230V Outdoor Units
Product Data
Type Propeller (BLDC) Propeller (BLDC) Propeller (BLDC) Propeller (BLDC)
Motor Output (kW) x Qty. 0.90 x 2 + 0.90 x 2 0.90 x 2 + 0.90 x 2 0.90 x 2 + 0.90 x 2 0.90 x 2 + 0.90 x 2
Motor/Drive Brushless Digitally Controlled / Direct
Cooling 0 - 1,150 0 - 1,150 0 - 1,150 0 - 1,150
Operating Range (RPM)
Heating 80 - 1,150 80 - 1,150 80 - 1,150 80 - 1,150
Maximum Air Volume (CFM) 22,600 22,600 22,600 22,600
ESP (in. w.g., Selectable Range) 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32
Unit Data
Refrigerant Type R410A R410A R410A R410A
Refrigerant Control/Location EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit
Factory Charge lbs. of R410A 23.2 + 26.5 23.2 + 30.9 23.2 + 37.5 23.2 + 37.5
Max. No. Indoor Units/System2 42 45 52 55
Sound Pressure dB(A)3 63.0 63.0 65.0 65.0
Net Unit Weight (lbs.) 507 + 639 507 + 659 507 + 666 507 + 666
Shipping Weight (lbs.) 534 + 666 534 + 688 534 + 694 534 + 694
Communication Cables4,5 2 x 18 2 x 18 2 x 18 2 x 18
Heat Exchanger
Material and Fin Coating Copper Tube / Aluminum Fin and Black Fin™ II Coated / Hydrophilic
Rows / Fins per inch 2 / 17 + 3 / 17 2 / 17 + 3 / 17 2 / 17 + 3 / 17 2 / 17 + 3 / 17
Piping for Heat Recovery Operation6
Liquid Line Connection (in., OD) 3/8 & 5/8 Braze 3/8 & 5/8 Braze 3/8 & 5/8 Braze 1/2 & 5/8 Braze
Low Pressure Vapor Line Connection (in., OD) 7/8 & 1-1/8 Braze 7/8 & 1-1/8 Braze 7/8 & 1-1/8 Braze 1-1/8 & 1-1/8 Braze
High Pressure Vapor Line Connection (in., OD) 3/4 & 7/8 Braze 3/4 & 1-1/8 Braze 3/4 & 1-1/8 Braze 3/4 & 1-1/8 Braze
Piping for Heat Pump Operation6
Liquid Line Connection (in., OD) 3/8 & 5/8 Braze 3/8 & 5/8 Braze 3/8 & 5/8 Braze 1/2 & 5/8 Braze
Vapor Line Connection (in., OD) 7/8 & 1-1/8 Braze 7/8 & 1-1/8 Braze 7/8 & 1-1/8 Braze 1-1/8 & 1-1/8 Braze
1
5DWHGFDSDFLW\LVFHUWL¿HGXQGHU$+5,6WDQGDUG5DWLQJVDUHVXEMHFWWRFKDQJH IDUs / HRUs communication cable at any other point. Wiring must comply with all applica-
ZLWKRXWQRWLFH&XUUHQWFHUWL¿HGUDWLQJVDUHDYDLODEOHDWZZZDKULGLUHFWRU\RUJ ble local and national codes.
2
The System Combination Ratio must be between 50–130%. 5
3RZHUZLULQJLV¿HOGSURYLGHGVROLGRUVWUDQGHGDQGPXVWFRPSO\ZLWKWKHDSSOLFDEOH
3
Sound pressure levels are tested in an anechoic chamber under ISO Standard 3745. local and national codes. See page 19 for detailed electrical data.
4
Communication cable between Main ODU to Sub ODU(s), and Main ODU to IDUs / HRUs
6
LG requires that LATS software be used on all projects to ensure correct line sizing.
to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the communication cable Designer must verify the shop drawing design against the as built design using LATS.
shield is properly grounded to the Main ODU chassis only. Do not ground the ODU to Contractor must also use LG manufactured Y-Branch and Header Kits only.
Due to our policy of continuous product innovation, some specifications may change without notification. 11
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
208-230V Outdoor Units
Due to our policy of continuous product innovation, some specifications may change without notification.
12
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
208-230V Outdoor Unit
Product Data
Type Propeller (BLDC) Propeller (BLDC) Propeller (BLDC) Propeller (BLDC)
Motor Output (kW) x Qty. 0.90x2 + 0.90x2 + 0.90x2 0.90x2 + 0.90x2 + 0.90x2 0.90x2 + 0.90x2 + 0.90x2 0.90x2 + 0.90x2 + 0.90x2
Motor/Drive Brushless Digitally Controlled / Direct
Cooling 0 - 1,150 0 - 1,150 0 - 1,150 0 - 1,150
Operating Range (RPM)
Heating 80 - 1,150 80 - 1,150 80 - 1,150 80 - 1,150
Maximum Air Volume (CFM) 33,900 33,900 33,900 33,900
ESP (in. w.g., Selectable Range) 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32
Unit Data
Refrigerant Type R410A R410A R410A R410A
Refrigerant Control/Location EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit
Factory Charge lbs. of R410A 23.2 + 23.2 + 30.9 23.2 + 23.2 + 37.5 23.2 + 26.5 + 37.5 23.2 + 26.5 + 37.5
Max. No. Indoor Units/System2 64 64 64 64
Sound Pressure dB(A)3 66.0 66.0 67.0 67.0
Net Unit Weight (lbs.) 507 + 507 + 659 507 + 507 + 666 507 + 639 + 666 507 + 639 + 666
Shipping Weight (lbs.) 534 + 534 + 688 534 + 534 + 694 534 + 666 + 694 534 + 666 + 694
Communication Cables4,5 2 x 18 2 x 18 2 x 18 2 x 18
Heat Exchanger
Material and Fin Coating Copper Tube / Aluminum Fin and Black Fin™ II Coated / Hydrophilic
Rows / Fins per inch 2/17 x 2 + 3/17 2 / 17 x 2 + 3 / 17 2 / 17 + 3 / 17 x 2 2 / 17 + 3 / 17 x 2
Piping for Heat Recovery Operation6
Liquid Line Connection (in., OD) 1/2 & 1/2 & 5/8 Braze 1/2 & 1/2 & 5/8 Braze 1/2 & 1/2 & 5/8 Braze 1/2 & 5/8 & 5/8 Braze
Low Pressure Vapor Line Conn. (in., OD) 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze
High Pressure Vapor Line Conn. (in., OD) 3/4 & 3/4 & 1-1/8 Braze 3/4 & 3/4 & 1-1/8 Braze 3/4 & 7/8 & 1-1/8 Braze 3/4 & 7/8 & 1-1/8 Braze
Piping for Heat Pump Operation6
Liquid Line Connection (in., OD) 1/2 + 1/2 + 5/8 Braze 1/2 & 1/2 & 5/8 Braze 1/2 & 1/2 & 5/8 Braze 1/2 & 5/8 & 5/8 Braze
Vapor Line Connection (in., OD) 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze
1
5DWHGFDSDFLW\LVFHUWL¿HGXQGHU$+5,6WDQGDUG5DWLQJVDUHVXEMHFWWRFKDQJH IDUs / HRUs communication cable at any other point. Wiring must comply with all applica-
ZLWKRXWQRWLFH&XUUHQWFHUWL¿HGUDWLQJVDUHDYDLODEOHDWZZZDKULGLUHFWRU\RUJ ble local and national codes.
2
The System Combination Ratio must be between 50–130%. 5
3RZHUZLULQJLV¿HOGSURYLGHGVROLGRUVWUDQGHGDQGPXVWFRPSO\ZLWKWKHDSSOLFDEOH
3
Sound pressure levels are tested in an anechoic chamber under ISO Standard 3745. local and national codes. See page 19 for detailed electrical data.
4
Communication cable between Main ODU to Sub ODU(s), and Main ODU to IDUs / HRUs
6
LG requires that LATS software be used on all projects to ensure correct line sizing.
to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the communication cable Designer must verify the shop drawing design against the as built design using LATS.
shield is properly grounded to the Main ODU chassis only. Do not ground the ODU to Contractor must also use LG manufactured Y-Branch and Header Kits only.
Due to our policy of continuous product innovation, some specifications may change without notification. 13
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
460V Outdoor Units
1
5DWHGFDSDFLW\LVFHUWL¿HGXQGHU$+5,6WDQGDUG5DWLQJVDUHVXEMHFWWRFKDQJH IDUs / HRUs communication cable at any other point. Wiring must comply with all applica-
ZLWKRXWQRWLFH&XUUHQWFHUWL¿HGUDWLQJVDUHDYDLODEOHDWZZZDKULGLUHFWRU\RUJ ble local and national codes.
2
The System Combination Ratio must be between 50–130%. 5
3RZHUZLULQJLV¿HOGSURYLGHGVROLGRUVWUDQGHGDQGPXVWFRPSO\ZLWKWKHDSSOLFDEOH
3
Sound pressure levels are tested in an anechoic chamber under ISO Standard 3745. local and national codes. See page 20 for detailed electrical data.
4
Communication cable between Main ODU to Sub ODU(s), and Main ODU to IDUs / HRUs
6
LG requires that LATS software be used on all projects to ensure correct line sizing.
to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the communication cable Designer must verify the shop drawing design against the as built design using LATS.
shield is properly grounded to the Main ODU chassis only. Do not ground the ODU to Contractor must also use LG manufactured Y-Branch and Header Kits only.
Due to our policy of continuous product innovation, some specifications may change without notification.
14
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
460V Outdoor Units
Product Data
Motor Output (kW) x Qty. 0.9 x 2 0.9 x 2 0.9 x 2 0.9 x 2
Motor/Drive Brushless Digitally Controlled / Direct
Cooling 0 - 1,150 0 - 1,150 0 - 1,150 0 - 1,150
Operating Range (RPM)
Heating 80 - 1,150 80 - 1,150 80 - 1,150 80 - 1,150
Maximum Air Volume (CFM) 11,300 11,300 11,300 11,300
ESP (in. w.g., Selectable Range) 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32
Unit Data
Refrigerant Type R410A R410A R410A R410A
Refrigerant Control/Location EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit
Factory Charge lbs. of R410A 26.5 30.9 37.5 37.5
Max. No. Indoor Units/System2 29 32 35 39
Sound Pressure dB(A)3 61.0 62.0 64.0 65.0
Net Unit Weight (lbs.) 639 659 666 666
Shipping Weight (lbs.) 666 688 694 694
Communication Cables4,5 2 x 18 2 x 18 2 x 18 2 x 18
Heat Exchanger
Material and Fin Coating Copper Tube / Aluminum Fin and Black Fin™ II Coated / Hydrophilic
Rows / Fins per inch 3 / 17 3 / 17 3 / 17 3 / 17
Piping for Heat Recovery Operation6
Liquid Line Connection (in., OD) 5/8 Braze 5/8 Braze 5/8 Braze 5/8 Braze
Low Pressure Vapor Line Connection (in., OD) 1-1/8 Braze 1-1/8 Braze 1-1/8 Braze 1-3/8 Braze
High Pressure Vapor Line Connection (in., OD) 7/8 Braze 1-1/8 Braze 1-1/8 Braze 1-1/8 Braze
Piping for Heat Pump Operation6
Liquid Line Connection (in., OD) 5/8 Braze 5/8 Braze 5/8 Braze 5/8 Braze
Vapor Line Connection (in., OD) 1-1/8 Braze 1-1/8 Braze 1-1/8 Braze 1-3/8 Braze
1
5DWHGFDSDFLW\LVFHUWL¿HGXQGHU$+5,6WDQGDUG5DWLQJVDUHVXEMHFWWRFKDQJH IDUs / HRUs communication cable at any other point. Wiring must comply with all applica-
ZLWKRXWQRWLFH&XUUHQWFHUWL¿HGUDWLQJVDUHDYDLODEOHDWZZZDKULGLUHFWRU\RUJ ble local and national codes.
2
The System Combination Ratio must be between 50–130%. 5
3RZHUZLULQJLV¿HOGSURYLGHGVROLGRUVWUDQGHGDQGPXVWFRPSO\ZLWKWKHDSSOLFDEOH
3
Sound pressure levels are tested in an anechoic chamber under ISO Standard 3745. local and national codes. See page 20 for detailed electrical data.
4
Communication cable between Main ODU to Sub ODU(s), and Main ODU to IDUs / HRUs
6
LG requires that LATS software be used on all projects to ensure correct line sizing.
to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the communication cable Designer must verify the shop drawing design against the as built design using LATS.
shield is properly grounded to the Main ODU chassis only. Do not ground the ODU to Contractor must also use LG manufactured Y-Branch and Header Kits only.
Due to our policy of continuous product innovation, some specifications may change without notification. 15
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
460V Outdoor Units
Due to our policy of continuous product innovation, some specifications may change without notification.
16
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
460V Outdoor Units
Product Data
Type Propeller (BLDC) Propeller (BLDC) Propeller (BLDC)
Motor Output (kW) x Qty. 0.90 x 2 + 0.90 x 2 0.90 x 2 + 0.90 x 2 0.90 x 2 + 0.90 x 2
Motor/Drive Brushless Digitally Controlled / Direct
Cooling 0 - 1,150 0 - 1,150 0 - 1,150
Operating Range (RPM)
Heating 80 - 1,150 80 - 1,150 80 - 1,150
Maximum Air Volume (CFM) 22,600 22,600 22,600
ESP (in. w.g., Selectable Range) 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32
Unit Data
Refrigerant Type R410A R410A R410A
Refrigerant Control/Location EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit
Factory Charge lbs. of R410A 26.5 + 37.5 26.5 + 37.5 30.9 + 37.5
Max. No. Indoor Units/System2 58 61 64
Sound Pressure dB(A)3 66.0 66.0 66.0
Net Unit Weight (lbs.) 639 + 666 639 + 666 659 + 666
Shipping Weight (lbs.) 666 + 694 666 + 694 688 + 694
Communication Cables4,5 2 x 18 2 x 18 2 x 18
Heat Exchanger
Material and Fin Coating Copper Tube / Aluminum Fin and Black Fin™ II Coated / Hydrophilic
Rows / Fins per inch 3 / 17 x 2 3 / 17 x 2 3 / 17 x 2
Piping for Heat Recovery Operation6
Liquid Line Connection (in., OD) 1/2 & 5/8 Braze 5/8 & 5/8 Braze 5/8 & 5/8 Braze
Low Pressure Vapor Line Connection (in., OD) 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 Braze
High Pressure Vapor Line Connection (in., OD) 7/8 & 1-1/8 Braze 7/8 & 1-1/8 Braze 1-1/8 & 1-1/8 Braze
Piping for Heat Pump Operation6
Liquid Line Connection (in., OD) 1/2 & 5/8 Braze 5/8 & 5/8 Braze 5/8 & 5/8 Braze
Vapor Line Connection (in., OD) 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 Braze
1
5DWHGFDSDFLW\LVFHUWL¿HGXQGHU$+5,6WDQGDUG5DWLQJVDUHVXEMHFWWRFKDQJH IDUs / HRUs communication cable at any other point. Wiring must comply with all applica-
ZLWKRXWQRWLFH&XUUHQWFHUWL¿HGUDWLQJVDUHDYDLODEOHDWZZZDKULGLUHFWRU\RUJ ble local and national codes.
2
The System Combination Ratio must be between 50–130%. 5
3RZHUZLULQJLV¿HOGSURYLGHGVROLGRUVWUDQGHGDQGPXVWFRPSO\ZLWKWKHDSSOLFDEOH
3
Sound pressure levels are tested in an anechoic chamber under ISO Standard 3745. local and national codes. See page 20 for detailed electrical data.
4
Communication cable between Main ODU to Sub ODU(s), and Main ODU to IDUs / HRUs
6
LG requires that LATS software be used on all projects to ensure correct line sizing.
to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the communication cable Designer must verify the shop drawing design against the as built design using LATS.
shield is properly grounded to the Main ODU chassis only. Do not ground the ODU to Contractor must also use LG manufactured Y-Branch and Header Kits only.
Due to our policy of continuous product innovation, some specifications may change without notification. 17
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SPECIFICATIONS
WITH
460V Outdoor Units
Heating Performance
Nominal Heating Capacity (Btu/h)1 486,000 513,000 540,000 567,000
Rated Heating Capacity (Btu/h)1 460,000 484,000 510,000 534,000
Operating Range
Cooling (°F DB) 5 to 122 5 to 122 5 to 122 5 to 122
Heating (°F WB) -22 to +61 -22 to +61 -22 to +61 -22 to +61
Synchronous — Cooling Based (°F DB) 14 to 81 14 to 81 14 to 81 14 to 81
Synchronous — Heating Based (°F WB) 14 to 61 14 to 61 14 to 61 14 to 61
Compressor
Inverter Quantity HSS DC Scroll x 4 HSS DC Scroll x 4 HSS DC Scroll x 5 HSS DC Scroll x 5
Oil/Type PVE / FVC68D PVE / FVC68D PVE / FVC68D PVE / FVC68D
Fan (Top Discharge)
Type Propeller (BLDC) Propeller (BLDC) Propeller (BLDC) Propeller (BLDC)
Motor Output (kW) x Qty. 0.90x2 + 0.90x2 + 0.90x2 0.90x2 + 0.90x2 + 0.90x2 0.90x2 + 0.90x2 + 0.90x2 0.90x2 + 0.90x2 + 0.90x2
Motor/Drive Brushless Digitally Controlled / Direct
Cooling 0 - 1,150 0 - 1,150 0 - 1,150 0 - 1,150
Operating Range (RPM)
Heating 80 - 1,150 80 - 1,150 80 - 1,150 80 - 1,150
Maximum Air Volume (CFM) 33,900 33,900 33,900 33,900
ESP (in. w.g., Selectable Range) 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32 0.16 ~ 0.32
Unit Data
Refrigerant Type R410A R410A R410A R410A
Refrigerant Control/Location EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit EEV / Indoor Unit
Factory Charge lbs. of R410A 23.2 + 23.2 + 30.9 23.2 + 23.2 + 37.5 23.2 + 26.5 + 37.5 23.2 + 26.5 + 37.5
Max. No. Indoor Units/System2 64 64 64 64
Sound Pressure dB(A)3 66.0 66.0 67.0 67.0
Net Unit Weight (lbs.) 507 + 507 + 659 507 + 507 + 666 507 + 639 + 666 507 + 639 + 666
Shipping Weight (lbs.) 534 + 534 + 688 534 + 534 + 694 534 + 666 + 694 534 + 666 + 694
Communication Cables4,5 2 x 18 2 x 18 2 x 18 2 x 18
Heat Exchanger
Material and Fin Coating Copper Tube / Aluminum Fin and Black Fin™ II Coated / Hydrophilic
Rows / Fins per inch 2/17 x 2 + 3/17 2 / 17 x 2 + 3 / 17 2 / 17 + 3 / 17 x 2 2 / 17 + 3 / 17 x 2
Piping for Heat Recovery Operation6
Liquid Line Connection (in., OD) 1/2 & 1/2 & 5/8 Braze 1/2 & 1/2 & 5/8 Braze 1/2 & 1/2 & 5/8 Braze 1/2 & 5/8 & 5/8 Braze
Low Pressure Vapor Line Conn. (in., OD) 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze
High Pressure Vapor Line Conn. (in., OD) 3/4 & 3/4 & 1-1/8 Braze 3/4 & 3/4 & 1-1/8 Braze 3/4 & 7/8 & 1-1/8 Braze 3/4 & 7/8 & 1-1/8 Braze
Piping for Heat Pump Operation6
Liquid Line Connection (in., OD) 1/2 & 1/2 & 5/8 Braze 1/2 & 1/2 & 5/8 Braze 1/2 & 1/2 & 5/8 Braze 1/2 & 5/8 & 5/8 Braze
Vapor Line Connection (in., OD) 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze 1-1/8 & 1-1/8 & 1-1/8 Braze
1
5DWHGFDSDFLW\LVFHUWL¿HGXQGHU$+5,6WDQGDUG5DWLQJVDUHVXEMHFWWRFKDQJH IDUs / HRUs communication cable at any other point. Wiring must comply with all applica-
ZLWKRXWQRWLFH&XUUHQWFHUWL¿HGUDWLQJVDUHDYDLODEOHDWZZZDKULGLUHFWRU\RUJ ble local and national codes.
2
The System Combination Ratio must be between 50–130%. 5
3RZHUZLULQJLV¿HOGSURYLGHGVROLGRUVWUDQGHGDQGPXVWFRPSO\ZLWKWKHDSSOLFDEOH
3
Sound pressure levels are tested in an anechoic chamber under ISO Standard 3745. local and national codes. See page 20 for detailed electrical data.
4
Communication cable between Main ODU to Sub ODU(s), and Main ODU to IDUs / HRUs
6
LG requires that LATS software be used on all projects to ensure correct line sizing.
to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the communication cable Designer must verify the shop drawing design against the as built design using LATS.
shield is properly grounded to the Main ODU chassis only. Do not ground the ODU to Contractor must also use LG manufactured Y-Branch and Header Kits only.
Due to our policy of continuous product innovation, some specifications may change without notification.
18
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL DATA
WITH
208-230V Outdoor Unit Electrical Data
Product Data
22.0 ARUM264BTE5 3 21.2 19.1 16.4 - - - 4 8.0 8.0 - 53.6 28.5 - 70 40 - 70 40 -
24.0 ARUM288BTE5 3 23.3 20.8 16.4 - - - 4 8.0 8.0 - 57.9 28.5 - 80 40 - 80 40 -
26.0 ARUM312BTE5 3 24.3 21.9 16.4 - - - 4 8.0 8.0 - 60.3 28.5 - 80 40 - 80 40 -
28.0 ARUM336BTE5 3 24.3 21.9 18.3 - - - 4 8.0 8.0 - 60.3 30.9 - 80 40 - 80 40 -
30.0 ARUM360BTE5 4 24.3 21.9 19.8 18.3 - - 4 8.0 8.0 - 60.3 51.1 - 80 70 - 80 70 -
32.0 ARUM384BTE5 4 24.3 21.9 21.2 19.1 - - 4 8.0 8.0 - 60.3 53.6 - 80 70 - 80 70 -
34.0 ARUM408BTE5 4 24.3 21.9 23.3 20.8 - - 4 8.0 8.0 - 60.3 57.9 - 80 80 - 80 80 -
36.0 ARUM432BTE5 4 23.3 20.8 18.3 - 18.3 - 6 8.0 8.0 8.0 57.9 30.9 30.9 80 40 40 80 40 40
38.0 ARUM456BTE5 4 24.3 21.9 18.3 - 18.3 - 6 8.0 8.0 8.0 60.3 30.9 30.9 80 40 40 80 40 40
40.0 ARUM480BTE5 5 24.3 21.9 19.8 18.3 18.3 - 6 8.0 8.0 8.0 60.3 51.1 30.9 80 70 40 80 70 40
42.0 ARUM504BTE5 5 24.3 21.9 21.2 19.1 18.3 - 6 8.0 8.0 8.0 60.3 53.6 30.9 80 70 40 80 70 40
)RUFRPSRQHQWPRGHOQRVVHHWKHVSHFL¿FDWLRQWDEOHVRQS Maximum Overcurrent Protection (MOCP) is calculated as follows: (Largest motor FLA x
Voltage tolerance is 187V to 253V. 2.25) + (Sum of other motor FLA) rounded down to the nearest standard fuse size. RFA =
Recommended Fuse Amps.
Maximum allowable voltage inbalance is 2%.
*SCCR rating: 56 kA RMS symmetrical 208V maximum / 62 kA RMS symmetrical 230V
MCA = Minimum Circuit Ampacity.
maximum.
Due to our policy of continuous product innovation, some specifications may change without notification. 19
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL DATA
WITH
460V Outdoor Unit Electrical Data
Due to our policy of continuous product innovation, some specifications may change without notification.
20
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
HEAT RECOVERY UNIT
WITH
SPECIFICATIONS
Figure 1: Two-Port Heat Recovery Unit. Figure 2: Three-Port Heat Recovery Unit. Figure 3: Four-Port Heat Recovery Unit.
Heat recovery units can only be used with LG systems piped for heat recovery operation.
Product Data
Number of Ports 2 3 4
Max. Connectible No. of Indoor Units 16 24 32
Max. Connectible No. of Indoor Units on each port 8 8 8
Max. Port Capacity (each port) Btu/h 60,000 60,000 60,000
Max. Unit Capacity (sum of ports) Btu/h 120,000 180,000 230,000
Net Weight lbs. 33 37 40
Shipping Weight lbs. 46 50 53
Dimensions (W x H x D) Inches 19-1/8 x 8-5/8 x 18-15/16
Casing Galvanized Steel Plate
Liquid Pipe (inches) 3/8 3/8 3/8
To Indoor Units
Vapor Pipe (inches) 5/8 5/8 5/8
Connecting Pipes Liquid (inches) 3/8 1/2 5/8
To Outdoor Units Low-pressure Vapor (inches) 7/8 1-1/8 1-1/8
High-pressure Vapor (inches) 3/4 7/8 7/8
Insulation Material Polyethylene Foam
Due to our policy of continuous product innovation, some specifications may change without notification. 21
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
HEAT RECOVERY UNIT
WITH
SPECIFICATIONS
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Figure 4: Six-Port Heat Recovery Unit. Figure 5: Eight-Port Heat Recovery Unit.
Heat recovery units can only be used with LG systems piped for heat recovery operation.
Due to our policy of continuous product innovation, some specifications may change without notification.
22
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
HEAT RECOVERY UNIT
WITH
ELECTRICAL DATA
Product Data
Due to our policy of continuous product innovation, some specifications may change without notification. 23
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
OUTDOOR UNIT DIMENSIONS
WITH
ARUM072BTE5 / DTE5
MULTI V 5 with LGRED Outdoor Unit Installation Manual
L9 6 – 1/2
L11
L12
L9
L10 5 – 9/16
L10 L11 8 – 5/8
7/8” Diameter Leak Test Hole L13
L12 6 – 7/16
Left Side View L14
L15 Right Side View L13 24 – 5/8
L14 26 – 7/16
M5 29 – 3/16
L15
M6
M7
M8 Two (2) 7/8” Diameter Wire
M9
Routing Holes (Bottom) M5 13 – 1/8”
M10 M6 12 – 5/16”
M11
M7 11 – 3/4”
M15
M14
M13
M12
M8 9 – 11/16”
Power Cord Routing Hole
M9 9 – 5/16”
(Bottom); two (2) - ø2” M10 7 – 5/16”
Piping Routing Holes (Bottom);
two - ø2-5/8”, ø2-1/8”
M11 6 – 3/16”
M12 6 – 13/16”
M13 4 – 1/2”
M14 3 – 11/16”
M15 3”
Due to our policy of continuous product innovation, some specifications may change without notification.
24
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
OUTDOOR UNIT DIMENSIONS
WITH
ARUM096BTE5 / DTE5, 121BTE5 / DTE5, 144BTE5 / DTE5,
168BTE5 / DTE5, 192BTE5 / DTE5, 216BTE5 / DTE5, 241BTE5 / DTE5
W
Airflow
Note: Please refer to multi-frame
placement information and piping
Airflow
H
rules in the Multi V 5 Engineering
Top View
Manual and the Multi V 5 Installation
D
Airflow
D
Product Data
L9
L13
L11
L12
L10
L14
M8 8 – 7/16”
M9 8 – 1/8”
M16
Due to our policy of continuous product innovation, some specifications may change without notification. 25
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
OUTDOOR UNIT DIMENSIONS
WITH
ARUM264BTE5 / DTE5, 288BTE5 / DTE5, 312BTE5 / DTE5,
336BTE5 / DTE5, 360BTE5 / DTE5, 384BTE5 / DTE5, 408BTE5 / DTE5
D
MULTI V 5 with LGRED Outdoor Unit Installation Manual
W W
97-5/8 (min)
Note: Please refer to multi-frame placement information and piping rules in the Multi V 5 Engineering
Manual and the Multi V 5 Installation Manual. Minimum spacing between frames is 1 inch.
D
L9
L13
L11
L12
L10
L14
M8 8 – 7/16”
W
Airflow
Airflow
M9 8 – 1/8”
M16
Due to our policy of continuous product innovation, some specifications may change without notification.
26
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
OUTDOOR UNIT DIMENSIONS
WITH
ARUM432BTE5 / DTE5, 456BTE5 / DTE5,
480BTE5 / DTE5, 504BTE5 / DTE5
W W W
146-7/16 (min)
Note: Please refer to multi-frame placement information and piping rules in the Multi V 5 Engineering
Manual and the Multi V 5 Installation Manual. Minimum spacing between frames is 1 inch.
D
Product Data
L9
L13
L11
L12
L10
L14
M8 8 – 7/16”
W
Airflow
Airflow
M9 8 – 1/8”
M16
Due to our policy of continuous product innovation, some specifications may change without notification. 27
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
HEAT RECOVERY UNIT DIMENSIONS
WITH
PRHR023A
D L2
M1 M2
L1
MULTI V 5 with LGRED Outdoor Unit Installation Manual
W M4
Strainers are factory installed on the indoor unit vapor piping.
L4
L11
L9 L12 4 5 L6
M3
L10
H
1
L5 2
L3 3 L7
L8 [Unit: inch]
Note:
1. Unit should be installed in compliance with the appropriate 6 Control box
LG installation manual. 5 Liquid pipe to Indoor unit
2. Unit should be grounded in accordance with the local 4 Vapor pipe to Indoor unit
regulations or applicable national codes. 3 Low pressure vapor pipe
3. All electrical components and materials supplied 2 Liquid pipe to Outdoor unit
from the site must comply with the local regulations or 1 High pressure vapor pipe
No. Part Name
national codes.
Due to our policy of continuous product innovation, some specifications may change without notification.
28
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
HEAT RECOVERY UNIT DIMENSIONS
WITH
PRHR033A
D L2
M1 M2
L1
W M4
– Connect the strainer that is provided as an accessory to the HRU high
pressure vapor pipe.
– Strainers are factory installed on the indoor unit vapor piping.
High pressure
vapor pipe
L4 Strainer
Product Data
Liquid pipe
Low pressure
vapor pipe
L8
L11
L9 L12 4 5 L6
L8
M3
[Unit: inch]
L10 1
H
L5
2
L3 3 L7 L8
L8
Note:
1. Unit should be installed in compliance with the appropriate 6 Control box
LG installation manual. 5 Liquid pipe to Indoor unit
2. Unit should be grounded in accordance with the local 4 Vapor pipe to Indoor unit
regulations or applicable national codes. 3 Low pressure vapor pipe
3. All electrical components and materials supplied 2 Liquid pipe to Outdoor unit
from the site must comply with the local regulations or 1 High pressure vapor pipe
Due to our policy of continuous product innovation, some specifications may change without notification. 29
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
HEAT RECOVERY UNIT DIMENSIONS
WITH
PRHR043A
D L2
M1 M2
L1
MULTI V 5 with LGRED Outdoor Unit Installation Manual
W M4
– Connect the strainer that is provided as an accessory to the HRU high
pressure vapor pipe.
– Strainers are factory installed on the indoor unit vapor piping.
High pressure
vapor pipe
L4 Strainer
Liquid pipe
Low pressure
vapor pipe
L8
L11
L9 L12 4 5 L6
L8
M3 L8
[Unit: inch]
L10 1
H
L5
2
L8
L3 3 L7 L8
L8
Note:
1. Unit should be installed in compliance with the appropriate
LG installation manual. 6 Control box
5 Liquid pipe to Indoor unit
2. Unit should be grounded in accordance with the local
4 Vapor pipe to Indoor unit
regulations or applicable national codes.
3 Low pressure vapor pipe
3. All electrical components and materials supplied 2 Liquid pipe to Outdoor unit
from the site must comply with the local regulations or 1 High pressure vapor pipe
national codes. No. Part Name
Due to our policy of continuous product innovation, some specifications may change without notification.
30
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
HEAT RECOVERY UNIT DIMENSIONS
WITH
PRHR063A
D L2
M1 M2
L1
W M4
Strainer
L4
Liquid pipe
Product Data
Low pressure
vapor pipe
L8
L8
L8
L8
L8
4 5 L6 [Unit: inch]
L11 L9 L12 M3
L10 L5
H 1
2
L3 3 L7
L8
Note: L8
L8
L8
L8
1. Unit should be installed in compliance with the appropriate 6 Control box
LG installation manual. 5 Liquid pipe to Indoor unit
2. Unit should be grounded in accordance with the local 4 Vapor pipe to Indoor unit
regulations or applicable national codes. 3 Low pressure vapor pipe
3. All electrical components and materials supplied 2 Liquid pipe to Outdoor unit
from the site must comply with the local regulations or 1 High pressure vapor pipe
national codes. No. Part Name
Due to our policy of continuous product innovation, some specifications may change without notification. 31
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
HEAT RECOVERY UNIT DIMENSIONS
WITH
PRHR083A
D L2
M1 M2
L1
MULTI V 5 with LGRED Outdoor Unit Installation Manual
W M4
– Connect the strainer that is provided as an accessory to the HRU high
pressure vapor pipe.
– Strainers are factory installed on the indoor unit vapor piping.
High pressure
vapor pipe
Strainer
L4 Liquid pipe
Low pressure
vapor pipe
L8
L8
L8
L8
L8
L8
L8
4 5 L6 [Unit: inch]
L11 L9 L12 M3
L10 L5
H 1
2
L3 3 L7
L8
Note: L8
L8
L8
1. Unit should be installed in compliance with the appropriate L8
L8 6 Control box
LG installation manual. L8
5 Liquid pipe to Indoor unit
2. Unit should be grounded in accordance with the local 4 Vapor pipe to Indoor unit
regulations or applicable national codes. 3 Low pressure vapor pipe
3. All electrical components and materials supplied 2 Liquid pipe to Outdoor unit
from the site must comply with the local regulations or 1 High pressure vapor pipe
national codes. No. Part Name
Due to our policy of continuous product innovation, some specifications may change without notification.
32
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
75$163257,1*/,)7,1*
WITH
• When lifting the unit, use lifting straps and place around the unit as
A
shown.
• Always lift the unit using properly sized lifting straps rated to carry
the unit weight.
• Ensure the straps are long enough to maintain a maximum of a
40° angle as shown at “A”. Access holes for transportation ropes
A: 40°
Table 16: Multi V 5 Shipping and Net Weights.
Capacity (ton) Shipping Weight (lbs.) Net Weight (lbs.)
6 452 430
8 534 507 Access Hole for Forklift
10 534 507
12 666 639
14 666 639
Installation
16 688 659
18 694 666
20 694 666
WARNING
• Use appropriate moving equipment to transport each frame; ensure the equipment is capable of supporting the weights listed above. If the
equipment is not properly secured, it will result in an accident that causes physical injury or death.
• Wear protective gloves when handling equipment. Sharp edges will cause personal injury.
• Some products include polypropylene bands around the unit for packaging. Do not use polypropylene bands to lift the unit. There is a
risk of the product falling and causing physical injury.
• Tear apart and throw away plastic packaging bags so that children will not play with them and risk suffocation and death.
• Consider the unit’s center of gravity is before lifting. Hoist the unit with the center of gravity centered among the lifting straps. There is a risk
of the product falling and causing physical injury.
• Lift the outdoor unit from the base at specified locations. Support the outdoor unit at a minimum of six (6) points to avoid slippage from the
rigging apparatus, and use a minimum of three (3) lifting straps. There is a risk of the product falling and causing physical injury.
• Use caution when using forklift to transport an unpackaged unit. Do not drop the unit when carrying it with a forklift. There is a risk of the
product falling and causing physical injury.
NOTE
Place a protective cloth or other soft material at the locations where the casing comes in contact with the lifting straps to prevent damage to painted
surfaces.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 33
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Selecting the Best Location for the Outdoor Unit(s)
sidewalks or driveways, which will create unsafe conditions. Properly install and insulate any drain hoses to prevent the hose from freezing,
cracking, leaking, and causing unsafe conditions from frozen condensate.
Install a fence to prevent vermin from crawling into the unit or unauthorized individuals from accessing it. Follow the placement guidelines set forth in
“Clearance Requirements”.
Select a location for installing the outdoor unit that will meet the following conditions:
• Where there is enough strength to bear the weight of the outdoor unit.
• A location that allows for optimum air flow and is easily accessible for inspection, maintenance, and service.
• Where piping between the outdoor unit and indoor unit(s) / heat recovery units are within allowable limits.
• Include space for drainage to ensure condensate flows properly out of the unit when it is in heating mode. Avoid placing the outdoor unit
in a low-lying area where water could accumulate.
• If the outdoor unit is installed in a highly humid environment (near an ocean, lake, etc.), ensure that the site is well-ventilated and has a lot
of natural light (Example: Install on a rooftop).
Do Not’s
• Where it will be subjected to direct thermal radiation from other heat sources, or an area that would expose the outdoor unit to heat or
steam like discharge from boiler stacks, chimneys, steam relief ports, other air conditioning units, kitchen vents, plumbing vents, and other
sources of extreme temperatures.
• Where high-frequency electrical noise / electromagnetic waves will affect operation.
• Where operating sound from the unit will disturb inhabitants of surrounding buildings.
• Where the unit will be exposed to direct, strong winds.
• Where the discharge of one outdoor unit will blow into the inlet side of an adjacent unit (when installing multiple outdoor units).
Planning for Snow and Ice
To ensure the outdoor unit operates properly, certain measures are required in locations where there is a possibility of heavy snowfall or
severe wind chill or cold:
1. Prepare for severe winter wind chills and heavy snowfall, even in areas of the country where these are unusual phenomena.
2. Position the outdoor unit so that its airflow fans are not buried by direct, heavy snowfall. If snow piles up and blocks the airflow, the
system will malfunction.
3. Remove any snow that has accumulated four (4) inches or more on the top of the outdoor unit.
4. In climates that will experience significant snow buildup, mount the outdoor unit on a raised, field-provided platform or stand. The raised
support platform must be high enough to allow the unit to remain above possible snow drifts, and must be higher than the maximum antici-
pated snowfall for the location.
5. Design the mounting base to prevent snow accumulation on the platform in front or back of the unit frame.
6. Provide a field fabricated snow protection hood to keep snow and ice and/or drifting snow from accumulating on the coil surfaces.
7. Install a hail guard kit and air guide accessories (sold separately) to prevent snow or rain from accumulating on the fan inlet / outlet guards.
8. Consider tie-down requirements in case of high winds or where required by local codes.
CAUTION
When deciding on a location to place the outdoor unit, be sure to choose an area where run-off from defrost will not accumulate and freeze on
sidewalks or driveways, which will create unsafe conditions. Properly install and insulate any drain hoses to prevent the hose from freezing,
cracking, leaking, and causing unsafe conditions from frozen condensate.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
34
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Selecting the Best Location for the Outdoor Unit(s)
The system will take longer to provide heat, or heating performance will be reduced in winter if the outdoor unit is installed:
1. In a narrow, shady location.
2. Near a location that has a lot of ground moisture.
3. In a highly humid environment.
4. In an area in which condensate does not drain properly.
Installation
NOTE
2FHDQZLQGVZLOOFDXVHFRUURVLRQSDUWLFXODUO\RQWKHFRQGHQVHUDQGHYDSRUDWRU¿QVZKLFKLQWXUQFRXOGFDXVHSURGXFWPDOIXQFWLRQRULQHI¿FLHQW
performance.
• Avoid installing the outdoor unit where it would be directly exposed to ocean winds.
• Install the outdoor unit on the side of the building opposite from direct ocean winds.
• Select a location with good drainage.
• Periodically clean dust or salt particles off of the heat exchanger with water.
Ocean winds
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 35
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Outdoor Unit Clearance Requirements
A 1" A "
B " B 4"
C 1" C "
Front Front D " D 4"
E 1" E 4"
F " F "
Different clearances are required if a Low Ambient Cooling Kit is installed. Refer to the Low Ambient Cooling Kit Installation Manual for clearance
information.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
36
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Installing Outdoor Units Indoors
• Wall height at the front of the outdoor unit must be 60 inches.
60 inches
Wall Height
Front
• Wall height at the inlet side of the outdoor unit must be LQFKHV
Limitations
20 in.
• There are no height limitations for the walls at the sides of the outdoor unit.
(When the • If the wall heights at the front and inlet sides of the outdoor unit are higher than
Unit[s] is [are] >45° allowable limits, additional space must be included.
Surrounded >10 inches - Additional space on the FRONT side by 1/2 of h1.
by Four [4] - Additional space on the INLET side by 1/2 of h2.
Walls) Front - h1 = A (the actual height) - 60.
- h2 = B (the actual height) - 20.
>2 inches
Installation
weather’s freezing rain, sleet, and snow. Some building projects, however, necessitate placing the HVAC outdoor units indoors:
• Lack of ground space.
• Lack of an appropriate outdoor location that meets system design requirements.
• When mounting on the roof is not an option due to a lack of roof space.
• Roof warranty will be voided if mechanical equipment is placed on the membrane.
• On retrofit projects, a former chiller/boiler/air handler equipment room, mechanical area, or penthouse already exists.
• Where a project has vertical, self-contained VAV air handlers on each floor (in lieu of a centralized mechanical room).
• To curtail the potential need for redundant zone heating devices such as wall-fin radiators or duct heaters.
• In extremely cold environments where there is a significant amount of run-time at temperatures well below freezing outside the outdoor unit
ambient air temperature range published in this engineering manual.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 37
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Installing Outdoor Units Indoors
General Guidelines
• Follow ASHRAE 62.1 design guidelines.
• Depending on the project / application, a roof over the outdoor units in combination with a wind break will be all that is necessary.
• Consider the potential for snow accumulation near louvers/roof openings. Outside air intakes and discharge ducts/louvers must be engi-
neered to clear anticipated snow accumulation levels by at least one (1) foot.
• In situations where operation is anticipated at temperatures of -13°F and lower, ancillary heat must be provided to heat the outdoor unit
coils to assure continuous compressor operation and heating.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
It will be necessary to use an air guide accessory to prevent discharge air from short-cycling back to the coil inlet.
• Another option is to field manufacture ductwork and mount on top of the unit to encompass the outdoor unit fan discharge and connect to
the exterior discharge grille on the building.
• Avoid using a single duct on multi-fan units to prevent short cycling. Provide a dedicated duct for each outdoor unit fan discharge.
• Consider the direction of prevailing winds and opening placement. If possible, locate inlet openings upwind of discharge openings and other
exhaust outlets.
• When inlet and outlet openings are placed on the same wall, minimum distance between the two openings must be approximately three (3)
feet (minimum distance varies significantly with variations in outlet opening face velocity).
• If roof-mounted ventilation openings are used, strategically locate the inlet ventilation opening(s) upwind of the outlet opening(s).
• Discharge and supply ductwork must be designed to avoid weather related long periods of water entrainment.
Provide a means to drain the condensate generated during heating mode and defrost cycle in addition to rainwater that infiltrates the inlet
louver enclosed area.
• Install a field-provided drain pan under the outdoor units and provide a path to a nearby floor drain.
• If the ambient air temperature is expected to drop below 32°F in the enclosure, heat the bottom surface of the pan, drain line, and floor
drain so that the condensate does not freeze before reaching the drain.
Allow for ventilation intake and exhaust air based on maximum outdoor unit fan capacity.
• Select the size, type and orientation of architectural louvers with adequate “net free area” face velocity to ensure the total external static
pressure from the outdoor unit fan does not exceed design limitations.
• No obstructions must be placed in front of the louver that could hamper the free flow (throw) of air.
• Roof top openings and / or discharge and supply louvers must be equipped with screens to prevent bird and insect infiltration.
As always, the best solution for each project balances acceptable heating performance (considering local weather conditions), capital costs,
life cycle energy consumption, and limitations set forth by local building codes. For more detailed information on how to design indoor spaces
for LG Multi V outdoor units, see the white paper “Air-Source VRF Mechanical Room Design Considerations for Outdoor Unit Placement in
Enclosures” on www.lghvac.com.
)RUGHWDLOHGSODFHPHQWFRQVLGHUDWLRQVDQGLQVWDOODWLRQUHTXLUHPHQWVIRULQGRRUXQLWVUHIHUWRLWV,QGRRU8QLW(QJLQHHULQJDQG
or Installation Manuals.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
38
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Installing and Setting Outdoor Units in Dual / Triple Frame Systems
,QVWDOOLQJDQG6HWWLQJ2XWGRRU8QLWVLQ'XDO7ULSOH)UDPH6\VWHPV
To ensure proper system operation, the individual outdoor units within dual and triple frame systems must be physically installed in a certain
order, and DIP switches must be appropriately set.
Installing Outdoor Units in Dual / Triple Frame Systems Figure 7: Installing Outdoor Units In Dual / Triple Frame Systems.
• The Main unit must always be the largest capacity outdoor unit in a ABC
dual or triple frame system.
• The Main unit must always be placed the closest to the indoor unit A B
(Sub 1)
C
/ heat recovery unit refrigerant piping system. (Main) (Sub 2)
• The Sub 1 unit must always be the next largest capacity outdoor
unit in a dual or triple frame system, and must be larger than the
Sub 2 unit.
• The Sub 2 unit must be the smallest capacity outdoor unit in a
triple frame system.
Installation
triple-frame outdoor units are separated (requirement is based on dis- Sub 1 Outdoor Unit Sub 2 Outdoor Unit
tance between the units). For detailed information, see the “Refrigerant Connection Piping Connection Piping
Piping for Separated Outdoor Units” section. (First Y-Branch) (Second Y-Branch)
• For the DIP-SW01 bank on the Main unit, all DIP switches must be set to OFF.
• For the DIP-SW01 bank on the Sub 1 unit, set only DIP switch 6 to ON.
• For the DIP-SW01 bank on the Sub 2 unit, set only DIP switch 7 to ON.
Figure 8: Main, Sub1, and Sub2 DIP Switch Settings.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 39
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Selecting the Best Location / Clearance Requirements for the
Heat Recovery Unit(s)
6HOHFWLQJWKH%HVW/RFDWLRQ&OHDUDQFH5HTXLUHPHQWV
Heat recovery units are for use with systems designed for heat recovery operation only.
Select an installation space for the heat recovery unit that meets the following conditions:
• Install the heat recovery unit indoors in a level and upright position.
• Ensure there is enough space in the installation area for service access.
• Install the heat recovery unit in a location where any sound it may generate will not disturb occupants in the surrounding rooms.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
• Install the refrigerant piping and electrical wiring system in an easily accessible location.
Dont’s
• Refrigerant pipes must not exceed lengths specified by LG Electronics.
• Do not install the heat recovery unit in a location where it would be subjected to strong radiation heat from heat sources.
• Avoid an installation environment where oil splattering or vapor spray may occur.
• Avoid an installation environment where high-frequency electric noise could occur.
• Condensate drain piping is not required.
Figure 9: PRHR023A to 043A Clearance Requirements.
Unit: Inch 20-3/8
7 4 Service Space
11-13/16 11-13/16
12-1/4
4 Service Space
10
Access Panel
(Service Space)
19-1/8 11-13/16 Access Panel
2 Service Space (10 Inch Service Space)
4-15/16
5-15/16 19-1/8 5-15/16 3 4 5
2-13/16
1
5-13/16
8-9/16
6-1/2
6 15-5/16 6-15/16
3-5/8
3/4
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
40
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Selecting the Best Location / Clearance Requirements for the
Heat Recovery Unit(s)
12-1/4
11-13/16 11-13/16
Service Space Service Space
10
Access Panel
(Service Space) 4 Service Space
31-1/4
2
Installation
3
11-13/16 Access Panel
1 (10 Inch Service Space)
Service Space
8-9/16
6-1/2
6
4-15/16
6-5/16 31-1/4 6-5/16 4 5
2-3/16
5-13/16
3/4
Table 18: PRHR063A and PRHR083A Heat Recovery Unit Components.
Connection Size (in. )/ Type
No. Component Name
PRHR063A PRHR083A
1 Low Pressure Vapor Pipe Connection Port 1-1/8 Braze 1-1/8 Braze
2 High Pressure Vapor Pipe Connection Port 7/8 Braze 7/8 Braze
3 Liquid Pipe Connection Port 5/8 Braze 5/8 Braze
4 Indoor Unit Vapor Pipe Connection Port 5/8 Braze 5/8 Braze
5 Indoor Unit Liquid Pipe Connection Port 3/8 Braze 3/8 Braze
6 Control Box – –
7 Metal Hanger Bracket (Field-Supplied Suspension Bolt) 5/16 or 7/16 5/16 or 7/16
• Include an access panel at the side of the heat recovery unit where the control box is located.
• If reducers are used, service space must be increased equal to the dimensions of the reducer.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 41
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PLACEMENT CONSIDERATIONS
WITH
Selecting the Best Location / Clearance Requirements for the
Heat Recovery Unit(s)
PRHR063A PRHR083A
Six Ports Eight Ports
1. Heat recovery units have capacities from 120,000 to 230,000 Btu/h, depending on the model. See the specification tables in the “Product
Data” section.
2. Heat recovery units connected in series have a total capacity up to 192,000 Btu/h per series string. Series string is defined as heat
recovery units piped in series.
3. Elevation difference between heat recovery units connected in series is permitted, but must not exceed 16 feet.
4. Each port on the heat recovery unit has a capacity up to 60,000 Btu/h.
5. Each port can be connected to a maximum of eight (8) indoor units. When multiple indoor units are connected to one port, all indoor units
on that port must operate in the same mode (cooling or heating).
6. If an indoor unit larger than 60,000 Btu/h is to be used, two (2) ports must be twinned using a reverse Y-branch.
7. Connect the largest indoor unit to the first port(s) of the heat recovery unit. Start indoor unit connections from the first port and do not
skip ports. The 3A heat recovery units are numbered from right to left (No. 1 port on right side).
8. Elevation difference between the heat recovery unit and the indoor unit(s) must not exceed 49 feet.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
42
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
02817,1*$1&+25,1*7+(
WITH
OUTDOOR UNIT(S)
Remove the wood pallet from the bottom of the outdoor unit before attaching the anchor bolts. If the
pallet is not removed, the outdoor unit will become unstable and heat exchanger will freeze, resulting
in improper operation.
• Ensure that the floor / chosen location has enough strength to support the weight of the unit(s) and the base. If it does not have sufficient
strength, the unit(s) and base will fall and cause physical injury or death.
• Install the outdoor unit to protect against extremely high winds and earthquakes. Any deficiency in installation will cause unit to fall, resulting
in physical injury or death.
CAUTION
Installation
When deciding on a location to place the outdoor unit, be sure to choose an area where run-off from defrost will not accumulate and freeze on
sidewalks or driveways, which will create unsafe conditions. Properly install and insulate any drain hoses to prevent the hose from freezing,
cracking, leaking, and causing unsafe conditions from frozen condensate.
NOTE
Ocean winds will cause corrosion, particularly on the condenser and
Figure 13: Support Options.
HYDSRUDWRU¿QVZKLFKLQWXUQFRXOGFDXVHSURGXFWPDOIXQFWLRQRULQHI¿-
cient performance.
• Ensure that the floor / chosen location has enough strength to sup-
port the weight of the unit(s) and the base, enough space for the
piping and wiring; and sufficient slope for proper drainage between
the units, the condensate drain connection, and the floor drain.
s s
• Avoid placing the unit(s) in a low-lying area where water will inche inche
ast 4 ast 4
accumulate. At le At le
• Do not install the condensate drain piping within the outdoor
unit frame; use the access hole for drainage instead. Drain piping s ches
nche inches t 4 in t 4 inche
s
installed within the outdoor unit frame will freeze, the condensate st 4 i 4 as
At lea At least Center of the Unit At le
At leas Center of the Unit
will not drain properly and cause damage the outdoor unit.
• Refer to dimensional drawings in the “Product Data” section, and
follow the applicable local and state codes for clearances, mount-
ing, anchor, and vibration attenuation requirements.
All four corners, as well as the center of the outdoor unit, must be
ches
supported properly. All four corners of the outdoor unit must be
least 4 in
securely fastened to a: At
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 43
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
02817,1*$1&+25,1*7+(
WITH
OUTDOOR UNIT(S)
Anchoring the Outdoor Unit Figure 15: Location of the Anchor Bolts on the Outdoor Unit.
• 2XWGRRUXQLWVXSSRUW V PXVWEHDWOHDVWLQFKHVZLGHDQG Unit: Inch
inches high.
• Include anti-vibration material chosen by the acoustics engineer.
• If not otherwise directed by the structural engineer or local codes,
use 7/8 inch or 1/2 inch diameter J-bolts inserted at least 3 inches
2-9/16
deep into the supports.
2-9/16
At least
• Use a hexagon nut with a lock washer.
29-29/32
28-25/32
Table 19: 2XWGRRU8QLW$QFKRU%ROW/RFDWLRQ6SHFL¿FDWLRQV
2-9/16
At least
Capacity (ton) A (inches) B (inches)
2-9/16
6 36-5/8 28-3/4
8
10
12
14 47-1/4 40-15/16
16
18
20
Figure 16: Side View of Anchor Bolts Figure 17: Close Up View of Anchor Bolts.
Used on the Outdoor Unit. Anti-vibration
Spring Washer
Material
Nut Concrete Three Threads
Unit Mounting Anti-vibration Base Four Bolts
Foot Material Required
H-Beam
3"
8"
8"
3"
4"
Unit: Inch
See Close Up View of Anchor Bolts at right.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
44
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
02817,1*$1&+25,1*7+(
WITH
HEAT RECOVERY UNIT(S)
0RXQWLQJ$QFKRULQJWKH+HDW5HFRYHU\8QLW V
Install the heat recovery unit by suspending it from the ceiling with Figure 18: Installing the Heat Recovery Unit Top Side Up.
the top (see diagram) always facing up.
Ceiling
1. Select and mark the area where the anchors / suspension bolts
are to be placed on the ceiling. Top of HRU
Top of HRU
HRU
2. Drill the holes for the anchors / suspension bolts as indicated.
Using a drop-in anchor, install the hanging bolt.
p of HRU
Top H
3. Thread 3/8 or 5/16 inch hexagon nuts (field-supplied), the metal
hanger tabs, and flat washers (field-supplied) onto the hanging
bolts as shown in the diagram. Figure 19: Drilling the Holes for Figure 20: Suspension Bolts
the Anchors / Suspension Bolts. Installation.
4. Install the heat recovery unit horizontally on the metal hanger
brackets with its top facing up. Use a level—the unit must be
within ±5° from front to back and from left to right. Tighten all Six-Sided Nut
anchors, nuts, and bolts. 5/16 (M8) or 7/16 (M10)
5. After verifying that the heat recovery unit is level, tighten the Hanger
Metal Hanger metal
Bracket
hexagon nuts. Flat Washer
washer
7/16 (M10)
Suspension Bolt
Installation
The following parts are field supplied: 5/16 (M8) or 7/16 (M10)
5 Suspension
Bolt
NOTE
2FHDQZLQGVZLOOFDXVHFRUURVLRQSDUWLFXODUO\RQWKHFRQGHQVHUDQGHYDSRUDWRU¿QVZKLFKLQWXUQFRXOGFDXVHSURGXFWPDOIXQFWLRQRULQHI¿FLHQW
performance.
• The threaded suspension bolts and other hardware must be securely tightened to prevent the unit from falling from its installation location.
There is a risk of equipment damage.
• Do not damage power wiring during installation. There is a risk of equipment malfunction, which may result in property damage.
• The heat recovery unit MUST be installed so that its top faces up. If not, the incorrect installation may cause unit failure.
• The heat recovery unit must be positioned no more than ±5° from level front to back and left to right.
• Removing the factory process stubs is required. Replace with refrigerant-grade caps.
• Insulate unused ports completely as shown in the figure.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 45
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
LG AIR CONDITIONER
WITH
TECHNICAL SOLUTION (LATS)
To reduce the risk of designing an improper applied system or one that will not operate correctly, LG requires that LATS software be used on all
projects.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Formats
LATS is available to LG customers in two user interfaces: LATS HVAC and LATS REVIT. Both LATS formats are available through www.
lghvac.com, or contact an LG Sales Representative.
LATS HVAC is a Windows®-based application that aids engineers in designing LG Variable Refrigerant Flow (VRF), Multi F / Multi F MAX,
Single-Zone, and Energy Recovery Ventilator (ERV) systems.
*Windows® is a registered mark of Microsoft® Corporation.
LATS REVIT integrates the LG LATS program with Revit® software**. It permits engineers to layout and validate Multi V VRF systems directly
into Revit drawings.
**Revit® is a registered mark of Autodesk, Inc.
Features
All LG product design criteria have been loaded into the program, making LATS simple to use: double click or drag and drop the component
choices. Build systems in Tree Mode where the refrigerant system can be viewed. Switch to a Schematic diagram to see the electrical and
communications wiring.
LATS software permits the user to input region data, indoor and outdoor design temperatures, modify humidity default values, zoning, specify
type and size of outdoor units and indoor units, and input air flow and external static pressure (ESP) for ducted indoor units.
Features depend on which LATS program is being used, and the type of system being designed.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
46
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
LG AIR CONDITIONER
WITH
TECHNICAL SOLUTION (LATS)
Proper Design to Install Procedure Figure 22: Example of a LATS Tree Diagram.
LG encourages a two report design-to-install-procedure. After the
design engineer determines building / zone loads and other details,
The contractor must mark any deviation from the design on the Shop Drawing, including as-built straight lines and elbows. This “Mark Up”
drawing must be returned to the design engineer or Rep, who must input contractor changes into the LATS file. (Copy the original LATS soft-
ware file, save and rename as a separate file, and modify all piping lengths by double-clicking on each length and editing information.) Like
the shop drawing, the Auto Piping and System Check must also be run on this new “As Built” drawing. The design engineer or Rep must then
provide the final As Built file to the contractor. The Mark Up version must be compared to the As Built version for:
• Differences in pipe diameter(s). If incorrect diameters have been installed, the piping must be changed out. If pipe diameters have changed,
check to see if Y-Branches will also need to be changed.
• Changes to outdoor unit and indoor unit capacities. Capacities changes will impact line length changes.
• Additional refrigerant charge quantity (“Trim Charge”). Trim charge will change if piping lengths and diameters change. The As Built version
must reflect installed piping lengths to ensure correct trim charge.
All documents submitted by the contractor, as well as the Shop Drawing and the As Built Drawing files must be provided for commissioning
purposes. Model and serial numbers for all system components must also be submitted. If the steps previously detailed are not followed, and
all documents are not provided to the commissioning agent, the project runs the risk of not being commissioned and any warranty LG offers
on the equipment not being activated.
$Q\¿HOGFKDQJHVVXFKDVUHURXWLQJVKRUWHQLQJRUOHQJWKHQLQJDSLSHVHJPHQWDGGLQJRUHOLPLQDWLQJHOERZVDQGRU¿WWLQJVUHVL]LQJ
DGGLQJRUHOLPLQDWLQJLQGRRUXQLWVFKDQJLQJWKHPRXQWLQJKHLJKWRUPRYLQJWKHORFDWLRQRIDGHYLFHRU¿WWLQJGXULQJLQVWDOODWLRQPXVWEH
GRQHZLWKFDXWLRQDQG$/:$<69(5,),('LQ/$7608/7,962)7:$5(%()25(VXSSOLHVDUHSXUFKDVHGRULQVWDOOHG'RLQJVRZLOOOHDGWR
DPRUHSUR¿WDEOHLQVWDOODWLRQUHGXFHWKHSRWHQWLDOIRUUHZRUNDQGZLOOUHGXFHWKHSRWHQWLDOIRUPXOWLSOHYLVLWVWRWKHMREVLWHWRFRPSOHWHWKH
V\VWHPFRPPLVVLRQLQJ
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 47
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
REFRIGERANT CHARGE WORKSHEET
WITH
System R410A Refrigerant Charge Calculator (lbs.)
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
48
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
5()5,*(5$176$)(7<67$1'$5'6
WITH
DEVICE CONNECTION LIMITATIONS
One of the most critical elements of a Multi V system is the refrigerant piping. The table below lists pipe length limits that must be followed in
the design of a Multi V refrigerant pipe system:
Table 20: Multi V 5 Refrigerant Piping System Limitations.
Longest total equivalent piping length 3,280 feet
Longest distance from outdoor unit to indoor unit 656 feet (Actual) 738 feet (Equivalent)
Distance between fittings and indoor units LQFKHV
Pipe Length Distance between fittings and Y-branches LQFKHV
(ELF = Equivalent Length
of pipe in Feet) Distance between two Y-branches LQFKHV
Distance between two series-piped heat recovery units LQFKHV
Minimum distance between indoor unit to any Y-branch 3 feet from indoor unit to Y-branch
Maximum distance between first Y-branch to farthest indoor unit 131 feet (295 feet for conditional applications)
If outdoor unit is above or below indoor unit 360 feet
Elevation Between indoor units on heat pump systems, or indoor units
(All Elevation Limitations connected to separate parallel heat recovery units 131 feet
are Measured in Actual
Feet) Between indoor units connected to single heat recovery unit or 49 feet
series heat recovery units
Table 21: Equivalent Piping Length for Y-branches, Headers, and Other Piping Components.
Size (Inches)
Component
1/4 3/8 1/2 5/8 3/4 7/8 1 1-1/8 1-1/4 1-3/8 1-1/2 1-5/8 1-3/4 2-1/8
Long Radius Elbow (ft.) 0.5 0.6 0.7 0.8 1.2 1.3 1.5 1.6 1.8 2.0 2.1 2.3 2.5 2.8
Y-branch (ft.)1 1.6
Header (ft.) 3.3
Heat Recovery Unit (ft.) (For Heat Recovery 8.2
Systems only)
1
Kit contains two Y-branches: one for liquid and one for vapor.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 49
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
SELECTING COPPER PIPING
WITH
Always follow local codes when selecting and installing copper pipe and piping system components.
Approved piping for use with Multi V products will be marked “R410 RATED” along the length of the pipe. Piping wall thickness must meet
local code requirements and be approved for a maximum operating pressure of 551 psi. When bending piping, try to keep the number of
bends to a minimum, and use the largest radii possible to reduce the equivalent length of installed piping; also, bending radii greater than ten
(10) piping diameters can minimize pressure drop. Be sure no traps or sags are present.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Always properly support the piping as per the instructions under “Pipe Supports” later in this section.
• Commercially available piping often contains dust and other materials. Always blow it clean with a dry nitrogen.
• Prevent dust, water or other contaminants from entering the piping during installation.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
50
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
COPPER EXPANSION AND
WITH
CONTRACTION
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 51
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
COPPER EXPANSION AND
WITH
CONTRACTION
See table below for precalculated anticipated expansion for various pipe sizes and lengths of refrigerant piping.
www.engineeringtoolbox.com.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
52
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
COPPER EXPANSION AND
WITH
CONTRACTION
L L
R L
All expansion loops and offsets must be installed in the horizontal plane to prevent the possibility of trapping oil. Loops and offsets in vertical risers
must also be installed in a horizontal plane.
Table 26: Radii of Coiled Expansion Loops and Developed Lengths of Expansion Offsets.
Anticipated Linear Nominal Tube Size (OD) inches
Expansion (LE) (in.) 1/4 3/8 1/2 3/4 1 1-1/4 1-1/2
R1 6 7 8 9 11 12 13
1/2
L2 38 44 50 59 67 74 80
R1 9 10 11 13 15 17 18
1
L2 54 63 70 83 94 104 113
R1 11 12 14 16 18 20 22
1-1/2
L2 66 77 86 101 115 127 138
R1 12 14 16 19 21 23 25
2
L2 77 89 99 117 133 147 160
R1 14 16 18 21 24 26 29
2-1/2
L2 86 99 111 131 149 165 179
R1 15 17 19 23 26 29 31
3
L2 94 109 122 143 163 180 196
R1 16 19 21 25 28 31 34
3-1/2
L2 102 117 131 155 176 195 212
R1 17 20 22 26 30 33 36
4
L2 109 126 140 166 188 208 226
1
R = Centerline Length of Pipe.
2
L = Centerline Minimum Radius (inches).
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 53
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
PIPING HANDLING
WITH
Piping Handling
Pipes used for the refrigerant piping system must include the specified thickness, and the Keep Pipes Capped While Storing.
interior must be clean.
While handling and storing, do not bend or damage the pipes, and take care not to
contaminate the interior with dust, moisture, etc.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Possible - Significant hydrolysis of refrigerant oil. - Refrigerant oil degradation. - Refrigerant gas leaks / shortages.
Problems - Refrigerant oil degradation. - Poor insulation of the compressor. - Refrigerant oil degradation.
- Poor insulation of the compressor. - System does not operate properly. - Poor insulation of the compressor.
- System does not operate properly. - EEVs and capillary tubes become - System does not operate properly.
- EEVs, capillary tubes are clogged. clogged.
Solutions - Remove moisture from the piping. - Remove dust from the piping. - Test system for air tightness.
- Piping ends should remain capped until - Piping ends should remain capped until - Perform brazing procedures that comply
connections are complete. connections are complete. with all applicable standards.
- Do not install piping on a rainy day. - Connect piping properly at the side of - Perform flaring procedures that comply
- Connect piping properly at the unit’s side. the unit. with all applicable standards.
- Remove caps only after the piping is - Remove caps only after the piping is cut - Perform flanging procedures that
cut, the burrs are removed, and after and burrs are removed. comply with all applicable standards.
passing the piping through the walls. - Retain the cap on the piping when - Ensure that refrigerant lines are pressure
- Evacuate system to a maximum of 500 passing it through walls, etc. tested to 550 psig and hold for 24 hours.
microns and insure the vacuum holds at
that level for 1 hour.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
54
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
REFRIGERANT SYSTEM ENGINEERING
WITH
Proper system operation depends on the installer using utmost care while assembling the piping system. The following pages are an over-
view of best practices when installing the refrigerant piping system.
LG Electronics U.S.A.,Inc., is not responsible for any piping calculations, refrigerant leaks, degradation of performance, any other potential problems
or damages caused by the interconnecting piping, their joint connections, isolation valves, or introduced debris inside the piping system.
• Pressure drops for any component used, including isolation valves, must be known in equivalent pipe length and calculated into the total
and segment equivalent piping lengths and compared to product design limitations.
• In all cases, materials must be suitable for the application and any applicable codes, including, but not limited to, diameter and wall thick-
ness continuity per ACR standards.
Failure to do so will cause significant performance degradation. Proper leak checks must be performed. Using isolation valves does not
automatically void any LG product warranty, however, a limited warranty will be voided in whole or part if any field supplied accessory fail in
any way that causes product failure.
Using Elbows
Field-supplied elbows are allowed if they are long radius and designed for use with R410A refrigerant. The designer and installer, however,
must be cautious with the quantity and size of fittings used, and must account for the additional pressure losses in equivalent pipe length
calculation for each branch. The equivalent pipe length of each elbow must be added to each pipe segment in the LATS program.
Pipe Bends
When bending soft copper, use long radius bends. Refer to the “Radii of Coiled Expansion Loops and Developed Lengths of Expansion
Offsets” table for minimum radius specifications.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 55
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
REFRIGERANT SYSTEM ENGINEERING
WITH
MINIMUM
Pipe supports must never touch the pipe wall; supports must be installed outside
(around) the primary pipe insulation jacket. Insulate the pipe first because pipe supports
must be installed outside (around) the primary pipe insulation jacket. Clevis hangers must be
used with shields between the hangers and insulation. Field provided pipe supports must be
designed to meet local codes. If allowed by code, use fiber straps or split-ring hangers
suspended from the ceiling on all-thread rods (fiber straps or split ring hangers can be used
as long as they do not compress the pipe insulation). Place a second layer of insulation over
the pipe insulation jacket to prevent chafing and compression of the primary insulation in the
confines of the support clamp.
Use a 4" + long sheet curved sheet metal
saddles between hanger bracket and insulation
A properly installed pipe system will have sufficient supports to avoid pipes from sagging to promote linear expansion/contraction.
during the life of the system. As necessary, place supports closer for segments where
potential sagging could occur. Maximum spacing of pipe supports must meet local codes. Figure 26: Typical Pipe Support Location—
If local codes do not specify pipe support spacing, pipe must be supported: Change in Pipe Direction.
• Maximum of five (5) feet on center for straight segments of pipe up to 3/4 inches outside
diameter size.
• Maximum of six (6) feet on center for pipe up to one (1) inch outside diameter size.
• Maximum of eight (8) feet on center for pipe up to two (2) inches outside diameter size. Max. 12"
Wherever the pipe changes direction, place a hanger within twelve (12) inches on one side
and within twelve (12) to nineteen (19) inches of the bend on the other side. Support piping
~ 12" – 19"
at indoor units, Y-branch, and Header fittings as shown.
Figure 27: Pipe Support at Indoor Unit. Figure 28: Pipe Support at Y-branch Fitting. Figure 29: Pipe Support at Header Fitting.
Max. 12" Max. 12" Max. 12"
~12" - 19"
Max. 12"
Max. 12"
Max. 12"
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
56
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
REFRIGERANT SYSTEM ENGINEERING
WITH
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 57
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
FLARING AND BRAZING PROCEDURES
WITH
• During installation, it is imperative to keep the piping system free of contaminants and debris such as copper burrs, slag, or carbon dust.
• Do not use kinked pipe caused by excessive bending in one specific area on its length.
Flaring Procedure
MULTI V 5 with LGRED Outdoor Unit Installation Manual
:KHQVHOHFWLQJÀDUH¿WWLQJVDOZD\VXVHD¿WWLQJUDWHGIRUXVHZLWKKLJKSUHVVXUHUHIULJHUDQW5$6HOHFWHG¿WWLQJVPXVWDOVRFRPSO\ZLWKORFDO
state, or federal standards.
1. Cut the pipe to length. 1. Copper
tube 90° Slanted Uneven Rough
• Measure the distance between the indoor unit and the outdoor unit.
• Cut the pipes a little longer than measured distance.
Handle
3. Flaring the pipe end. 3.
Bar Bar
• Use the proper size flaring tool to finish flared connections as Yoke
shown. Cone
• ALWAYS create a 45° flare when working with R410A.
Copper pipe
Clamp handle Red arrow
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
58
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
FLARING AND BRAZING PROCEDURES
WITH
2. Initially hand tighten the flare nuts using three (3) or four (4) turns.
3. To finish tightening the flare nuts, use both a torque wrench and a backup wrench.
4. After all the piping has been connected and the caps have been tightened, check for refrigerant gas leaks.
Brazing Procedure
WARNING
Do not braze in an enclosed location. Do not allow the refrigerant to leak during brazing. Always test for gas leaks
before and after brazing.
If the refrigerant combusts, it generates a toxic gas the will cause physical injury or death.
Braze the pipes to the service valve pipe stub of the outdoor unit.
1. All joints are brazed in the field. Multi V refrigeration system components contain very Figure 31: Refrigerant Pipe Brazing.
small capillary tubes, small orifices, electronic expansion valves, oil separators, and Refrigerant
Piping Pressure-reducing
heat exchangers that can easily become blocked. Proper system operation depends Pipe to
be brazed Valve
on the installer using best practices and utmost care while assembling the piping
system. Nitrogen
2. Store pipe stock in a dry place; keep stored pipe capped and clean.
Valve
3. Blow clean all pipe sections with dry nitrogen prior to assembly. Taping
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 59
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Indoor Unit Y-Branch Kits
-5°
Y-branch Inlet
Field-Supplied
Insulation
PLAN VIEW
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
60
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Indoor Unit Y-Branch Kits
11-1/16 (281)
11-1/16 (281)
11-1/2 (292)
11-1/2 (292)
I.D. 1/2 (12.7)
I.D. 3/4 (19.05)
1 O.D. 3/8 (9.52)
1 O.D. 5/8 (15.88)
2-3/4 (70)
2-3/4 (70) AJR54072929 AJR54072927
Vapor Pipe Liquid Pipe
I.D. 7/8 (22.2) I.D. 3/4 (19.05) I.D. 1/2 (12.7)
I.D. 1 (25.4) I.D. 3/4 (19.05) I.D. 5/8 (15.88) I.D. 1/2 (12.7) I.D. 3/8 (9.52) I.D. 1/4 (6.35)
I.D. 3/8 (9.52)
2
1
I.D. 3/4 (19.05) I.D. 1/2 3-1/4
I.D. 5/8 (15.88) (12.7) I.D. 1/2 (12.7) 2-15/16
ARBLN03321 (83) I.D. 1/2 (12.7) I.D. 3/8 (9.52) I.D. 1/4 (6.35) (74)
15-3/8 (390) 3
16-1/4 (413) 12-5/8 (321)
13-1/16 (332)
I.D. 7/8 (22.2) I.D. 28.58 (1-1/8) I.D. 7/8 (22.2)
O.D. 3/4 (19.05) O.D. 1 (25.4) O.D. 3/4 (19.05) I.D. 1 (25.4)
3 1 2
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 61
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Outdoor Unit Y-Branch Kits
When installed vertically, position the Y-branch at a level lower than the outdoor units it serves, so the straight-through leg is within ±3° of
plumb. When installed horizontally, the straight-through leg must be level, and the branch leg must be within ±5° of horizontal rotation.
Outdoor unit Y-branches must always be installed with the two port ends connected to the piping coming from the outdoor units, and the sin-
gle port end towards the indoor unit refrigerant piping system supporting the indoor units. Outdoor unit Y-branches are usually installed close
to the outdoor unit, leaving enough space for servicing and maintenance.
Figure 35: 2XWGRRU8QLW<%UDQFK+RUL]RQWDO&RQ¿JXUDWLRQ Figure 36: Outdoor Unit Y-branch Vertical Installation Alignment
Straight-through Leg Branch Leg 6SHFL¿FDWLRQV
9HUWLFDO83&RQ¿JXUDWLRQIRU2XWGRRU8QLW 9HUWLFDO'2:1&RQ¿JXUDWLRQIRU
ELEVATION VIEW Y-Branches. Outdoor Unit Y-Branches
+5° -3° of Plumb +3° of Plumb NOT PERMITTED.
-3° of Plumb +3° of Plumb
Horizontal
Plane
-5°
Y-branch Inlet
ELEVATION VIEW
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
62
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Outdoor Unit Y-Branch Kits
*For example, the indicated Ø3/8 (9.52) is the outside diameter (O.D.) of the field-joined piping.
B A
I.D. 1-5/8 (41.3) I.D. 1-3/8 4-3/8 (111)
I.D. 7/8 (22.2) I.D. 3/4 (19.05) I.D. 3/4 (19.05) 3-9/32 (83) (34.9)
*For example, the indicated Ø3/8 (9.52) is the outside diameter (O.D.) of the field-joined piping. MEZ62225511 7/16/2018
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 63
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Header Kits
Header Kits Figure 39: Header Kit—Horizontal Rotation Limit (Ports Must Point to a
Horizontal Direction).
LG Header kits are highly engineered devices designed to evenly Smaller Indoor Units Largest Indoor Units
divide the flow of refrigerant, and are used to join one pipe segment
to two or more segments. Header kits are intended for use where
multiple indoor units are in the same vicinity and it would be better
to “home-run” the run-out pipes back to a centralized location. If
ELEVATION VIEW
connecting multiple indoor units that are far apart, Y-branches can Header Inlet
+0.0
be more economical. -0.0
Header End View
LG Header Kits Consist of: Figure 40: Vertical Header Insulation and Piping Detail (Ports Must Point
• Two headers (one liquid line, one vapor line). to an Upright Direction).
• Reducer fittings as applicable. Field-Supplied Copper Piping
Headers must be installed with the main pipe level in the horizontal
plane. Distribution ports must be either level in the horizontal plane Field-Supplied Insulation Within ±3°
or within ±3° of plumb in the vertical plane. of plumb
Must be
When connecting indoor units to a Header, always connect the unit Must be
Level Level
with the largest nominal capacity to the port closest to the outdoor
unit. Then install the next largest indoor unit to the next port, working
Field-Supplied Copper Piping LG Supplied Header LG Supplied Insulation Jacket
down to the smallest indoor unit.
Do not skip ports. All indoor Figure 41: Incorrect Header Figure 42: ,QFRUUHFW+HDGHU&RQ¿JXUDWLRQ 3RUWV3RLQWLQJ'RZQZDUG
units connected to a single &RQ¿JXUDWLRQ
Header fitting must be located
ELEVATION
with an elevation difference VIEW ELEVATION VIEW
between indoor units that does
not exceed 49 feet.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
64
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Header Kits
Headers
Table 29: Header Model Nos.
Headers
Four Branch Seven Branch Ten Branch
21-1/4 21-1/4
4-3/4 4-3/4
I.D. 1/2 I.D. 1/4
15-3/4 14-3/16
6-5/16 4-3/4
I.D. 5/8
I.D. 1/4
I.D. 1/2
4 branch I.D. 1/4
22-7/8 27-9/16
6-5/16 4-3/4
I.D. 5/8 I.D. 1/4
I.D. 1/4
7 branch ID12.7(1/2)
I.D. 1/2
29-7/8 28-3/8
6-5/16
4-3/4
I.D. 5/8
10 branch I.D. 1/2
I.D. 1/4 I.D. 1/4
5-15/16 5-15/16
ARBL1010 I.D. 5/8
I.D. 3/4 4-3/4 I.D. 3/8 4-3/4
27-9/16
30-9/16
7-3/16 21-1/2 4-1/4
I.D. 5/8 I.D. 1/4
10 branch I.D. 1/2 I.D. 1/4
I.D. 3/8
I.D. 3/4
I.D. 1-1/4 I.D. 1-1/8
I.D. 1-3/8 I.D. 5/8
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 65
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Sample Layouts
Sample Layouts
,PDJHVDUHIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWDFFXUDWHUHSUHVHQWDWLRQV)RUVSHFL¿FGHWDLOVRQSLSLQJOLPLWDWLRQVDQGRWKHUUHIULJHUDQWV\VWHP
rules, review the information in this entire piping section, see the Multi V 5 LGRED Engineering Manual, and follow the LATS diagram.
Example: Five (5) indoor Units Connected Sub 2 ODU
ODU: Outdoor Units. Sub 1 ODU
Main ODU
to the Sub1 outdoor unit capacity, and, where applicable, Length: 492 feet (656 feet conditional application)
Sub1 outdoor unit capacity must be greater than or equal
to the Sub2 outdoor unit capacity. ƐIHHW IHHWFRQGLWLRQDODSSOLFDWLRQ
• Connection piping from branch to branch cannot exceed
the main pipe diameter (A) used by the outdoor unit.
• Install the header branches so that the pipe distances Y-Branch
between the between the connected indoor units are
minimized. Large differences in pipe distances can cause IDU
IDU IDU IDU
indoor unit performances to fluctuate.
• Y-branches and other header branches cannot be Elevation2: IHHW IDU
installed downstream of the initial header branch.
Table 30: Main Pipe (A) Diameters from Outdoor Unit to First Y-branch / Header Branch.
Pipe diameter when pipe length is Pipe diameter when pipe length is Pipe diameter when height differential
ODU Capacity <295 feet (Standard) IHHW 2'8Ľ,'8 2'8Ľ,'8 LV!IHHW
(ton)
Liquid pipe (in. OD) Vapor pipe (in. OD) Liquid pipe (in. OD) Vapor pipe (in. OD) Liquid pipe (in. OD Vapor pipe (in. OD)
6 3/8Ø 3/4Ø 1/2Ø 7/8Ø 1/2Ø No Increase
8 3/8Ø 7/8Ø 1/2Ø 1-1/8Ø 1/2Ø No Increase
10-12 1/2Ø 1-1/8Ø 5/8Ø No Increase 5/8Ø No Increase
14-18 5/8Ø 1-1/8Ø 3/4Ø 1-3/8Ø 3/4Ø No Increase
20 5/8Ø 1-3/8Ø 3/4Ø No Increase 3/4Ø No Increase
22-28 3/4Ø 1-3/8Ø 7/8Ø 1-5/8Ø 7/8Ø No Increase
30-42 3/4Ø 1-5/8Ø 7/8Ø No Increase 7/8Ø No Increase
Table 31: Pipe Diameters (B) from Y-branch to Y-branch / Header.
Downstream Total Capacity of IDUs (Btu/h) Liquid pipe (inches OD) Vapor pipe (inches OD)
1/4Ø 1/2Ø
3/8Ø 5/8Ø
3/8Ø 3/4Ø
3/8Ø 7/8Ø
1/2Ø 1-1/8Ø
5/8Ø 1-1/8Ø
5/8Ø 1-3/8Ø
3/4Ø 1-3/8Ø
3/4Ø 1-5/8Ø
1
)RUWKH¿UVWEUDQFKSLSHXVHWKHEUDQFKSLSHWKDWPDWFKHVPDLQSLSH$GLDPHWHU
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
66
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Sample Layouts
Conditional Applications
Conditional applications are computed in LATS. See below for an explanation of when pipes are upsized.
If the equivalent length between the first Y-branch to the farthest indoor unit is >131 feet (up to 295 feet maximum):
• Pipe segment diameters between the first Y-branch and the second Y-branch must be sized up by one. This applies to both liquid and low
pressure vapor pipes. If the next size up is not available, or if the piping segment diameters are the same as main pipe (A) diameters, sizing
up is not possible.
• :KLOHFDOFXODWLQJWKHHQWLUHUHIULJHUDQWSLSHOHQJWKSLSHOHQJWKVIRUȈ%PXVWEHPXOWLSOLHGE\WZR$ Ȉ%[ Ȉ&IHHW
• /HQJWKRISLSH & IURPHDFKLQGRRUXQLWWRWKHFORVHVW<EUDQFKRUKHDGHUIHHW
• >/HQJWKRISLSHIURPRXWGRRUXQLWWRIDUWKHVWLQGRRUXQLW $%& @>/HQJWKRISLSHIURPRXWGRRUXQLWWRFORVHVWLQGRRUXQLW $%& @IHHW
• When an indoor unit is connected directly after the first branch (installing the pipe of an indoor unit connected directly after the first branch
that is between 131 feet and 295 feet):
• Pipe diameter must be sized up by one.
• 3LSHOHQJWKPXVWEHPXOWLSOLHGE\WZR$ Ȉ%[ & Ȉ&IHHW
If the pipe (B) diameters after the first branch are bigger than the main pipe (A) diameters, pipe (B) must changed to match main pipe (A)
sizes.
If one (or both) of the conditions below are met, the main pipe must be upsized:
• The equivalent length between outdoor unit and the farthest indoor unit is 295 feet or more (liquid and vapor pipes are upsized).
• The elevation distance between outdoor unit and indoor unit is 164 feet or more (only the liquid pipe is upsized).
Refer Table 30 on the previous page for Main pipe (A) diameter from the outdoor unit to the first Y-branch / header branch.
Example: When an indoor unit combination ratio of 120% is connected to a 22-ton outdoor unit:
Outdoor unit main pipe (A) diameters: 1-3/8Ø inches (vapor) and 5/8Ø inches (liquid).
1. Pipe (B) diameters: 1-3/8Ø (vapor) and 3/4Ø (liquid) (after the first branch, when indoor unit combination ratio is 120% [26 tons]).
2. $IWHUWKH¿UVWEUDQFKSLSH % GLDPHWHUVPXVWEHFKDQJHGWRLQFKHV YDSRU DQGLQFKHV OLTXLG WRPDWFKPDLQSLSH $ VL]HV
Instead of using the total indoor unit capacity to choose main pipe (A) diameters, use outdoor unit capacity to choose downstream main pipe
(A) diameters. Do not permit connection pipes (B) from branch to branch to exceed main pipe (A) diameters as indicated by outdoor unit
capacity. Example: When an indoor unit combination ratio of 120% is connected to a 20-ton outdoor unit (24 tons), and indoor unit with a
7,000 Btu/h capacity is located at the first branch:
1. Main pipe (A) diameters on a 20-ton outdoor unit: 1-1/8Ø inches (vapor) and 5/8Ø inches (liquid).
2. Pipe diameters between first and second branches, however, are: 1-3/8Ø (vapor) and 3/4Ø (liquid) (connected downstream indoor unit
capacity is 20 tons).
3. If main pipe (A) diameters of a 20-ton outdoor unit are 1-1/8Ø (vapor) and 5/8Ø (liquid), then the pipe diameters between the first and
second branches must be changed to match.
Note that the pipe diameters computed in LATS may not be standard ACR copper tube sizes that are commonly available. In these instances,
refer to the table below and use the next commonly available pipe size. Please refer to the Copper Development Association Inc. Publication
A4015-14/19: Copper Tube Handbook for additional information.
Table 33: LATS Conditional Piping Upsizing.
LATS Conditional Applications Upsized Pipe Diameters Standard Size Commonly Available ACR Pipe Diameters
Ǝ Ǝ
Ǝ Ǝ
Ǝ Ǝ
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 67
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Sample Layouts
Sub Sub
Main Main
Outdoor Unit
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Outdoor Unit
Y-Branch Y-Branch
First Indoor Unit First Indoor Unit
Y-Branch Y-Branch
Sub
Main
Outdoor Unit
Y-Branch
First Indoor Unit
Y-Branch
,PDJHVDUHIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWDFFXUDWHUHSUHVHQWDWLRQV)RUVSHFL¿FGHWDLOVRQSLSLQJOLPLWDWLRQVDQGRWKHUUHIULJHUDQWV\VWHP
rules, review the information in this entire piping section, see the Multi V 5 LGRED Engineering Manual, and follow the LATS diagram.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
68
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Sample Layouts
Sub Sub
Main Main
,PDJHVDUHIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWDFFXUDWHUHSUHVHQWDWLRQV)RUVSHFL¿FGHWDLOVRQSLSLQJOLPLWDWLRQVDQGRWKHUUHIULJHUDQWV\VWHP
rules, review the information in this entire piping section, see the Multi V 5 LGRED Engineering Manual, and follow the LATS diagram.
Incorrect Layouts
A second branch cannot be made after a header.
Header Headerr
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 69
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Piping Connections / Pipe Routes
Piping Connections for Heat Pump Operation Figure 43: Piping Connections for Heat Pump Operation.
Use the correct outdoor unit connections to join the outdoor unit to the branch piping Service Ports for Heat Pump Operation
in the indoor unit refrigeration system. The outdoor unit and branch piping require
brazed connections; indoor units require flare connections to the refrigerant system.
Multi V 5 outdoor units designed for heat pump operation use only the liquid pipe
and vapor pipe connections as shown in the diagram at right. For heat pump opera- Liquid Pipe
tion, the middle pipe is NOT used and must be kept closed and capped.
Pipe Not Used for
Heat Pump Systems
MULTI V 5 with LGRED Outdoor Unit Installation Manual
(Keep Closed
WARNING and Capped)
It is important that the correct outdoor unit connections be used for the intended system
operation (heat pump versus heat recovery). If the wrong connections are used, it will Vapor Pipe
result in refrigerant leaks, which will lead to illness or death.
It is important that the correct outdoor unit connections be used for the intended system
operation (heat pump versus heat recovery). If the wrong connections are used, it will
result in refrigerant leaks, which will lead to system malfunction or even failure to work
at all.
The pipe route chosen depends on the installation area, and is at the discretion of the installer. Right Side
Pipe Route
After the pipe route is chosen, the appropriate outdoor unit access holes must be knocked out
(see next page for knock out information).
Left Side
Pipe Route
Fr ont Pipe Route
Figure 45: Front Pipe Route. Figure 46: Left and Right Side Routes (Pipes are Routed Through the
Vapor Pipe Bottom of the Outdoor Unit).
Liquid Pipe
Pipe Not Used for Heat Pump
Liquid Pipe Systems (Keep Closed and
Capped)
4-31/32
5-5/32
Vapor Pipe
Liquid Pipe
Vapor Pipe
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
70
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Knock Outs
Knock Outs
After the pipe route is chosen, installer must prepare the access holes in the front panel (front pipe route) or in the base pan at the bottom of
the outdoor unit (for left and right side pipe routes). The access holes for the communication cables and the power supply wiring can also be
knocked out at this time. See diagram below for access hole locations.
NOTE
• Do not damage the outdoor unit pipes or the base pan when knocking out the access holes.
• To avoid damaging the piping and power wiring / communication cables, remove any burrs that will have formed during the knock out
procedure. Make sure the access holes have smooth edges.
• To avoid damaging the power wiring / communication cables, install sleeves.
• After piping installation is complete, to prevent animals or foreign materials from damaging the outdoor unit cables / wiring, seal any holes in
with sealant, plugs, foam, caulk, putty, etc.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 71
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Removing the Leak Prevention Caps
)RUKHDWSXPSRSHUDWLRQWKHPLGGOHSLSHLV127XVHGPXVWEHNHSWFORVHGDQGD¿HOGVXSSOLHGFRSSHUFDSPXVWEHEUD]HGRQWRLWEHIRUHV\VWHPLV
operated. Protect the service valve with a wet towel during brazing.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
• Verify that the valve stems in the service ports are closed (see the "Service Port" section).
• Remove the leak prevention caps from the liquid and vapor pipe outdoor unit connections.
• Use the Schrader valves on the liquid and vapor pipes to perform the leak / pressure, triple evacuation, and trim charge procedures.
Vapor Pipe
Leak
Prevention Cap
/LQHFRQQHFWLRQGLPHQVLRQVLQWKHVSHFL¿FDWLRQWDEOHVDQGLQ/$76DUH¿HOGSLSLQJGLPHQVLRQV127WKHGLPHQVLRQVRQWKHRXWGRRUXQLWFRQQHFWLRQV
WKHPVHOYHV$GDSWHUVZLOOEHQHHGHGWRFRQQHFWWKH¿HOGSLSLQJWRWKHFRUUHFWRXWGRRUXQLWFRQQHFWLRQ DGDSWHUVDUHIDFWRU\VXSSOLHGZLWKWKHRXWGRRU
unit).
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
72
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Adapters
/LQHFRQQHFWLRQGLPHQVLRQVLQWKHVSHFL¿FDWLRQWDEOHVDQGLQ/$76DUH¿HOGSLSLQJGLPHQVLRQV127WKH
dimensions on the outdoor unit connections themselves.
WARNING
Do not braze in an enclosed location. Do not allow the refrigerant to leak during brazing. Always test for gas leaks
before and after brazing.
If the refrigerant combusts, it generates a toxic gas the will cause physical injury or death.
When installing the adapters / piping to the service valve pipe stub of the outdoor unit, always follow industry best practices and the instructions
included in this manual on brazing procedures. Always braze with a dry nitrogen purge operating at a minimum pressure of three (3) psig. The refrig-
erant may leak if the connections are not brazed properly, and / or contaminants are introduced to the piping system, leading to system malfunction.
* *
* *
Ton
A (Inch [mm]) 3/8 (9.52) 3/8 (9.52) 1/2 (12.7) 1/2 (12.7) 5/8 (15.88) 5/8 (15.88) 5/8 (15.88)
B (Inch [mm]) — — — — — — —
C (Inch [mm]) 3/4 (19.05) 7/8 (22.2) 1-1/8 (28.58) 1-1/8 (28.58) 1-1/8 (28.58) 1-1/8 (28.58) 1-3/8 (34.9)
*Elbow is field supplied.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 73
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
WITH
Inch (mm)
I.D. 1-1/8 (28.8) O.D. 1-1/8 (28.0) O.D. 7/8 O.D. 7/8 (22.2)
*Example: Ø3/8 (Ø9.52) is the outside diameter (O.D.) of the field piping.
O.D. 5/8 (15.88) (22.2)
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
8-5/8 (218.53) 7-15/16 (202)
8-1/4 (208.68)
3-3/16 (80.9) 3-7/16 (87) 4-5/16 (110)
I.D. 1-1/8 (28.8)
I.D. 1/2 (12.9) O.D. 1-1/8 (28.0) I.D. 1-1/8 (28.88) I.D. 7/8 (22.4) I.D. 1-1/8 (28.88)
I.D. 1-1/8 (28.8) O.D. 1-1/8 (28.0) O.D. 7/8 O.D. 7/8 (22.2)
O.D. 1/2 (12.7) (22.2)
12
7-15/16 (202)
8-9/16 (218.07) 8-1/4 (208.68)
3-3/16 (80.9) 3-7/16 (87) 4-5/16 (110)
INSTALLING FOR HEAT PUMP
(19.05)
8-9/16 (218.07) 7-15/16 (202)
7-1/16 (179.78) 4-3/4 (120)
3-3/16 (80.9) 3-7/16 (87)
I.D. 7/8 (22.4) O.D. 7/8 (22.2) I.D. 7/8 (22.4) I.D. 7/8 (22.4) O.D. 3/4 (19.05)
I.D. 3/4 (19.25)
O.D. 3/8 (9.52)
I.D. 7/8 (22.4) O.D. 7/8 (22.2)
I.D. 3/8 (9.72) O.D. 3/4
(19.05)
8
(19.05)
8 (203.85) 6-5/8 (168)
2-5/8 (66.3) 3 (76) 6-3/4 (170.78) 2-3/4 (70)
ODU Ton
OPERATION
Adapters
Pipe
Table 35: Adapter Table.
Adapters
74
MULTI V 5 with LGRED Outdoor Unit Installation Manual
INSTALLING FOR HEAT PUMP
WITH
OPERATION
Service Ports
Heat Pump Outdoor Unit Service Port Detail Figure 51: Heat Pump Outdoor Unit
Service Port Diagram.
1. Liquid piping service port (back seated type 4. Stem head access with factory-provided cap.
2
with right hand thread). 5. Schrader ports with factory-provided cap.
2. Service port NOT used for heat pump systems. 6. Service port piping to connect to field piping. 3
Do not expose the outdoor unit service valves to heat. Protect the service valve with a wet towel during brazing. 4
• Outdoor units ship with a factory charge of refrigerant. Always take extreme caution to prevent refrigerant gas (R410A) from leaking during use,
around fire or flame, and during brazing. If the refrigerant gas comes in contact with a flame from any source, it will break down and generate a
poisonous gas. Do not braze in a small room, or a room that is not ventilated.
• After refrigerant piping work is complete, verify that the Schrader port and service port caps are securely tightened to help prevent refrigerant gas
from leaking. Verify the system is free of leaks after refrigerant piping installation is complete. Exposure to high concentration levels of refrigerant
gas will lead to illness or death.
• Do not attempt to remove the service valve stem. Physical injury or death will occur from the uncontrolled rapid release of refrigerant.
• Before connecting the refrigerant piping, make sure the service port valves of the outdoor unit are completely closed (factory setting).
Do not open the service port valves or attempt to operate the system until the refrigerant pipe system installation has been completed.
Never open the valves before a pressure test is performed, a leak test performed, the system is evacuated, and the Commissioning Agent pro-
vides authorization to do so. Do not use polyolester (POE) or any other type of mineral oil as a thread lubricant. If introduced to the refrigerant
circuit, it will create oil sludge leading to system malfunction. Use PVE (polyvinyl ether) type refrigeration oil only.
• Protect the liquid and vapor piping / ports with a wet towel during brazing.
• Use a 15% silver phosphorous copper brazing alloy to avoid overheating and produce good flow. Do not use flux, soft solder, or anti-oxidant
agents. If the proper material is not used, oxidized film will accumulate and clog or damage the compressors. Flux can harm the copper piping or
refrigerant oil.
• When brazing the field-supplied refrigerant piping to the outdoor unit connections, flow 3 psig nitrogen into the piping. If nitrogen was not flowed
during brazing, the piping will oxidize and cause membranes to form, which will negatively impact valve and condenser operation.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 75
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Indoor Unit Y-Branch Kits
-5°
Y-branch Inlet
Figure 54: Y-Branch Insulation and Piping Detail.
Field-Supplied
LG-Supplied Insulation
Insulation Jacket
LG Supplied
Y-Branch
ELEVATION VIEW
Field-Supplied
Insulation
PLAN VIEW
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
76
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Indoor Unit Y-Branch Kits
I.D. 1-3/8 O.D. 1/2 (12.7) O.D. 3/4 (19.05) O.D. 3/4 (19.05) I.D. 1/2
O.D. 1/2 I.D. 3/8 I.D. 1/4 O.D. 1/2 I.D. 3/8
I.D. 1-1/8 (28.58) (34.9) O.D. 1-1/4 O.D. 3/4 I.D. 7/8 (22.2) (12.7) (9.52) (6.35) (12.7) (9.52) I.D. 3/8 (9.52) I.D. 5/8 (15.88) I.D. 5/8 (15.88) (12.7)
O.D. 7/8 (22.2) I.D. 1-1/4 (31.8) (19.05)
(31.8) I.D. 1-1/8
(28.58)
2-3/4 (70) 2-3/4 (70)
4-5/16 (110)
4-5/16 (110) 2-3/4 (70)
4-3/4 (120) 3-9/16 (90) 4-3/4 (120)
AJR54072907 AJR54072903 AJR72963603
Low-Pressure Vapor Pipe Liquid Pipe High-Pressure Vapor Pipe
I.D. 1-3/8 (34.9) I.D. 1-3/8 (34.9) I.D. 3/4 (19.05) I.D. 1/38 (34.9) I.D. 1-1/4 (31.8)
I.D. 1-5/8 (41.3) I.D. 1-1/2 (38.1) I.D. 1-1/8 (28.58) I.D. 5/8 (15.88) I.D. 3/4 (19.05) I.D. 7/8 (22.2) I.D. 5/8 (15.88) I.D. 1-1/4 (31.8) I.D. 1-1/8 (28.58) I.D. 1 (25.4)
I.D. 1-1/8
(28.58) I.D. 7/8 I.D. 5/8 (15.88) I.D. 1/2 I.D. 1
I.D. 1-1/2 (38.1)
I.D. 1-3/8 (34.9) (22.2) 4-15/16 (125) I.D. 7/8 (22.2) (12.7) 3-3/4 I.D. 1-1/8 (28.58) I.D. 1-1/8 I.D. 1-1/4 4-3/8
I.D. 3/4 (19.05) (28.58) (31.8)
(25.4) (111)
(96)
18-9/16 (471) 17-13/16 (453)
ARBLB14521 20-3/8 (517) 16-3/8 (416) 19-5/16 (491)
O.D. 1 (25.4)
I.D. 3/4 (19.05) I.D. 5/8 I.D. 1-5/8 (41.3) 17-1/2 (444) O.D. 1/2 (12.7) I.D. 7/8 (22.2)
(15.88) O.D. 1-1/2 O.D. 1-3/8 I.D. 1-1/2 (38.1) I.D. 3/8 (9.52)
O.D. 7/8 (22.2) O.D. 3/4 I.D. 7/8
(38.1) (34.9) I.D. 1/2 (12.7) I.D. 3/8 I.D. 1/4
I.D. 1-5/8 (41.3) O.D. 5/8 I.D. 3/8 (9.52) (19.05) (22.2) O.D. 1/2 (12.7) (9.52) (6.35) 3-1/8 (80) I.D. 1/2
(15.88) 2-3/4 (70)
I.D. 7/8 I.D. 3/4
O.D. 3/4
(19.05) I.D. 5/8 (15.88) (12.7)
4-3/4 (120) 3-9/16 (90) 5-1/8 (130)
O.D. 1 (25.4) (22.2) (19.05)
I.D. 1/2 (12.7) O.D. 1-1/8 (28.58)
I.D. 7/8 (22.2)
I.D. 3/4 4-5/16 (110) 3-1/8 (80) 4-5/16 (110) 4-5/16 (110)
O.D. 5/8
(15.88) 2-3/4 (70) AJR54072908
4-3/4 (120)
(19.05)
AJR54072904 4-3/4 (120)
AJR72963604
Low-Pressure Vapor Pipe Liquid Pipe High-Pressure Vapor Pipe
I.D. 1-3/4 (44.48) I.D. 1 (25.4) I.D. 1-3/8 (34.9) I.D. 1-3/8 (34.9)
I.D. 1-1/2 (38.1)
I.D. 2-1/8 (53.98) I.D. 1-5/8 (41.3) I.D. 1-1/2 (38.1) I.D. 1 (25.4) I.D. 7/8 (22.2) I.D. 7/8 (22.2) I.D. 3/4 (19.05)
I.D. 1-5/8 (41.3) I.D. 1-1/8 (28.58)
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 77
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Outdoor Unit Y-Branch Kits
When installed vertically, position the Y-branch at a level lower than the outdoor units it serves, so the straight-through leg is within ±3° of
plumb. When installed horizontally, the straight-through leg must be level, and the branch leg must be within ±5° of horizontal rotation.
Outdoor unit Y-branches must always be installed with the two port ends connected to the piping coming from the outdoor units, and the
single port end towards the refrigerant piping system supporting the heat recovery unit / indoor unit. Outdoor unit Y-branches are usually
installed close to the outdoor unit, leaving enough space for servicing and maintenance.
Figure 55: 2XWGRRU8QLW<%UDQFK+RUL]RQWDO&RQ¿JXUDWLRQ Figure 56: Outdoor Unit Y-branch Vertical Installation Alignment
Straight-through Leg Branch Leg 6SHFL¿FDWLRQV
9HUWLFDO83&RQ¿JXUDWLRQIRU2XWGRRU8QLW 9HUWLFDO'2:1&RQ¿JXUDWLRQIRU
ELEVATION VIEW Y-Branches. Outdoor Unit Y-Branches NOT PER-
+5° -3° of Plumb +3° of Plumb MITTED.
-3° of Plumb +3° of Plumb
Horizontal
Plane
-5°
Y-branch Inlet
ELEVATION VIEW
To Heat Recoveryy U
Units
Field-Supplied
To Next Branch Insulation
PLAN VIEW
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
78
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Outdoor Unit Y-Branch Kits
*For example, the indicated Ø3/8 (9.52) is the outside diameter (O.D.) of the field-joined piping.
B A
I.D. 1-5/8 (41.3) I.D. 1-3/8 4-3/8 (111) I.D. 1-1/4 (31.8) I.D. 1-3/8 (34.9) I.D. 1-1/8 4-3/8 (111)
(34.9) I.D. 7/8 (22.2) I.D. 3/4 (19.05) I.D. 3/4 (19.05) 3-9/32 (83) 28.58)
I.D. 1-1/2 O.D. 1-3/8
I.D. 1-5/8 (38.1) (34.9)
(41.3)
I.D. 2-1/8 (53.98) O.D. 1-5/8 (41.3)
I.D. 1-1/8 (28.58) I.D. 1-1/8 (28.58)
I.D. 1-3/4 (44.5) I.D. 5/8 (15.88) I.D. 1/2 (12.7)
5-1/8 (130)
O.D. 3/4 (19.05) I.D. 1-1/8 (28.58) I.D. 1-3/8 O.D. 1-1/8 I.D. 7/8
I.D. 7/8 (22.2) I.D. 1-3/8 (34.9) I.D. 7/8 (22.2) (34.9) (28.58) (22.2)
O.D. 1-1/8 (28.58) O.D. 5/8 (15.88) I.D. 3/4 (19.05) I.D. 2-1/8 I.D. 1-3/4 O.D. 1-5/8
(53.98) (44.5) (41.3)
*For example, the indicated Ø3/8 (9.52) is the outside diameter (O.D.) of the field-joined piping. MEZ62225512 4/18/2017
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 79
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Header Kits
LG Header Kits Consist of: Figure 60: Vertical Header Insulation and Piping Detail (Ports Must Point
• Two headers (one liquid line, one vapor line). to an Upright Direction).
Field-Supplied Copper Piping
• Reducer fittings as applicable.
• Molded clam-shell type peel and stick insulation covers—one for
the liquid line and one for the vapor line.
ELEVATION VIEW
Headers must be installed with the main pipe level in the horizontal
plane. Distribution ports must be either level in the horizontal plane Field-Supplied Insulation Within ±3°
or within ±3° of plumb in the vertical plane. of plumb
Must be Must be
Level
When connecting indoor units to a Header, always connect the unit Level
with the largest nominal capacity to the port closest to the outdoor
unit. Then install the next largest indoor unit to the next port, working Field-Supplied Copper Piping LG Supplied Header LG Supplied Insulation Jacket
down to the smallest indoor unit.
Do not skip ports. All indoor Figure 61: Incorrect Header Con- Figure 62: ,QFRUUHFW+HDGHU&RQ¿JXUDWLRQ 3RUWV3RLQWLQJ'RZQZDUG
units connected to a single ¿JXUDWLRQ
ELEVATION ELEVATION VIEW
Header fitting must be located VIEW
with an elevation difference
between indoor units that does
not exceed 49 feet.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
80
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Header Kits
Headers
Table 38: Header Model Nos.
Headers
21-1/4 21-1/4
4-3/4 4-3/4
I.D. 1/2 I.D. 1/4
15-3/4 14-3/16
6-5/16 4-3/4
I.D. 5/8
I.D. 1/4
I.D. 1/2
4 branch I.D. 1/4
22-7/8 27-9/16
6-5/16 4-3/4
I.D. 5/8 I.D. 1/4
I.D. 1/4
7 branch ID12.7(1/2)
I.D. 1/2
29-7/8 28-3/8
6-5/16
4-3/4
I.D. 5/8
10 branch I.D. 1/2
I.D. 1/4 I.D. 1/4
5-15/16 5-15/16
ARBL1010 I.D. 5/8
I.D. 3/4 4-3/4 I.D. 3/8 4-3/4
27-9/16
30-9/16
7-3/16 21-1/2 4-1/4
I.D. 5/8 I.D. 1/4
10 branch I.D. 1/2 I.D. 1/4
I.D. 3/8
I.D. 3/4
I.D. 1-1/4 I.D. 1-1/8
I.D. 1-3/8 I.D. 5/8
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 81
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Heat Recovery Units
High
Pressure
Vapor Pipe 4
3
2 1
Vapor Pipe
Liquid Pipe Low Pressure
Vapor Pipe
Limitations
Figure 64: Close Up of the Heat Recovery Unit Connections.
1. Series connection of heat recovery units: Total
FDSDFLW\RILQGRRUXQLWV%WXK
2. Refer to the heat recovery unit PCB for valve group High Pressure Vapor Pipe
control setting.
Liquid Pipe
3. Maximum capacity of each port is 60,000 Btu/h and
eight (8) indoor units. Low Pressure Vapor Pipe
4. Do not skip ports when connecting indoor units. Remove Caps Before
Start at port 1, then use 2, then use 3, then use 4, Brazing
etc. (the numbers are displayed on the heat recov- Vapor Pipe Ø5/8 (15.88) – Ø1/2 (12.7)
Liquid Pipe Ø3/8 (9.52) – Ø1/4 (6.35)
ery ports from right to left). Brazed Connections
Removing the caps releases any gas present in the heat recovery unit. If the gas isn’t released, physical injury or death will occur from the uncon-
WUROOHGUDSLGUHOHDVHRIJDVRULIWKHJDVFRPHVLQFRQWDFWZLWKDÀDUHGXULQJEUD]LQJDQGJHQHUDWHVDSRLVRQRXVJDV
Figure 65: Preparing Unused Heat Recovery Unit Ports.
Ensure There Are No Gaps Here
On whichever port or pipe not used, the factory-provided cap must be
removed, and that port / pipe must be recapped and completely insulat- Field-Supplied Insulation
ed.
Unused Port
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
82
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Heat Recovery Units
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 83
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Heat Recovery Units
Top Side
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Top Side
Top Side
WARNING
%HIRUHEUD]LQJUHPRYHWKHJDVLQWKHKHDWUHFRYHU\XQLWE\FXWWLQJWKHWKUHHSLSHVLQWKHVPDOOFLUFOHVRQWKH¿JXUHEHORZ5HPRYHWKHFDSVEHIRUH
connecting the pipes. If not, it may cause injuries.
High Pressure
Vapor Pipe
Liquid Pipe
Low Pressure
Vapor Pipe
(Brazed Type)
Connect after removing the cap. Connect the strainer that is factory-provided as an accessory to the heat recovery unit's high pressure gas
pipe.
High Pressure
Vapor Pipe
Strainer
Liquid Pipe
Low Pressure
Vapor Pipe
After considering the indoor unit capacity, determine the pipe sizes and cut the pipes connected to the indoor unit.
Ø5/8 (15.88) Ø1/2 (12.7) Ø3/8 (9.52) Ø1/4 (6.35)
Cut Cut
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
84
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Heat Recovery System Piping
If large capacity indoor units (larger than 60,000 Btu/h) are installed, the Y-branch pipe shown in the table below must be used to twin the ports.
Unit: Inch
Kit Model
Vapor Pipe Dimensions Liquid Pipe Dimensions
No.
I.D. 7/8 (22.2) I.D. 3/4 (19.05) I.D. 1/2 (12.7)
I.D. 1 (25.4) I.D. 3/4 (19.05) I.D. 5/8 (15.88) I.D. 1/2 (12.7) I.D. 3/8 (9.52) I.D. 3/8 (9.52) I.D. 1/4 (6.35)
2
1
I.D. 3/4 (19.05) I.D. 1/2 3-1/4
I.D. 5/8 (15.88) (12.7) (83) I.D. 1/2 (12.7) 2-15/16
I.D. 1/2 (12.7)
ARBLN03321 I.D. 3/8 (9.52) I.D. 1/4 (6.35) (74)
15-3/8 (390) 3
16-1/4 (413)
12-5/8 (321)
I.D. 7/8 (22.2) I.D. 28.58 (1-1/8) I.D. 7/8 (22.2) 13-1/16 (332)
O.D. 3/4 (19.05) O.D. 1 (25.4) O.D. 3/4 (19.05) I.D. 1 (25.4)
3 1 2
• Connect / twin ports that are adjacent. Do not connect / twin ports that are not adjacent.
• Do not connect / twin more than two (2) heat recovery unit ports.
• Do not twin ports 4 and 5.
• The 72,000 and 96,000 Btu/h indoor units MUST be connected / twinned to the first and second ports of the first heat recovery unit. Smaller
indoor units (including smaller high static ducted indoor units) can be connected / twinned to any two (2) neighboring ports on one (1) heat
recovery unit.
• If the rules above are not followed, the system may not operate properly and / or malfunction.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 85
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Heat Recovery System Piping
Reducers
When installing an indoor unit to a heat recovery port, it may be necessary to cut the piping connected to the indoor unit (after considering
indoor unit capacity and determining pipe sizes). A reducer can also be installed if the indoor unit piping or outdoor unit piping is too large or
too small for the heat recovery unit connections.
O.D. 3/4 (19.05) Ø5/8 (15.88) Ø1/2 (12.7) O.D. 7/8 (22.2) Ø3/4 (19.05) Ø5/8 (15.88)
PRHR023A
O.D. 3/8 (9.52) Ø1/4 (6.35)
Heat O.D. 1/2 (12.7) Ø3/8 (9.52) O.D. 5/8 (15.88) Ø1/2 (12.7)
Recovery
Unit
Reducer
PRHR033A
PRHR043A O.D. 7/8 (22.2) Ø3/4 (19.05) Ø5/8 (15.88) O.D. 1-1/8 (28.58) Ø7/8 (22.2) Ø3/4 (19.05)
O.D. 5/8 (15.88) Ø1/2 (12.7) Ø3/8 (9.52)
PRHR063A
PRHR083A
O.D. 1/2 (12.7) Ø3/8 (9.52) O.D. 5/8 (15.88) Ø1/2 (12.7) O.D. 3/4 (19.05) Ø5/8 (15.88)
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
86
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Sample Layouts
Sample Layouts
,PDJHVDUHIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWDFFXUDWHUHSUHVHQWDWLRQV)RUVSHFL¿FGHWDLOVRQSLSLQJOLPLWDWLRQVDQGRWKHUUHIULJHUDQWV\VWHP
IHHW
height1
HRU: Heat Recovery Units. A
IDU: Indoor units.
Closest Y-branch (first)
A: Main Pipe from Outdoor Unit to First Y-branch. IDU
C
B: Heat Recovery Unit to Heat Recovery Unit, IDU
C B To
Outdoor Unit
Y-branch
To Indoor Units
98 feet*
IDU
C: Heat Recovery Unit / Header to Indoor Unit. Case 1 B
HRU
16 feet
C B B
C C
HRU
• Always reference the LATS HVAC software report. HRU IDU
(OHYDWLRQIHHW
IDU B C
Case 2
• Larger-capacity outdoor units must be the Main in a multi-frame C
Header
Brazed
system. C IDU C
C
x cap
C
• Main outdoor unit capacity must be greater than or equal to IDU IDU IDU Farthest
IDU
IDU
the Sub1 outdoor unit capacity, and, where applicable, Sub1
outdoor unit capacity must be greater than or equal to the Sub2 IDU
outdoor unit capacity. Case 1: Maximum height is 131 feet if installed with a Y-branch.
• Connection piping from branch to branch cannot exceed the Case 2: Maximum height is 16 feet in heat recovery control unit series connection.
*Up to 131 feet may be possible with certain applications. Contact LG Engineering for additional information.
main pipe diameter (A) used by the outdoor unit.
• Install the header branches or heat recovery units so that the pipe distances between the between the connected indoor units are mini-
mized. Large differences in pipe distances can cause indoor unit performances to fluctuate.
• Y-branches and other header branches cannot be installed downstream of the initial header branch.
• 7RWDOFDSDFLW\RILQGRRUXQLWVLQVHULHVFRQQHFWLRQRIKHDWUHFRYHU\XQLWV%WXK
• If large capacity indoor units (>60,000 Btu/h with piping sizes >5/8Ø / 3/8Ø) are installed, the valve group setting must be used. (Refer to
the PCB of the heat recovery unit for the valve group control setting.)
Table 41: Main Pipe (A) Diameters from Outdoor Unit to First Y-branch.
3LSHGLDPHWHUZKHQSLSHOHQJWKLVIHHWRUZKHQKHLJKW
ODU Standard Pipe Diameter GLIIHUHQWLDO 2'8Ľ,'8 LV!IHHW
Capacity
(ton) Liquid Pipe Low Pressure Vapor High Pressure Vapor Liquid Pipe Low Pressure Vapor High Pressure Vapor
(inches OD) Pipe (inches OD) Pipe (inches OD) (inches OD) Pipe (inches OD) Pipe (inches OD)
6 3/8Ø 3/4Ø 5/8Ø 1/2Ø No Increase No Increase
8 3/8Ø 7/8Ø 3/4Ø 1/2Ø No Increase No Increase
10 1/2Ø 1-1/8Ø 3/4Ø 5/8Ø No Increase No Increase
12 1/2Ø 1-1/8Ø 7/8Ø 5/8Ø No Increase No Increase
14 5/8Ø 1-1/8Ø 7/8Ø 3/4Ø No Increase No Increase
16-18 5/8Ø 1-1/8Ø 1-1/8Ø 3/4Ø No Increase No Increase
20 5/8Ø 1-3/8Ø 1-1/8Ø 3/4Ø No Increase No Increase
22-28 3/4Ø 1-3/8Ø 1-1/8Ø 7/8Ø No Increase No Increase
30-42 3/4Ø 1-5/8Ø 1-1/8Ø 7/8Ø No Increase No Increase
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 87
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Sample Layouts
Table 42: Refrigerant Pipe (B) Diameters between Y-branches and Y-branches / Heat Recovery Unit / Headers.
Downstream IDU total capacity Vapor pipe (inches OD)
Liquid pipe (inches OD)
(Btu/h) Low pressure High pressure
1/4Ø 1/2Ø 3/8Ø
<54,600 3/8Ø 5/8Ø 1/2Ø
<76,400 3/8Ø 3/4Ø 5/8Ø
<114,700 3/8Ø 7/8Ø 3/4Ø
<172,000 1/2Ø 1-1/8Ø 7/8Ø
<229,400 5/8Ø 1-1/8Ø 7/8Ø
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Conditional Applications
Conditional applications are computed in LATS. See below for an explanation of when pipes are upsized.
If the equivalent length between the first Y-branch to the farthest indoor unit is >131 feet (up to 295 feet maximum):
• Pipe segment diameters between the first Y-branch and the second Y-branch must be sized up by one. This applies to both liquid and low
pressure vapor pipes. If the next size up is not available, or if the piping segment diameters are the same as main pipe (A) diameters, sizing
up is not possible.
• :KLOHFDOFXODWLQJWKHHQWLUHUHIULJHUDQWSLSHOHQJWKSLSHOHQJWKVIRUȈ%PXVWEHPXOWLSOLHGE\WZR$ Ȉ%[ Ȉ&IHHW
• /HQJWKRISLSH & IURPHDFKLQGRRUXQLWWRWKHFORVHVW<EUDQFKRUKHDGHUIHHW
• >/HQJWKRISLSHIURPRXWGRRUXQLWWRIDUWKHVWLQGRRUXQLW $%& @>/HQJWKRISLSHIURPRXWGRRUXQLWWRFORVHVWLQGRRUXQLW $%& @IHHW
Example: When an indoor unit combination ratio of 120% is connected to a 22-ton outdoor unit:
Outdoor unit main pipe (A) diameters: 1-3/8Ø inches (vapor) and 5/8Ø inches (liquid).
1. Pipe (B) diameters: 1-3/8Ø (vapor) and 3/4Ø (liquid) (after the first branch, when indoor unit combination ratio is 120% [26 tons]).
2. $IWHUWKH¿UVWEUDQFKSLSH % GLDPHWHUVPXVWEHFKDQJHGWRLQFKHV YDSRU DQGLQFKHV OLTXLG WRPDWFKPDLQSLSH $ VL]HV
Instead of using the total indoor unit capacity to choose main pipe (A) diameters, use outdoor unit capacity to choose downstream main pipe
(A) diameters. Do not permit connection pipes (B) from branch to branch to exceed main pipe (A) diameters as indicated by outdoor unit
capacity. Example: When an indoor unit combination ratio of 120% is connected to a 20-ton outdoor unit (24 tons), and indoor unit with a
7,000 Btu/h capacity is located at the first branch:
1. Main pipe (A) diameters on a 20-ton outdoor unit: 1-1/8Ø inches (vapor) and 5/8Ø inches (liquid).
2. Pipe diameters between first and second branches, however, are: 1-3/8Ø (vapor) and 3/4Ø (liquid) (connected downstream indoor unit
capacity is 20 tons).
3. If main pipe (A) diameters of a 20-ton outdoor unit are 1-1/8Ø (vapor) and 5/8Ø (liquid), then the pipe diameters between the first and
second branches must be changed to match.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
88
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Sample Layouts
Note that the pipe diameters computed in LATS may not be standard ACR copper tube sizes that are commonly available. In these instances,
refer to the table below and use the next commonly available pipe size. Please refer to the Copper Development Association Inc. Publication
A4015-14/19: Copper Tube Handbook for additional information.
Systems designed for heat recovery operation can use also Y-branches and Headers in combination with heat recovery units.
Header
Y-Branch
Indoor Unit Indoor Unit Header
48,000 Btu/h 48,000 Btu/h
Indoor Unit Indoor Unit
Indoor Unit 12,000 Btu/h 12,000 Btu/h
Indoor Unit Indoor Unit 12,000 Btu/h
48,000 Btu/h 48,000 Btu/h
Indoor Unit Indoor Unit
24,000 Btu/h 24,000 Btu/h
,PDJHVDUHIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWDFFXUDWHUHSUHVHQWDWLRQV)RUVSHFL¿FGHWDLOVRQSLSLQJOLPLWDWLRQVDQGRWKHUUHIULJHUDQWV\VWHP
rules, review the information in this entire piping section, see the Multi V 5 LGRED Engineering Manual, and follow the LATS diagram.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 89
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Sample Layouts
,PDJHVDUHIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWDFFXUDWHUHSUHVHQWDWLRQV)RUVSHFL¿FGHWDLOVRQSLSLQJOLPLWDWLRQVDQGRWKHUUHIULJHUDQWV\VWHP
rules, review the information in this entire piping section, see the Multi V 5 LGRED Engineering Manual, and follow the LATS diagram.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
90
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Sample Layouts
Y-Branch
Indoor Unit Indoor Unit Indoor Unit Indoor Unit
Keep the sum of total Indoor Unit capacity under 230,000 Btu/h.
Heat Recovery Unit
Heat Recovery Unit
Header
Zone Control Group 1
Brazed Cap
Indoor Unit Indoor Unit Indoor Unit Indoor Unit Maximum eight (8) Indoor Units
Indoor Unit
Same Mode
Indoor Unit Y-Branches
Maximum eight (8) Indoor Units Auto Changeover
Same Mode
• One heat recovery unit branch pipe can support a maximum of 54,000 Btu/h total indoor unit cooling capacity.
• The PRHR043A heat recovery unit can support a maximum of 192,000 Btu/h total capacity and up to 32 connected indoor units (maximum
indoor units per heat recovery unit branch pipe is 8).
• Zone control groups cannot operate in “Auto changeover” or “Mode override” functions.
• In the zone control group, if some indoor units are operating in cooling or heating mode, the other indoor units cannot change over to /
operate in the opposite mode.
,PDJHVDUHIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWDFFXUDWHUHSUHVHQWDWLRQV)RUVSHFL¿FGHWDLOVRQSLSLQJOLPLWDWLRQVDQGRWKHUUHIULJHUDQWV\VWHP
rules, review the information in this entire piping section, see the Multi V 5 LGRED Engineering Manual, and follow the LATS diagram.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 91
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Sample Layouts
Incorrect Layouts
A second branch cannot be made after a Header.
Header Headerr
Header
ead Y-Branch
Heat Recovery Unit
ea Recovery Unit 1
Heat co Unit 2
Heat Recovery Header
er
Y-Branch
Indoor Unit Indoor Unit
24,000 Btu/h 24,000 Btu/h
Indoor Unit Indoor Unit IIndoor Unit
7,000 Btu/h 77,000 Btu/h 7,000 Btu/h
Indoor Unit Indoor Unit Indoor Unit Indoor Unit
48,000 Btu/h 48,000 Btu/h 48,000 Btu/h 48,000 Btu/h
Indoor Unit Indoor
ndoor Unit
Incorrect installation: Header branch pipe then a Heat Recovery Unit. 7,000 Btu/h 7,0000 Btu/h
Incorrect installation: Heat Recovery Unit, then a Header branch pipe, then a
Y-Branch and Header Branch pipe.
,PDJHVDUHIRULOOXVWUDWLYHSXUSRVHVRQO\DQGDUHQRWDFFXUDWHUHSUHVHQWDWLRQV)RUVSHFL¿FGHWDLOVRQSLSLQJOLPLWDWLRQVDQGRWKHUUHIULJHUDQWV\VWHP
rules, review the information in this entire piping section, see the Multi V 5 LGRED Engineering Manual, and follow the LATS diagram.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
92
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Piping Connections / Pipe Routes
Piping Connections for Heat Recovery Figure 68: Piping Connections for Heat Recovery Operation.
Operation Service Ports for Heat Recovery Operation
Use the correct outdoor unit connections to join the outdoor unit to the branch pip-
It is imperative that the correct outdoor unit connections be used for the intended system
operation (heat pump versus heat recovery). If the wrong connections are used, it will
result in refrigerant leaks, which will lead to system malfunction or even failure to work
at all.
Pipe Routes Figure 69: Pipe Route Options.
Choose from three pipe routes from out of the outdoor unit to the indoor unit refrigerant system:
• Front Pipe Route.
• Left Side Route (Pipes are routed through the bottom of the outdoor unit).
• Right Side Route (Pipes are routed through the bottom of the outdoor unit).
Right Side
The pipe route chosen depends on the installation area, and is at the discretion of the installer. Pipe Route
After the pipe route is chosen, the appropriate outdoor unit access holes must be knocked out
(see next page for knock out information).
Left Side
Pipe Route
Front Pipe Route
Figure 70: Front Pipe Route. Figure 71: Left and Right Side Routes (Pipes are Routed Through the
Bottom of the Outdoor Unit).
High Pressure Vapor Pipe
Liquid Pipe Liquid pipe Low Pressure Vapor Pipe
4-31/32
5-5/32
2-23/32
Liquid Pipe
High Pressure Vapor Pipe
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 93
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Knock Outs
Knock Outs
After the pipe route is chosen, installer must prepare the access holes in the front panel (front pipe route) or in the base pan at the bottom of
the outdoor unit (for left and right side pipe routes). The access holes for the communication cables and the power supply wiring can also be
knocked out at this time. See diagram below for access hole locations.
Figure 72: Heat Recovery Outdoor Unit Knock Outs.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
NOTE
• Do not damage the outdoor unit pipes or the base pan when knocking out the access holes.
• To avoid damaging the piping and power wiring / communication cables, remove any burrs that will have formed during the knock out
procedure. Make sure the access holes have smooth edges.
• To avoid damaging the power wiring / communication cables, install sleeves.
• After piping installation is complete, to prevent animals or foreign materials from damaging the outdoor unit cables / wiring, seal any holes in
with sealant, plugs, foam, caulk, putty, etc.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
94
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Removing the Leak Prevention Caps
Liquid Pipe
Low Pressure
High Pressure
Vapor Pipe
Vapor Pipe
Leak
Prevention Cap
/LQHFRQQHFWLRQGLPHQVLRQVLQWKHVSHFL¿FDWLRQWDEOHVDQGLQ/$76DUH¿HOGSLSLQJGLPHQVLRQV127WKHGLPHQVLRQVRQWKHRXWGRRUXQLWFRQQHFWLRQV
WKHPVHOYHV$GDSWHUVZLOOEHQHHGHGWRFRQQHFWWKH¿HOGSLSLQJWRWKHFRUUHFWRXWGRRUXQLWFRQQHFWLRQ DGDSWHUVDUHIDFWRU\VXSSOLHGZLWKWKHRXWGRRU
unit).
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 95
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Adapters
/LQHFRQQHFWLRQGLPHQVLRQVLQWKHVSHFL¿FDWLRQWDEOHVDQGLQ/$76DUH¿HOGSLSLQJGLPHQVLRQV127WKH
dimensions on the outdoor unit connections themselves.
1. Adapters are factory supplied with the outdoor unit, and will be needed to connect the field piping to
the correct outdoor unit connection. To install the correct adapter:
MULTI V 5 with LGRED Outdoor Unit Installation Manual
2. Review the “Heat Pump Adapter Table” below to determine the adapter type.
3. Review the “Adapter Table” on the next page to determine which adapter is to be installed on each
piping connection type. Braze the liquid and gas pipe components as shown.
• Some field-supplied long radius elbows must be tilted approximately 15° as shown in the “Heat Adapter
Table”.
WARNING
Do not braze in an enclosed location. Do not allow the refrigerant to leak during brazing. Always test for gas leaks
before and after brazing.
If the refrigerant combusts, it generates a toxic gas the will cause physical injury or death.
When installing the adapters / piping to the service valve pipe stub of the outdoor unit, always follow industry best practices and the instructions
included in this manual on brazing procedures. Always braze with a dry nitrogen purge operating at a minimum pressure of three (3) psig. The refrig-
erant may leak if the connections are not brazed properly, and / or contaminants are introduced to the piping system, leading to system malfunction.
* *
* *
* *
Ton
A (Inch [mm]) 3/8 (9.52) 3/8 (9.52) 1/2 (12.7) 5/8 (15.88) 1/2 (12.7)
5/8 (15.88) 5/8 (15.88)
B (Inch [mm]) 3/4 (19.05) 7/8 (22.2) 1-1/8 (28.58) 1-1/8 (28.58) 1-1/8 (28.58) 1-1/8 (28.58) 1-3/8 (34.9)
C (Inch [mm]) 5/8 (15.88) 3/4 (19.05) 3/4 (19.05) 7/8 (22.2) 7/8 (22.2) 1-1/8 (28.58) 1-1/8 (28.58)
*Elbow is field supplied.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
96
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
Refrigerant Piping System Installation for Heat Recovery Operation
INSTALLING FOR HEAT RECOVERY
97
OPERATION
Adapters
Inch (mm)
I.D. 1-1/8 (28.8) O.D. 1-1/8 (28.0) O.D. 7/8 O.D. 7/8 (22.2)
*Example: Ø3/8 (Ø9.52) is the outside diameter (O.D.) of the field piping.
O.D. 5/8 (15.88) (22.2)
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
8-5/8 (218.53) 7-15/16 (202)
8-1/4 (208.68)
3-3/16 (80.9) 3-7/16 (87) 4-5/16 (110)
I.D. 1-1/8 (28.8)
I.D. 1/2 (12.9) O.D. 1-1/8 (28.0) I.D. 1-1/8 (28.88) I.D. 7/8 (22.4) I.D. 1-1/8 (28.88)
I.D. 1-1/8 (28.8) O.D. 1-1/8 (28.0) O.D. 7/8 O.D. 7/8 (22.2)
O.D. 1/2 (12.7) (22.2)
12
7-15/16 (202)
8-9/16 (218.07) 8-1/4 (208.68)
3-3/16 (80.9) 3-7/16 (87) 4-5/16 (110)
I.D. 1-1/8 (28.8) I.D. 1-1/8 (28.88)
O.D. 1-1/8 (28.0)
I.D. 1/2 (12.9) I.D. 1-1/8 (28.88) O.D. 3/4 (19.05)
I.D. 1-1/8 (28.8) O.D. 1-1/8 (28.0) I.D. 3/4 (19.25)
O.D. 3/4
O.D. 1/2 (12.7)
10
(19.05)
8-9/16 (218.07) 7-15/16 (202)
7-1/16 (179.78) 4-3/4 (120)
3-3/16 (80.9) 3-7/16 (87)
I.D. 7/8 (22.4) O.D. 7/8 (22.2) I.D. 7/8 (22.4) I.D. 7/8 (22.4) O.D. 3/4 (19.05)
I.D. 3/4 (19.25)
O.D. 3/8 (9.52)
I.D. 7/8 (22.4) O.D. 7/8 (22.2)
I.D. 3/8 (9.72) O.D. 3/4
(19.05)
8
(19.05)
8 (203.85) 6-5/8 (168)
2-5/8 (66.3) 3 (76) 6-3/4 (170.78) 2-3/4 (70)
ODU Ton
Adapters
Pipe
Table 46: Adapter Table.
WITH
INSTALLING FOR HEAT RECOVERY
WITH
OPERATION
Service Ports
Heat Recovery Outdoor Unit Service Port Detail Figure 75: Heat Recovery Out-
door Unit Service Port Diagram.
1. Liquid piping service port (back seated type with 4. Stem head access with factory-provided cap.
right hand thread). 5. Schrader ports with factory-provided cap. 2
2. Low pressure vapor piping service port (back 6. 6HUYLFHSRUWSLSLQJWRFRQQHFWWR¿HOGSLSLQJ
seated type with right hand thread). 3
1 5
3. High pressure vapor piping service port (back 5
seated type with right hand thread).
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Do not expose the outdoor unit service valves to heat. Protect the service valve with a wet towel during brazing. 4
• Outdoor units ship with a factory charge of refrigerant. Always take extreme caution to prevent refrigerant gas (R410A) from leaking during use,
around fire or flame, and during brazing. If the refrigerant gas comes in contact with a flame from any source, it will break down and generate a
poisonous gas. Do not braze in a small room, or a room that is not ventilated.
• After refrigerant piping work is complete, verify that the Schrader port and service port caps are securely tightened to help prevent refrigerant gas
from leaking. Verify the system is free of leaks after refrigerant piping installation is complete. Exposure to high concentration levels of refrigerant
gas will lead to illness or death.
• Do not attempt to remove the service valve stem. Physical injury or death will occur from the uncontrolled rapid release of refrigerant.
• Before connecting the refrigerant piping, make sure the service port valves of the outdoor unit are completely closed (factory setting).
Do not open the service port valves or attempt to operate the system until the refrigerant pipe system installation has been completed.
Never open the valves before a pressure test is performed, a leak test performed, the system is evacuated, and the Commissioning Agent pro-
vides authorization to do so. Do not use polyolester (POE) or any other type of mineral oil as a thread lubricant. If introduced to the refrigerant
circuit, it will create oil sludge leading to system malfunction. Use PVE (polyvinyl ether) type refrigeration oil only.
• Protect the liquid and vapor piping / ports with a wet towel during brazing.
• Use a 15% silver phosphorous copper brazing alloy to avoid overheating and produce good flow. Do not use flux, soft solder, or anti-oxidant
agents. If the proper material is not used, oxidized film will accumulate and clog or damage the compressors. Flux can harm the copper piping or
refrigerant oil.
• When brazing the field-supplied refrigerant piping to the outdoor unit connections, flow 3 psig nitrogen into the piping. If nitrogen was not flowed
during brazing, the piping will oxidize and cause membranes to form, which will negatively impact valve and condenser operation.
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
98
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
REFRIGERANT PIPING FOR
WITH
SEPARATED OUTDOOR UNITS
Dual-frame and triple-frame systems must be installed with all outdoor units located next to each other. In conditions where the dual-frame or
triple-frame outdoor units need to be separated, the following rules must be followed (rules do not apply to single-frame outdoor units):
1. Measurements. Figure 77: Y-branch Measurement Location.
All measurements must be made from the union center of the outdoor unit Y-branch.
PLAN VIEW
Elevation
To IDUs /
33 Feet HRUs
(Max.)
Trapping
1. :KHQUHTXLUHGDOOWUDSVPXVWEHLQYHUWHGW\SHWUDSVƎLQWKHYDSRUOLQH V
a. Heat pump outdoor units would be trapped in the suction vapor line, and heat recovery outdoor units would be trapped in the
high AND low pressure vapor lines.
E,QYHUWHGWUDSVDUHGHILQHGDVDQ\SLSLQJWKDWLVƎLQDYHUWLFDOGLUHFWLRQXSWKHKRUL]RQWDOSLSHLWHOHYDWHVIURP
Figure 80: Traps for Heat Pump and Heat Recovery Systems. Figure 81: Close Up of An Inverted Oil Trap.
Heat Pump Heat Recovery Oil Trap
To To Heat Recovery Units
Indoor
Units
Suction High Pressure Vapor 8 inches
Low Pressure Vapor Oil Traps
Oil Trap Oil Trap Liquid
Liquid
Elevation
Elevation
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 99
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
REFRIGERANT PIPING FOR
WITH
SEPARATED OUTDOOR UNITS
To IDUs /
HRUs
To IDUs / HRUs
Elevation
Elevation
Oil Trap
Oil Trap
Oil Trap
Oil Trap
To IDUs / HRUs
Oil Trap
Oil Trap
Oil Trap
Elevation
more than -10° (see figure) without installing an inverted trap within
6.6' of the outdoor unit Y-branch and before the pipe slopes down-
ward toward the outdoor unit.
To indoor units /
heat recovery units
-10°
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ
100
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
REFRIGERANT PIPING FOR
WITH
SEPARATED OUTDOOR UNITS
LQFKHV
7RLQGRRUXQLWV 7RLQGRRUXQLWV
To indoor units
'XHWRRXUSROLF\RIFRQWLQXRXVSURGXFWLQQRYDWLRQVRPHVSHFL¿FDWLRQVPD\FKDQJHZLWKRXWQRWL¿FDWLRQ 101
/*(OHFWURQLFV86$,QF(QJOHZRRG&OLIIV1-$OOULJKWVUHVHUYHG³/*´LVDUHJLVWHUHGWUDGHPDUNRI/*&RUS
INSULATION
WITH
For information regarding insulation for penetration situations, see the “General Refrigerant Piping System Information” section.
Refrigerant Piping System Insulation Figure 85: Typical Pipe Insulation, Power Wire and Communications
Cable Arrangement.
All refrigerant piping from the outdoor unit to the indoor units / heat
Vapor Line
recovery units must be insulated correctly for safety and usage.
Y-branch connections, header branch connections, refrigerant Insulation Material
piping, field-provided isolation ball valves (if present), service valves,
MULTI V 5 with LGRED Outdoor Unit Installation Manual
and elbows must be properly and completely insulated using closed Liquid Line
cell pipe insulation (up to the indoor unit piping connections). To
prevent heat loss / heat gain through the refrigerant piping, all Pipe Sleeve
refrigerant piping including liquid lines and vapor lines must be
insulated separately. Insulation must be a minimum 1/2 inches thick,
Insulation
and thickness will need to be increased based on ambient conditions Material
and local codes. Table on the next page lists minimum wall thick-
ness requirements for Ethylene Propylene Diene Methylene (EPDM) Min. 18 Gauge
Power/Communication
insulation. Cable
Inside the outdoor unit, maximum pipe temperature is 248°F and Figure 86: Typical Insulation Butt-Joint at Figure 87: Typical Refrigerant
minimum pipe temperature is -40°F. For field insulation of refrigerant Indoor Unit Casing. Flare Fitting Insulation Detail.
piping between outdoor units and indoor units, consider the following
typical pipe temperature ranges for an operating heat pump system:
Due to our policy of continuous product innovation, some specifications may change without notification.
102
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
INSULATION
WITH
• Do not insulate gas and liquid pipes together as this can result in pipe leakage and malfunction due to extreme temperature fluctuations.
• Always properly insulate the piping. Insufficient insulation will result in condensation, reduced heating/cooling performance, etc. Also, if the
pipes aren’t insulated properly, condensation could potentially cause damage to building finishes. Pay special attention to insulating the
pipes installed in the ceiling plenum.
• Fully insulate the piping connections.
• Follow local codes and the designer’s instructions when selecting ethylene propylene diene methylene (EPDM) insulation wall thickness.
Table 47: Minimum Refrigerant Pipe EPDM Insulation Wall Thickness Requirements.1
Air-conditioned location Non-air conditioned location
&ODVVLÀFDWLRQ3LSLQJ2' 1. Typical Conditioned 2. Special Conditioned 3. Typical Unconditioned 4. Special Unconditioned
Location Location Location Location
ø1/4 inches
LQFKHV LQFKHV LQFKHV LQFKHV
Liquid pipe ø3/8 inches
ø1/2 inches LQFKHV LQFKHV LQFKHV LQFKHV
ø3/8 inches
ø1/2 inches
ø5/8 inches
LQFKHV
ø3/4 inches LQFKHV LQFKHV
ø7/8 inches
Insulation
Vapor pipe ø1 inch LQFK
ø1-1/8 inches
ø1-1/4 inches
ø1-3/8 inches LQFKHV
LQFK LQFK
ø1-1/2 inches
ø1-3/4 inches
1
The thickness of the above insulation material is based on heat conductivity of 0.61 Btu/in/h/ft2/°F.
Due to our policy of continuous product innovation, some specifications may change without notification. 103
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
INSULATION
WITH
(field supplied)
Insulator
Field pipe
insulator
Figure 92: Capped pipes must be insulated using the cap included in each kit, and then taped as shown.
Pipe Insulator Cap
(included with Header Kit)
Cap pipe
Tape
Additional Insulation for Y-Branches and Headers Will be Required in Humid Environments.
If the system has been operating for a long time in a high humidity environment (dew point temperature: more than 73°F), condensate is likely to
form. If this happens, install 3/8 inch thick ethylene propylene diene methylene (EPDM) insulation that is plenum-rated with a heat-resistance factor
of more than 248°F.
Due to our policy of continuous product innovation, some specifications may change without notification.
104
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
INSULATION
WITH
Field-Supplied
Refrigerant Piping
Field-Supplied Insulation for
Refrigerant Piping
Insulation
Unused Port
Due to our policy of continuous product innovation, some specifications may change without notification. 105
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
General Information
WARNING
• All power wiring and communication cable installation must be performed by authorized service providers working in accordance with local,
state, and National Electrical Code (NEC) regulations related to electrical equipment and wiring, and following the instructions in this manu-
al. Failure to do so will lead to electric shock and bodily injury or death.
• Be sure that main power to the unit is completely off before proceeding. Follow all safety and warning information outlined at the beginning
of this manual. Failure to do so will cause electric shock and bodily injury.
• Familiarize yourself with the location of the circuit breaker. Be sure that a circuit breaker or some other emergency power cutoff device is in
place before any power wiring is done to the system. Failure to do so will cause bodily injury or death.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
• Never touch any power lines or live cables before all power is cutoff to the system. To do so, will cause bodily injury or death.
• Undersized wiring will lead to unacceptable voltage at the unit and will cause a fire, which will cause bodily injury or death.
• Properly ground all outdoor units and indoor units. Ground wiring must always be installed by a qualified technician. Ground wiring is re-
quired to prevent accidental electrical shock during current leakage, which will cause bodily injury or death.
• The outdoor units are inverter driven. Do not install a phase-leading capacitor; if installed, it will deteriorate the power factor
improvement effect, cause the capacitor to generate an abnormal amount of heat, which will result in physical injury.
• Install appropriately sized breakers / fuses / overcurrent protection switches and wiring in accordance with local, state, and NEC regulations
related to electrical equipment and wiring, and following the instructions in this manual. Generated overcurrent could include some amount
of direct current. Using an oversized breaker or fuse will result in electric shock, physical injury or death.
• Do not connect ground wire to refrigerant, gas, or water piping; to lightning rods; to telephone ground wiring; or to the building plumb-
ing system. Failure to properly provide a NEC-approved earth ground can result in electric shock, physical injury or death.
• Consider ambient conditions (temperature, direct sunlight, inclement weather, etc.) when selecting, installing, and connecting the power
wiring.
• Properly ground all outdoor units and indoor units. Ground wiring must always be installed by a qualified technician. Improperly ground wire
can cause communication problems from electrical noise, and motor current leakage.
• If there is a possibility of reversed phase, phase loss, momentary blackout, or the power goes on and off while the system is operating, in-
stall a field-supplied phase loss protection circuit. If the system operates in reversed phase, etc., it will damage the compressors and other
components.
• Install appropriately sized breakers / fuses / overcurrent protection switches and wiring in accordance with local, state, and NEC regulations
related to electrical equipment and wiring, and following the instructions in this manual. Generated overcurrent will include some amount of
direct current. Using an oversized breaker or fuse will result in equipment malfunction and property damage.
• Do not connect ground wire to refrigerant, gas, or water piping; to lightning rods; to telephone ground wiring; or to the building plumb-
ing system. Failure to properly provide a NEC-approved earth ground can result in property damage and equipment malfunction.
• Verify the power imbalance is no greater than 2% between phases at each outdoor unit frame. Power imbalances will damage the compres-
sors and other components.
Due to our policy of continuous product innovation, some specifications may change without notification.
106
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
General Information
Multi V 5 outdoor units contain a temperature sensor that must not be exposed to direct sunlight. When the panel is off, cover the temperature sensor
to protect it from any direct sunlight.
WARNING
3URSHUO\JURXQGDOORXWGRRUXQLWV*URXQGZLULQJPXVWDOZD\VEHLQVWDOOHGE\DTXDOL¿HGWHFKQLFLDQ*URXQGZLULQJLVUHTXLUHGWRSUHYHQWDFFLGHQWDO
electrical shock during current leakage, which will cause bodily injury or death.
• Do not secure the power wiring and communication cables together. It will result in equipment malfunction.
• Do not run the power wiring and the communication cable in the same conduit. It will result in equipment malfunction.
Due to our policy of continuous product innovation, some specifications may change without notification. 107
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
Power Wiring and Communication Cable Terminations
Main Board
External Board
Main Power Wiring
Terminal Block
(Connect the three (3) wires
properly for the three (3)
phase wiring system.)
Figure 97: Internal Routing and Terminations in Small Frame Outdoor Units.
Power Wiring / Communication Cable Routed Through the Front Power Wiring / Communication Cable Routed Through the Bottom (Left)
Figure 98: Close Up of Wiring / Cable Connections in Small Frame Outdoor Units.
Main Power Wiring Connection Communication Cable / Ground Wiring Connections
Position the power wiring /
communication cables so that
electromagnetic interference with
Ground Wiring the oil level sensor is avoided.
Main Power
Terminal Block Outdoor Unit to Indoor Unit If the oil sensor is subjected to
Communication Cable electromagnetic interference, it
Insulation Sleeve Master Outdoor Unit to will malfunction.
Attachments Slave Outdoor Unit
Communication Cable
Ground Wiring
Due to our policy of continuous product innovation, some specifications may change without notification.
108
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
Power Wiring and Communication Cable Terminations
Figure 99: Internal Routing and Terminations in Large Frame Outdoor Units.
Power Wiring / Communication Cable Routed Through the Front Power Wiring / Communication Cable
Routed Through the Bottom (Left)
Figure 100: Close Up of Wiring / Cable Connections in Large Frame Outdoor Units.
Main Power Wiring Connection Communication Cable / Ground Wiring Connections
Position the power wiring /
communication cables so that
electromagnetic interference with
the oil level sensor is avoided.
Main Power Outdoor Unit to Indoor Unit If the oil sensor is subjected to
Terminal Block Communication Cable electromagnetic interference, it
Insulation Sleeve Main Outdoor Unit to will malfunction.
Attachments Sub Outdoor Unit
Communication Cable
Due to our policy of continuous product innovation, some specifications may change without notification. 109
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
Power Wiring / Communication Cable Connections
Terminate multiple power wires of Do not terminate two wires on Do not terminate different gauge
the same gauge to both sides. one side. wires to a terminal block.
WARNING
,ISRZHUZLUHVDUHQRWSURSHUO\WHUPLQDWHGDQG¿UPO\DWWDFKHGWKHUHLVULVNRI¿UHHOHFWULFVKRFNDQGSK\VLFDOLQMXU\RUGHDWK
• Never apply line voltage power to the communications cable terminal block. If contact is made, the PCBs will be damaged.
• Always include some allowance in the wiring length when terminating. Firmly attach the wiring or cable, but provide some slack to facilitate
removing the electrical panels while servicing, and to prevent external forces from damaging the terminal block.
• The terminals labeled “GND” are NOT ground terminals. The terminals labeled
ARE ground terminals.
• Polarity matters. Always connect “A” to “A” and “B” to “B.”
• Always create a wiring diagram that contains the exact sequence in which all the indoor units and heat recovery units are wired in relation
to the outdoor unit.
• Do not include splices or wire nuts in the communication cable.
Due to our policy of continuous product innovation, some specifications may change without notification.
110
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
Power Wiring and Communication Cable System Layout
Figure 104: Example of a Typical Heat Pump Operation Power Wiring and Communications Cable System Schematic.
3 Phase 3 Wires
Power supply
60Hz 208-230V or
60Hz 460V Main Sub 1 Sub 2
Main Switch Switch R(L1) S(L2) T(L3) R(L1) S(L2) T(L3) R(L1) S(L2) T(L3)
Communication Line
(3-wire Cable)
Indoor Units
Figure 105: Example of a Typical Heat Recovery Operation Power Wiring and Communications Cable System Schematic.
3 Phase 3 Wires
Power supply
60Hz 208-230V or
60Hz 460V Main Sub 1 Sub 2
R(L1) S(L2) T(L3) R(L1) S(L2) T(L3) R(L1) S(L2) T(L3)
Main Switch
Switch Switch Switch
Fused
Power supply Disconnect
Fused Fused
1 Phase 60Hz Disconnect Disconnect
208-230V
L1 L2
HR unit
Power Line Power Line Power Line Power Line
(2-wire Cable) (2-wire Cable) (2-wire Cable) (2-wire Cable)
Communication Line
(3-wire Cable)
Indoor Units
Due to our policy of continuous product innovation, some specifications may change without notification. 111
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
3RZHU6XSSO\3RZHU:LULQJ6SHFL¿FDWLRQV
3RZHU6XSSO\3RZHU:LULQJ6SHFLILFDWLRQV
Outdoor unit(s) and indoor units must be provided power from separate breakers.
Outdoor Units Figure 106: Outside Power Source to Outdoor
• Outdoor units are available in both 3Ø, 208-230V, 60Hz, and 3Ø, 460V, 60Hz. Unit Terminal Diagram.
• Power wiring / power wiring gauge to the outdoor unit(s) must be solid or stranded, and must 208-230V, 60Hz or 460V, 60Hz
comply with all local and NEC electrical codes. Use Copper Power Supply Wire
• Each outdoor unit must be provided a dedicated fused disconnect or breaker. Properly
MULTI V 5 with LGRED Outdoor Unit Installation Manual
WARNING
• All power wiring installation must be performed by trained service providers working in accordance with local, state, and NEC regulations
related to electrical equipment and wiring, and following the instructions in this manual. Failure to do so will lead to electric shock and bodily
injury or death.
• Use specified wiring for connections, and ensure that external force is not imparted to terminal connections. If connections firmly attached,
it will generate heat and / or cause a fire, resulting in physical injury or death.
• Install appropriately sized breakers / fuses / overcurrent protection switches and wiring in accordance with local, state, and NEC regulations
related to electrical equipment and wiring, and following the instructions in this manual. Generated overcurrent will include some amount of
direct current. Using an oversized breaker or fuse will result in electric shock, physical injury or death.
• Use the appropriate type of overcurrent protection. Generated overcurrent will include some amount of direct current, and if the appropriate
type of overcurrent protection is not installed, there is a risk of fire, electric shock, and physical injury or death.
• Ground wiring is required to prevent accidental electrical shock during current leakage, communication problems from electrical noise, and
motor current leakage. 'RQRWFRQQHFWWKHJURXQGOLQHWRWKHSLSHV7KHUHLVULVNRI¿UHHOHFWULFVKRFNH[SORVLRQSK\VLFDOLQMXU\RUGHDWK
• ,QVWDOODPDLQVKXWRIIVZLWFKWKDWLQWHUUXSWVDOOSRZHUVRXUFHVVLPXOWDQHRXVO\7KHUHLVULVNRI¿UHHOHFWULFVKRFNH[SORVLRQSK\VLFDOLQMXU\RUGHDWK
• The GND terminal at the main PCB is a negative terminal for dry contact, not a ground. Inadequate connections will generate heat, cause a
fire, and physical injury or death.
• If there is a possibility of reversed phase, phase loss, momentary blackout, or the power goes on and off while the system is operating, in-
stall a field-supplied phase loss protection circuit. If the system operates in reversed phase, etc., it will damage the compressors and other
components.
• Install appropriately sized breakers / fuses / overcurrent protection switches and wiring in accordance with local, state, and NEC regulations
related to electrical equipment and wiring, and following the instructions in this manual. Generated overcurrent could include some amount
of direct current. Using an oversized breaker or fuse will result in equipment malfunction and property damage.
• Do not connect ground wire to refrigerant, gas, or water piping; to lightning rods; to telephone ground wiring; or to the building plumb-
ing system. Failure to properly provide a National Electrical Code-approved earth ground can result in property damage and equipment
malfunction.
Due to our policy of continuous product innovation, some specifications may change without notification.
112
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
3RZHU6XSSO\3RZHU:LULQJ6SHFL¿FDWLRQV
$OO¿HOGSRZHUVXSSO\ZLULQJPXVWEHHQJLQHHUHGSHUORFDOFRGH
Due to our policy of continuous product innovation, some specifications may change without notification. 113
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
3RZHU6XSSO\3RZHU:LULQJ6SHFL¿FDWLRQV
$OO¿HOGSRZHUVXSSO\ZLULQJPXVWEHHQJLQHHUHGSHUORFDOFRGH
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Due to our policy of continuous product innovation, some specifications may change without notification.
114
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
3RZHU6XSSO\3RZHU:LULQJ6SHFL¿FDWLRQV
$OO¿HOGSRZHUVXSSO\ZLULQJPXVWEHHQJLQHHUHGSHUORFDOFRGH
Due to our policy of continuous product innovation, some specifications may change without notification. 115
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
&RPPXQLFDWLRQ&DEOH6SHFL¿FDWLRQV
&RPPXQLFDWLRQ&DEOH6SHFLILFDWLRQV)URP2XWGRRU8QLWWR,QGRRU8QLWV
Heat Recovery Units
• Communication cable from Main Outdoor Unit to Indoor Units / Heat Recovery Units is to be 18 AWG, 2-conductor, twisted, stranded,
shielded. Ensure the communication cable shield is properly grounded to the Main Outdoor Unit chassis only. Do not ground the Out-
door Unit to Indoor Units / Heat Recovery Units communication cable at any other point. Wiring must comply with all applicable local and
national codes.
• Cable shields between the connected devices must be tied together and continuous from the Main outdoor unit to the last component
connected.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
• Start the communication cable at the Main outdoor unit and route to the indoor units / heat recovery units in a daisy chain configuration.
Do not install in a starburst configuration.
• Indoor Unit / Heat Recovery Unit Communication Bus: The communication terminals are labeled differently among the indoor units, depend-
ing on type (currently for indoor units: A / B, 3[A] / 4[B], or 3 / 4; for heat recovery units: A / B). Refer to the wiring diagram schematic found
in the indoor unit itself, or to the indoor unit wiring diagrams in the Engineering Manuals for more information. Match IDU A and B terminals
on outdoor unit to A (3) and B (4) terminals on indoor units / heat recovery units.
• Insulation as required by NEC and local codes.
• Rated for continuous exposure of temperatures up to 140°F.
• Maximum allowable communication cable length is 3,281 feet.
Figure 107: Correct Main Outdoor Unit to Indoor Unit / Heat Recovery
8QLW&RPPXQLFDWLRQ:LULQJ²'DLV\&KDLQ&RQ¿JXUDWLRQ
WARNING Master Outdoor Unit
HR unit
Due to our policy of continuous product innovation, some specifications may change without notification.
116
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
&RPPXQLFDWLRQ&DEOH6SHFL¿FDWLRQV
Figure 109: Example of Main Outdoor Unit to Indoor Unit Communica- Figure 110: Example of Main Outdoor Unit to Indoor Unit Communica-
tion Cable Connections (Heat Pump Systems). tion Cable Connections (Heat Recovery Systems).
Communications Cable Between Main Outdoor Unit and Indoor Unit Communications Cable Between Main Outdoor Unit and
Main Outdoor Unit Communication Terminal Block Heat Recovery Units / Indoor Units
ODU IDU CENTRAL DRY1 DRY2 GND 12 V Main Outdoor Unit Communication Terminal Block
B A B A B A
The terminals labeled “GND” are NOT ground terminals. The terminals labeled ARE ground terminals. Inadequate connections will generate
KHDWFDXVHD¿UHDQGSK\VLFDOLQMXU\RUGHDWK
• Make sure to match IDU A and B terminals on outdoor unit to A (3) and B (4) terminals on indoor units / heat recovery units. Maintain polari-
ty throughout the communication network. The system will malfunction if not properly wired.
• Always create a wiring diagram that contains the exact sequence in which all the indoor units / heat recovery units are wired in relation to
the outdoor unit.
• Do not include splices or wire nuts in the communication cable.
From Main Outdoor Unit to Sub Outdoor Unit(s), Multi-Frame Systems Only
• Communication cable from Main Outdoor Unit to Sub Outdoor Unit(s) is to be 18 AWG, 2-conductor, twisted, stranded, shielded. Ensure the
communication cable shield is properly grounded to the Main ODU chassis only. Do not ground the communication cable at any other
point. Wiring must comply with all applicable local and national codes.
• Cable shields between the connected devices must be tied together and continuous from the Main outdoor unit to the last component con-
nected.
• Main / Sub Communication Bus: Use ODU A and B terminals on Main outdoor unit to ODU A and B terminals on Sub outdoor unit(s).
• Insulation as required by NEC and local codes.
• Rated for continuous exposure of temperatures up to 140°F.
Figure 111: Communication Cable Installation Between Main Outdoor Unit and Sub Outdoor Unit(s).
Main Sub 1 Sub 2
Due to our policy of continuous product innovation, some specifications may change without notification. 117
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
&RPPXQLFDWLRQ&DEOH6SHFL¿FDWLRQV
WARNING
• Ground wiring is required to prevent accidental electrical shock during current leakage, communication problems from electrical noise, and
motor current leakage. Do not connect the ground line to the pipes. There is risk of fire, electric shock, explosion, physical injury or
death.
• Never ground the shield of the communications cable to the indoor unit frame or other grounded entities of the building. Inadequate
connections will generate heat, cause a fire, and physical injury or death.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
• Always verify the communication cable is connected to a communications terminal on the outdoor unit(s). Never apply line voltage
power to the communication cable connection. If contact is made, the PCBs will be damaged.
• Never use a common multiple-core communications cable. Each communications bus must be provided a separate cable (i.e., between
outdoor unit(s) and indoor units, outdoor units and central controller(s). If communications cables of separate systems are wired using a
common multiple-core cable, it will result in a poor communications signal and unacceptable system operation.
Figure 112: Close up of Main Outdoor Unit to Sub Outdoor Unit(s) Communication Cable Connections.
Communications Cable Between Master Outdoor Unit and Slave Outdoor Unit(s)
Main Outdoor Unit Communication Terminal Block
B A B A B A
B A B A B A
B A B A B A
WARNING
The terminals labeled “GND” are NOT ground terminals. The terminals labeled ARE ground terminals. Inadequate connections will generate
KHDWFDXVHD¿UHDQGSK\VLFDOLQMXU\RUGHDWK
• Make sure that the terminals match (A to A, B to B). Maintain polarity throughout the communication network. The system will malfunction if
not properly wired.
• Do not include splices or wire nuts in the communication cable.
Due to our policy of continuous product innovation, some specifications may change without notification.
118
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ELECTRICAL
WITH
&RPPXQLFDWLRQ&DEOH6SHFL¿FDWLRQV
RD
BK
4 5 6
Indoor Unit
CN-REMO CN-REMO
BK RD YL
13 14 15
BACnet Common
BACnet+
Not used
Not used
Not used
BACnet-
Front Back
Between Multiple Indoor Units Figure 115: Example of Indoor Unit Group to Zone Controller
Connections (Sig-12V-GND [Comm.] Terminal).
Operating as a Group (Group
Control)
If any indoor units were specified to operate in unison:
• Before running cable, decide which indoor unit will be the “Main.”
The other indoor units in that group will be designated as “Sub(s).”
The zone controller will be connected to the “Main.” Main Indoor Unit Sub 1 Indoor Unit Sub 2 Indoor Unit
• Set the pertinent DIP switch at each indoor unit to identify the Main
MULTI V 5 with LGRED Outdoor Unit Installation Manual
and Sub(s). On wall mounted indoor unit models, set the assign- Signal 12VDC Comm. Signal 12VDC Comm. Signal 12VDC Comm.
Due to our policy of continuous product innovation, some specifications may change without notification.
120
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Triple Leak / Pressure Check
7ULSOH/HDN3UHVVXUH&KHFN
After the refrigerant piping installation is complete, perform a triple leak / pressure test to check for leaks at any joints or connections within
the piping system.
DANGER
8VLQJFRPEXVWLEOHJDVHVLQFOXGLQJR[\JHQZLOOUHVXOWLQ¿UHRUH[SORVLRQDQGUHVXOWLQVHYHUHSHUVRQDOLQMXU\RUGHDWK8VHLQHUWJDV PHGLFDOJUDGH
dry nitrogen) when checking leaks, cleaning, installing/repairing pipes, etc. The use of an 800 psig or higher nitrogen regulator is required for safety.
• Do not apply power to the Multi V outdoor unit(s), the indoor units, and the heat recovery units before performing a system leak test. There
is a possibility that the EEV valves will close and isolate sections of the piping system, making the leak test inconclusive. Contact your LG
Applied Rep or service technician for the procedure to reopen the EEV valves before the leak test 21/< if the power has been applied.
• For multi-frame outdoor units, connect the nitrogen cylinder regulator to the gauge manifold, then connect the gauge manifold to the
Schrader port on the service port of only one outdoor unit, preferably the Sub outdoor unit that is farthest away from the refrigerant piping
system and connected indoor units / heat recovery units.
• To avoid nitrogen entering the refrigerant system in a liquid state, the top of the cylinder must be higher than its bottom (used in a verti-
cal standing position) when the system is pressurized.
Pre-Setup
• Use only a leak-free gauge manifold set.
2. Verify that all outdoor unit service ports are closed. For multi-frame outdoor units, verify the service valves on all Main and Sub outdoor
units are closed and the stem head access caps are tight. The leak / pressure check is to be performed to only the refrigerant piping
system and connected indoor units / heat recovery units.
• For systems designed for heat pump operation, verify that the liquid and vapor line service ports (and to the unused service port) are
closed, and the stem head access caps are tight.
• For systems designed for heat recovery operation, verify that the hot gas line (high pressure vapor), liquid line, and suction (low pres-
sure vapor) line service ports are closed, and the stem head access caps are tight.
3. Remove the caps on the Schrader ports. Connect the (medical-grade dry) nitrogen cylinder regulator to a gauge manifold, then connect
the gauge manifold to the Schrader ports on the service ports.
• For systems designed for heat pump operation, connect the nitrogen cylinder regulator to the gauge manifold, then connect the gauge
manifold to the Schrader ports on the liquid and vapor line service ports. Do not connect to the unused port.
• For systems designed for heat recovery operation, connect the nitrogen cylinder regulator to the gauge manifold, then connect the
gauge manifold to the Schrader ports on the hot gas line (high pressure vapor), liquid line, and suction (low pressure vapor) service
ports.
For multi-frame outdoor units, connect the gauge manifold to the Schrader ports on only one outdoor unit, preferably the Sub outdoor unit that is
farthest away from the refrigerant piping system and connected indoor units / heat recovery units.
Due to our policy of continuous product innovation, some specifications may change without notification. 121
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Triple Leak / Pressure Check
4. Perform the leak / pressure check at 150 psig for five (5) minutes (standing pressure check).
5. Perform the leak / pressure check at 300 psig for fifteen (15) minutes (standing pressure check).
6. Perform the leak / pressure check at 550 psig for 24 hours to make sure the piping system is leak-free. After the gauge reading reaches
550 psig, isolate the system by first closing the gauge manifold, then close the nitrogen cylinder valve. Check the flared and brazed con-
nections for leaks by applying a bubble solution to all joints.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
The bubble solution must be a solution designed for refrigerant leak testing. Common soap solution must never be used on refrigerant piping as
those contain chemicals that could corrode copper and brass, and cause product malfunction.
7. If the pressure does NOT drop for 24 hours, the system passes the test. See how ambient conditions will affect the pressure test below.
Example: When pressure (550 psig) was applied, temperature was 80°F; 24 hours later when pressure drop (540 psig) was checked,
temperature was 68°F.
In this case, the pressure drop of 9.5 psig was due to temperature differences, therefore, there is no leak in the refrigerant piping system.
8. If the pressure drops and it is not due to ambient conditions, there is a leak and it must be found. Remove the bubble solution with a clean
cloth, repair the leak(s), and perform the leak / pressure check again.
9. After the system has been thoroughly tested and no leaks are found, depressurize by loosening the charging hose connector at the nitro-
gen cylinder regulator. When system pressure returns to normal, completely disconnect the charging hose from the cylinder, and release
the nitrogen charge from all refrigerant piping. Wipe off any remaining bubble solution with a clean cloth.
Due to our policy of continuous product innovation, some specifications may change without notification.
122
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Triple Leak / Pressure Check
Figure 117: Leak / Pressure Test for Systems Designed for Heat Pump Operation.
Schrader Schrader
Schrader Port and
Port Port
Schrader Open Service Schrader
Open Port Port Port and
Closed Closed Service
Port
Service Closed
Port Service
Closed Service Port Schrader
Gauge Manifold Port Closed Port and
Service
Closed Port
Closed
(Keep Closed)
Pipe Not Used in
(Keep Closed)
Liquid Pipe
Liquid Pipe
Vapor Pipe
Vapor Pipe
Pre-Setup
Vapor Pipe
Farthest Sub outdoor unit is the Sub outdoor unit installed farthest away from the refrigerant
piping system / indoor units.
Figure 118: Leak / Pressure Test for Systems Designed for Heat Recovery Operation.
Schrader
Port Schrader
Schrader Schrader Schrader Port
Port Closed Port
Port Closed
Open Schrader Open Service Closed
Port Port
Open Closed
Service
Nitrogen Gas Port Service Service Service
Closed
Cylinder Service Port
Closed
Port
Closed
Port
Closed
Port
Closed
Gauge Manifold
Hot Gas Pipe (High
Hot Gas Pipe (High
Pressure Vapor)
Pressure Vapor)
Pressure Vapor)
Pressure Vapor)
Liquid Pipe
Liquid Pipe
Liquid Pipe
Heat Indoor
Recovery Unit
Nitrogen Gas Unit
Cylinder
Vapor
Pipe
Farthest Sub outdoor unit is the Sub outdoor unit installed farthest away from the refrigerant piping
system / indoor units / heat recovery units.
Due to our policy of continuous product innovation, some specifications may change without notification. 123
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Triple Evacuation Procedure
• For faster evacuation, the Schrader core can be removed, and an auxiliary service port can used. Make sure to re-install the original
Schrader core before operating the system.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
• For Heat Pump systems, evacuate through both the liquid and vapor refrigerant lines. For Heat Recovery systems, evacuate through all
three (3) hot gas line (high pressure vapor), liquid line, and suction (low pressure vapor) refrigerant lines.
• The outdoor unit service valves must remain closed and the stem head access caps tight. Do not open the outdoor unit service valves
and release the factory refrigerant charge until the LG trained setup contractor authorizes to do so. The system must be left in vacuum until
the LG trained setup contractor verifies the quality of the evacuation.
• Any field-installed ball valves in the refrigerant system (if used) must be open to ensure all piping is free and clear for evacuation on all
piping and connected indoor units / heat recovery units.
• Do not apply power to the Multi V outdoor unit(s), the indoor units, and the heat recovery units before performing a system evacuation.
There is a possibility that the EEV valves will close and isolate sections of the pipe system, making the evacuation procedure inconclusive.
Contact your LG Applied Rep or service technician for the procedure to reopen the EEV valves before evacuation only if the power has
been applied.
• For multi-frame outdoor units, connect the vacuum pump / manifold to the service port Schrader ports (or core) to only one outdoor unit,
preferably the Sub outdoor unit that is installed farthest away from the refrigerant piping system and connected indoor units / heat recovery
units.
• Use only a vacuum pump that can reach 500 microns, vacuum rated hoses or copper tubing, and a leak-free gauge manifold set.
• Use only new vacuum pump oil from a properly sealed (unopened) container, and change oil in pump before (9(5< use.
• Subsequent oil changes will be necessary after several hours of continuous operation; have extra oil on hand.
• Use a quality micron gauge in good operating order and install as far away from pump as possible.
Triple Evacuation Procedure Steps
1. If this procedure is performed shortly after the leak / pressure test, the caps and cores on the Schrader ports must have already been
removed, and the manifold must already be connected. If the procedure was not performed shortly after the leak / pressure test, make
sure to remove the caps and cores on the Schrader ports. Verify that the service valves on the outdoor unit are closed, and the stem head
access caps are tight.
&RQQHFWWKHYDFXXPSXPSWRWKHJDXJHPDQLIROGDQGKRVHV2QFHWKHYDFXXPSXPSLV¿UVWRSHUDWHGLIKRVHVPDQLIROGDQGYDFXXPYDOYHVDUH
leak free (and oil is not moisture laden), the gauge must read <100 microns within one (1) minute. Do not proceed if the gauge does not read
<100 microns within one (1) minute. There is a leak in the hose, gauge manifold, or vacuum valve, and the equipment must be replaced.
2. Connect the gauge manifold along with the vacuum pump to the Schrader ports (with core removed) using vacuum hoses. Open the
gauge manifold and the vacuum pump valves.
Due to our policy of continuous product innovation, some specifications may change without notification.
124
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Triple Evacuation Procedure
3. Operate the vacuum pump and evacuate the system to the 2,000 micron level. Isolate the pump by closing the manifold gauges and
the vacuum pump valve, and then watch the micron level. Micron level could rise a bit, but MUST eventually stop rising for fifteen (15)
minutes.
• If the micron level DOES NOT stop rising, there is a leak, and the leak test must be performed again.
• If the micron level DOES rise above 2,000 micron, re-open the manifold gauges and the vacuum pump valve and continue evacuation
back down to 2,000 micron level.
• If the micron level holds at 2,000 micron, continue to step 4.
4. Break vacuum with 50 psig nitrogen purge for an appropriate amount of time (this is to “sweep” moisture from piping).
5. Purge nitrogen from the system until the pressure drops down to 1 to 3 psig.
6. Evacuate to 1,000 micron level. Isolate the pump by closing the manifold gauges and the vacuum pump valve, and then watch the micron
level. Micron level could rise a bit, but MUST eventually stop rising for fifteen (15) minutes.
• If the micron level DOES NOT stop rising, there is a leak, and the leak test must be performed again.
• If the micron level DOES rise above 1,000 micron, re-open the manifold gauges and the vacuum pump valve, and continue evacuation
back down to 1,000 micron level.
• If the micron level holds at 1,000 micron, continue to step 7.
Pre-Setup
7. Break vacuum with 50 psig nitrogen purge for an appropriate amount of time.
8. Purge nitrogen from the system until the pressure drops down to 1 to 3 psig.
9. (YDFXDWHWRVWDWLFPLFURQOHYHO
11. After maintaining the system in vacuum for one (1) hour, check if the vacuum gauge rises or not. If it doesn’t rise, then the system is properly
evacuated.
13. Shut the valve before turning off the vacuum pump.
NOTE
If the outdoor unit is moved to and installed in another site, only charge with new refrigerant after successful leak test and triple evacuation proce-
dures have been performed. If a different refrigerant or air is mixed with the original refrigerant, the refrigerant cycle will malfunction and the unit will
be damaged.
Due to our policy of continuous product innovation, some specifications may change without notification. 125
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Triple Evacuation Procedure
Schrader
Port
Vacuum Open Schrader Schrader
Schrader Port Port and
Pump Port Open Service
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Vapor Pipe
Pipe Not Used in
Liquid pipe
Pipe Not Used in
Liquid Pipe
(Keep Closed)
Vapor Pipe
(Keep Closed)
Liquid Side
Indoor Unit
Vapor Pipe
Farthest Sub outdoor unit is the Sub outdoor unit installed farthest away from the refrigerant piping
system / indoor units.
Figure 120: Triple Evacuation Diagram for Heat Recovery Systems.
Gauge Manifold
Farthest Sub Outdoor Unit Main Outdoor Unit
Vacuum
Schrader
Pump Schrader Port and
Port Service
Schrader Open Port
Port Schrader Closed
Open Port Schrader
Open Port and
Service
Service Port
Port Schrader Closed
Closed Service Port and
Port Service
Service Closed Port
Port Closed
Closed
Gauge Manifold
Hot Gas Pipe (High
Suction Pipe (Low
Pressure Vapor)
Pressure Vapor)
Pressure Vapor)
Liquid Pipe
Liquid Pipe
Vacuum
Pump
Liquid Side
Heat Indoor Unit
Recovery
Unit
Suction (Low
Pressure
Vapor)
Pipe
Farthest Sub outdoor unit is the Sub outdoor unit installed farthest away from
the refrigerant piping system / indoor units / heat recovery units.
Due to our policy of continuous product innovation, some specifications may change without notification.
126
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Vacuum Mode (Option)
Vacuum Mode (Option) (SE3, vAcc) Figure 121: Vacuum Mode Setting Locations.
The vacuum mode can be used as an option for creating vacuum in No. 5 on DIP-SW01
the system when the outdoor unit is first installed, if power is avail-
able, and if the system has already been auto addressed. Vacuum SSD
mode enables the system to fully open all valves, and can help 6:& ;&DQFHO
speed up the evacuation process.
Vacuum mode can also be used when compressor and / or outdoor
SW03C ( )RUZDUG
unit parts are replaced, or when an indoor unit is added or replaced. SW02C ( %DFNZDUG
SW01C ( &RQ¿UP
1. Turn No. 5 on the Main outdoor unit PCB DIP Switch SW01 to $XWRPDWLF$GGUHVVLQJ
ON. 6:' 5HVHW
2. 6HOHFWWKH³6Y&´PRGH%\XVLQJWKHŹDQGŻEXWWRQVWKHQSXVK
WKHƔEXWWRQ No. 5 on DIP-SW01
3. 6HOHFWWKH³6H´IXQFWLRQ%\XVLQJWKHŹDQGŻ%XWWRQVWKHQ
SXVKWKHƔEXWWRQ ON
4. Press the SW01D Reset Button one (1) time to reset PCB, and
start the vacuum mode “vACC”. In vacuum mode, the outdoor
unit valve is open, the outdoor unit EEV is open, and the indoor
OFF
unit(s) EEV(s) is/are open. The heat recovery unit(s) valve(s) and
1 2 3 4 5 6 7
Pre-Setup
EEVs are open (if system includes heat recovery units).
5. To cancel the vacuum mode, turn No. 5 on the Main outdoor unit
PCB DIP Switch SW01 to OFF, and push the SW01D reset button
on the outdoor unit PCB. On a multi-frame system, push the
SW01D reset button on ALL outdoor units.
Turn Main Outdoor Unit PCB No. 5 DIP Switch to ON. Turn on Main Outdoor Unit.
<AND>
6HOHFWWKH³6Y&´0RGH%\8VLQJWKHŹDQGŻ
%XWWRQVWKHQ3XVKWKHƔ%XWWRQ
Push the Reset Button on the Outdoor Unit PCB. On a Multi-
Frame System, Push the Reset Button on ALL Outdoor Units.
6HOHFWWKH³6H´)XQFWLRQ%\8VLQJWKHŹDQGŻ
%XWWRQVWKHQ3XVKWKHƔ%XWWRQ
• Outdoor unit operation stops during Vacuum Mode, so the com-
pressor cannot operate.
• Limit vacuum mode to less than 48 hours of continuous operation.
Start the Vacuum Mode “vACC.” If vacuum mode is not stopped, the system will continue to operate
• Outdoor Unit Valve is Fully Open. with all solenoid valves open on the non-vacuum mode terminated
• Outdoor Unit EEV is Fully Open. Sub outdoor units. The refrigerant will flood back to the compres-
sors on those non-vacuum mode terminated Sub outdoor units,
• Indoor Unit(s) EEV(s) is/are Fully Open.
which will result in poor operation, equipment malfunction and / or
• Heat Recovery Unit(s) Valves and EEVs are compressor damage.
Fully Open.
Due to our policy of continuous product innovation, some specifications may change without notification. 127
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Pre-setup Start / Outdoor Unit DIP Switch Settings
Pre-setup Process
After successfully completing the leak / pressure check and triple evacuation procedures, begin the pre-setup process. The pre-setup pro-
cess will prepare the system for setup in several steps:
1. Verify facility power is correct. 4. Run self diagnostics check. (heat recovery systems only).
2. Power up the system. 5. Assign a system address to indoor units. 7. Assign each central control device an
3. Verify power at the system is correct. 6. Assign addresses to heat recovery units address.
Multi V outdoor units require either 208-230V / 60Hz / 3Ø or 460V / 60Hz / 3Ø power. Verify that the power and phase requirements are cor-
rect and all three legs are present. Make sure that the power imbalance ratio between phases is no greater than 2%. If the electrical power is
dirty, the unit will shutdown on a compressor safety and/or the lifespan will be reduced.
Multi V outdoor units are inverter driven. Do not install a phase-leading capacitor. If one is included, it will deteriorate the power factor
improvement effect, and will cause the capacitor to generate an abnormal amount of heat.
1. Verify correct, clean, specified power is at the line side of each system component’s disconnect.
2. Note if the green LED light on the component PCB board is illuminated.
3. If an air cleaner is installed on a high static ducted model indoor unit, verify power has been provided to the air cleaner controller. Verify
by observing the LED in the center of the disconnect plate is illuminated.
4. If a zone controller (Remote Unit controller on the Hydro Kit) is connected to the component, verify the LCD screen displays current oper-
ational characteristics.
OFF OFF
1 2 3 4 5 6 7 1 2 3 4 5 6 7
1 2 3 4 5 6 7 1 2 3 4 5 6 7
6HWWLQJ2XWGRRU8QLWVLQ'XDO7ULSOH)UDPH6\VWHPV
On the DIP-SW01 bank (Main PCB), one (1) outdoor unit must be set on DIP-SW01 bank to the Main unit and the other units set to the
Sub(s) unit(s) or errors will be generated.
• For the DIP-SW01 bank on the Main unit, • For the DIP-SW01 bank on the Sub 1 unit, • For the DIP-SW01 bank on the Sub 2 unit,
all DIP switches must be set to off. set only DIP switch 6 to ON. set only DIP switch 7 to ON.
Figure 124: Main, Sub1, and Sub2 DIP Switch Settings.
Checking Outdoor Unit Settings Figure 125: Checking Outdoor Unit Settings.
Initial Display
Outdoor unit settings are sequentially displayed in the SSD five (5) seconds after applying DIP Switch
power. All displays are shown on the Main outdoor unit.
SSD
Pre-Setup
Function Modes (Func, Fn)
Modify the operation of one (1) or more components of the VRF systems. Setting a Function Mode typically impacts the universal operation
of the refrigeration system control.
For specific, more detailed information, see the instructions for each mode on the next few pages. The short list of optional modes in this
manual will be useful for installation. For other modes that will be used for service, etc., purposes, see the Multi V 5 Service Manual.
Due to our policy of continuous product innovation, some specifications may change without notification. 129
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Setting the Optional Modes Figure 126: Location of DIP Switches and Setting Buttons on the Outdoor
Unit PCB.
To access and set the different modes, first turn No. 5 on the Main DIP-SW01 SSD
outdoor unit PCB DIP switch bank SW01 to ON. Then, select the
³)XQF´³,GX´RU³6Y&´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQ
DQGWKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&
FRQILUPƔEXWWRQ
Figure 127: No. 5 on DIP Switch Bank SW01 ON.
ON
MULTI V 5 with LGRED Outdoor Unit Installation Manual
OFF
1 2 3 4 5 6 7
1 2 3 4 5 6 7
• To set the optional modes / functions, all indoor units must be OFF. SW01D SW02C SW04D
Mode / function settings won’t save, nor will operate unless all (Reset Button) (ŻBackward (x Cancel
Button) Button)
indoor units are OFF. SW03C
• If system power was reset, some modes / function settings will SW01C (ŹForward
(Confirm / Automatic Button)
be automatically saved in the EEPROM. Other modes / functions Address Setting Button)
will reset when power is cycled off. See next pages for details on
specific modes / functions.
Table 49: Optional Modes.
Mode Selection Selection Selection
Notes
Content Display Mode / Function Name Display Default Options
Fault Detection
Fdd Integrated Test Run Fd7 - -
and Diagnostics
Saved in EEPROM;
Cool / Heat Selector Switch (Installed) Fn1 oFF oFF, oP1~oP2
Off = Not Installed
Static Pressure Compensation Fn2 oFF oFF, oP1~oP3 Used for ducted discharge
Night Low Sound Fn3 oP10 oP1~oP12
Off = Split Coil / Frame
Overall Defrost Fn4 oFF on, oFF
Allowed
Outdoor Unit Addressing Fn5 0 0~254 Saved in EEPROM.
Snow Removal Assist / Rapid Defrost Fn6 oFF oFF, oP1~oP3 Saved in EEPROM.
Low Ambient Kit Fn9 oFF on, oFF Saved in EEPROM.
High Efficiency Mode (Cooling Operation) Fn10 oFF on, oFF Saved in EEPROM.
Function Func High Efficiency Mode Cooling Operation
Fn11 oFF oFF, oP1~oP5 Saved in EEPROM.
(Auto Dust Throw)
Saved in EEPROM.
Can use in all applications
Smart Load Control Fn14 oFF oFF, oP1~oP3
except DOAS. Energy
saving feature.
Humidity Reference Fn16 oFF on, oFF Saved in EEPROM.
Power Consumption Display on Wired
Fn21 oFF oFF, Pd10, Pd11 Saved in EEPROM.
Remote Controllers
Overall Defrost Operating in Low
Fn22 oFF on, oFF Saved in EEPROM.
Temperature (Heating)
Drain Pan Heater (Optional Accessory) Fn23 oFF on, oFF Saved in EEPROM.
User Idu Comfort Cooling Id10 EAch Saved in EEPROM
Service SvC Vacuum Mode SE3, vAcc vAcc - One Time / One Selection
Due to our policy of continuous product innovation, some specifications may change without notification.
130
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
• Temperature Range (Error occurs when temperatures are out of All IDUs thermal on but ODU
system operation range.) controls EEV pulses of each IDU
• Indoor Unit: 64.4°F ~ 89.6°F. independently for testing purposes.
• Outdoor Unit: 32°F ~ 109.4°F.
• When the function is not used, set the DIP Switch to OFF and reset Save data.
the power.
• If an indoor unit error occurs, the indoor unit will operate in fan
mode only. The indoor unit number that the error occurred on will
not be displayed.
All IDU operation (refrigerant
check) and save data.
Pre-Setup
Switchover four-way valve.
System off.
OK 5-Cn
Due to our policy of continuous product innovation, some specifications may change without notification. 131
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
OK 6-Cn
OK 7-Cn
Outdoor Unit
NG (NOT GOOD) 7-C1
Main EEV
ITR
• Temperature Range (Error occurs when temperatures are out of system operation range.)
• Indoor Unit: 64.4°F ~ 89.6°F.
• Outdoor Unit: 32°F ~ 109.4°F.
• When the function is not used, set the DIP Switch to OFF and reset the power.
Due to our policy of continuous product innovation, some specifications may change without notification.
132
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Unlike previous versions of Multi V where the user selected heating or cooling mode for the Integrated Test Run function, Multi V 5 automatically
selects which mode to use based on outside air temperature.
Procedure
1. Connect a computer with LGMV software to the Main ODU.
2. Start the LGMV software.
3. Select ID7 on the Main outdoor unit seven segment display (SSD).
4. “INIT ITR” will be displayed (Initiate Integrated Test Run)
5. Use the SSD and the control buttons below it to enter the system refrigerant charge by weight in kilograms. The system refrigerant charge
is the sum of the field provided refrigerant charge and the factory refrigerant charge shipped with each outdoor unit.
Pre-Setup
6HHWKHVSHFL¿FDWLRQWDEOHVLQWKH3URGXFW'DWDVHFWLRQIRUWKHIDFWRU\UHIULJHUDQWFKDUJHLQSRXQGV
Example:
ARUM432BTE5
• Consisting of (2) ARUM121BTE5 + (1) ARUM192BTE5
• Factory charge ARUM121BTE5 = 23.2 lbs each
• Factory charge ARUM192BTE5 = 30.9 lbs
• Field trim charge : 10.5 lbs
System refrigerant charge = (Factory charge of frame 1 + Frame 2 + Frame 3)+(Field-supplied Refrigerant)
System refrigerant charge = (23.2 + 23.2 + 30.9) + 10.5 = 87.8 lbs.
Due to our policy of continuous product innovation, some specifications may change without notification. 133
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Installation Information
Name Company / Address product composition
Installer Outdoor unit 1
CIQ Indoor unit 4
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Supervisor HR unit 0
Site Total refrigerant quantity 10.3 Kg
* Please make sure that the product configuration information
. matches the actual installation.
Normal
- Normal
Amount of refrigerant : 10.2kg
$OZD\VFKHFNWKHDPRXQWRIUHIULJHUDQWLQWKH5HSRUWÀDVKLQJRQGLVSOD\PHDQVWKHUHIULJHUDQWLVZLWKLQDFFHSWDEOHRSHUDWLQJSDUDPHWHUV7KH
ITR report will give a more accurate analysis of the charge.
ODU EEV
pulse 30 65 130 0 0 0 0 0 0 0 0 0 -
Discharge
superheating - - 22 - - 0 - - 0 - - 0 10 ~ 50°C
( °C )
Suction
superheat. - - 13.8 - - 0 - - 0 - - 0 0.5 ~ 30°C
( °C )
Subcooling
( °C )
- - 19.2 - - 0 - - 0 - - 0 0.5 ~ 20°C
INV1 Discharge
temperature - - 84 - - 0 - - 0 - - 0 50 ~ 100°C
(°C)
INV2 Discharge
temperature - - 82 - - 0 - - 0 - - 0 50 ~ 100°C
(°C)
Input
voltage 380 380 380 0 0 0 0 0 0 0 0 0 345~456V
(V)
Phase
current 10 10 10 0 0 0 0 0 0 0 0 0 20AĻ
(A)
INV1 CT
current - - 15 - - 0 - - 0 - - 0 24AĻ
(A)
INV2 CT
current - - 15 - - 0 - - 0 - - 0 24AĻ
(A)
Due to our policy of continuous product innovation, some specifications may change without notification.
134
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Switch
• Off (Default): No Cool / Heat Selector installed, or the Cool / Heat Selector is installed, but has not (Down)
been identified by the Main outdoor unit.
• On: Cool / Heat Selector installed and operational. When On is selected:
• The left side of the upper switch is depressed. Mechanical refrigeration is locked out and the indoor
unit fans are allowed to operate. The position of the lower switch is irrelevant.
• The right side of the upper switch is depressed, the lower switch has the right side depressed, and
the system is operating in cooling.
• The right side of the upper switch is depressed, the lower switch has the left side depressed, and the
Pre-Setup
system is operating in heating.
Use the Cool / Heat Selector in heat pump systems to set the system mode for all cooling operation, all
heating operation, fan only, or dry operation (when all indoor units have to be in the same mode).
For use in heat pump systems only.
The Cool / Heat Selector function is set. PCB does not need reset.
Due to our policy of continuous product innovation, some specifications may change without notification. 135
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Static Pressure Compensation Figure 130: Setting the Static Pressure Compensation Function.
Function (Fn2) Turn No. 5 on the Main outdoor unit PCB
DIP switch bank SW01 to ON.
Static Pressure Compensation function modifies the maximum
outdoor unit fan speed during normal system operation. Use the
function to raise the maximum outdoor unit fan speed to compensate 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
for an obstruction (duct) in airflow. 6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUP
ƔEXWWRQ
The default outdoor fan external static pressure rating for Multi V 5
Outdoor Units is 0.16 in-wg. Selecting “op3” raises the fan speed to
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Press the SW01D Reset Button one (1) time to reset PCB.
• Ask a trained LG service provider to set this function during system The selected option value is saved in the EEPROM.
installation.
• If the outdoor unit RPM is changed, cooling capacity will be re-
duced.
Due to our policy of continuous product innovation, some specifications may change without notification.
136
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Night Low Sound Function (Fn3) Figure 131: Setting the Night Low Sound Function.
The Night Low Sound Function reduces the operating speed of the Turn No. 5 on the Main outdoor unit PCB
outdoor unit fans (according to the input signal) during “off-peak” DIP switch bank SW01 to ON.
hours under normal circumstances when in cooling mode. Operating
at a low RPM reduces the fan sound levels of the outdoor unit at 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
night (or other off-peak hours), which usually has a low cooling load. 6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUP
On a rolling 24 hour basis, an internal timer begins counting hours ƔEXWWRQ
after the start time (delay set after peak cooling recorded operation),
switching to restricted fan speed duration operation, following what- 6HOHFWWKH³)Q´IXQFWLRQE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQG
ever settings have been chosen. WKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&
For use on both heat pump and heat recovery systems. FRQILUPƔEXWWRQ
• Oil return is considered an abnormal condition. Select from “op1” through “op12” options (see table) by using the
• Timed algorithm. Restricted fan speed period length and start delay 6:&IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQ
is selectable. DQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
• Delay timer starts each day when, during a one (1) minute period
the highest demand for cooling is recorded by the outdoor unit. Press the SW01D Reset Button one (1) time to reset PCB.
The Night Low Sound function is set; the selected option value is
saved in the EEPROM.
Pre-Setup
Table 52: Setting the Time and Related Sound Level.
Start Time Restricted Fan Speed Duration Approximate Noise Level dB(A)
Settings (Delay after Peak Cooling Recorded) (Hour)* (Hour) 6 Ton 8 to 20 Ton
op1 8.0 9.0 55 59
op2 6.5 10.5 55 59
op3 5.0 12.0 55 59
op4 8.0 9.0 52 56
op5 6.5 10.5 52 56
op6 5.0 12.0 52 56
op7 8.0 9.0 49 53
op8 6.5 10.5 49 53
op9 5.0 12.0 49 53
op10 (Default) 0.0 (Continuous Operation) 24.0 55 59
op11 0.0 (Continuous Operation) 24.0 52 56
op12 0.0 (Continuous Operation) 24.0 49 53
*The system measures ambient temperature (minimum and maximum) in “Wait Time” to help determine when the system can start operating in Night Low Sound.
Due to our policy of continuous product innovation, some specifications may change without notification. 137
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
(Overall) Defrost Function (Fn4) Figure 132: Setting the Overall Function.
Overall Defrost Function allows the outdoor unit to operate in either Turn No. 5 on the Main outdoor unit PCB
full frame / full coil (overall) defrost or in full system defrost. When DIP switch bank SW01 to ON.
selected, the Intelligent Defrost algorithm can no longer choose
split-coil or partial frame (in multi-frame systems) defrost. System 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
pressure, outdoor unit coil temperatures, and outdoor ambient 6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUP
temperatures (and humidity if Fn16 - Humidity Reference) could ƔEXWWRQ
determine when the defrost cycle initiates.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Use in locations where relative humidity remains high during the 6HOHFWWKH³)Q´IXQFWLRQE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQG
heating season, or in applications where it has been proven that WKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&
operating all of the outdoor units in defrost at the same time saves FRQILUPƔEXWWRQ
energy, and / or shortens the defrost time without impacting comfort
levels. Select from “on” through “oFF” options (see table) by using the
Can also be used with Fn6 - Rapid Defrost, and Fn22 - Overall 6:&IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQ
Defrost Operating in Low Temperatures (Heating). DQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
For use on both heat pump and heat recovery systems.
Defrost Mode is set. PCB does not need reset.
Table 53: Setting the Overall Defrost Function.
Options Function
System Operates in Partial-Coil Defrost A trained LG service provider must set this function during system
oFF (Default)
(or Partial Frame Defrost in Multi-Frame Systems) installation.
on System Operates in Full Frame (Overall) Defrost Only
Outdoor Unit Addressing Function Figure 133: Setting the Outdoor Unit Address Function.
(Fn5) Turn No. 5 on the Main outdoor unit PCB DIP
switch bank SW01 to ON.
Use this function to set addresses when more than one Multi V
system shares a communications bus linked to a central controller
or BMS gateway. Each system is assigned to a unique outdoor 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQG
unit address. The Outdoor Unit Addressing Function will help avoid WKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&
assigning the same address to the different systems; if not properly FRQILUPƔEXWWRQ
addressed, a communication error could occur on one (1) or more of
the systems.
6HOHFWWKH³)Q´IXQFWLRQE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQG
For use on both heat pump and heat recovery systems. WKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&
FRQILUPƔEXWWRQ
• 000 = Default; Central Control Address setting of “000”.
• 001 = Central Control Address setting of “001”.
Select from 0 (Default) through 254 by using the SW03C forward
• Set 1 of 255 Valid Addresses; 000, 001, 002, 003, 004...through ŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVV
254. WKH6:&FRQILUPƔEXWWRQ
Due to our policy of continuous product innovation, some specifications may change without notification.
138
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
6QRZ5HPRYDO$VVLVW5DSLG'HIURVW Figure 134: Setting the Snow Removal / Rapid Defrost Function.
Function (Fn6) Turn No. 5 on the Main outdoor unit PCB
DIP switch bank SW01 to ON.
Snow Removal Assist
Snow Removal Assist function allows the outdoor unit(s) fans to 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
operate at regular intervals, for two (2) minutes, at specified speeds 6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUP
(as seen in the tables below) to remove snow accumulation from the ƔEXWWRQ
fan discharge.
The function will only operate when the system has not called for 6HOHFWWKH³)Q´IXQFWLRQE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQG
compressor activity (no demand for heating or cooling) for thirty (30) WKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&
minutes, and when the outdoor air temperature is <37ºF. Operates FRQILUPƔEXWWRQ
every thirty (30) minutes for two (2) minutes. Function will stop if
there is an operation error code, or if a compressor starts. Use this
function in areas where snow accumulating on the fan blades and Select from “oFF,” “op1” through “op3” options (see table) by using the
fan guard is common. 6:&IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQ
DQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
Rapid Defrost
Rapid Defrost function limits the amount of frost and ice are allowed The Snow Removal / Rapid Defrost function is set.
PCB does not need reset.
to build on the coil between defrost cycles (defrost cycles occur
Pre-Setup
more often). System pressure is monitored, and when system pres-
sure is reduced, the defrost cycle is initiated.
Snow Removal Assist and Rapid Defrost can be used on both heat
pump and heat recovery systems.
Due to our policy of continuous product innovation, some specifications may change without notification. 139
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
/RZ$PELHQW.LW)XQFWLRQ )Q Figure 136: Setting the Low Ambient Kit Function.
The function notifies the outdoor unit that a low ambient kit is Turn No. 5 on the Main outdoor unit PCB DIP
installed. Use in zones that will need cooling when outdoor ambient switch bank SW01 to ON.
temperatures fall below 5ºF.
Optional low ambient baffle kits allow for Multi V 5 outdoor unit 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
operation down to -9.9°F. When used with heat recovery operation, 6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUP
low ambient cooling to -9.9°F is possible only when all indoor units ƔEXWWRQ
are operating in cooling mode. Also when used with heat recovery
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Due to our policy of continuous product innovation, some specifications may change without notification.
140
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Pre-Setup
The Auto Dust Mode function is not a substitute for coil cleaning and The High Efficiency Function in Cooling Operation (Auto Dust Throw)
does not clear the coil of all debris. A coil cleaning procedure must be is set. PCB does not need reset.
included when performing regular preventative maintenance.
Due to our policy of continuous product innovation, some specifications may change without notification. 141
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Smart Load Control (SLC) Function Figure 138: Setting the Smart Load Control Function.
(Fn14) Turn No. 5 on the Main outdoor unit PCB
DIP switch bank SW01 to ON.
Smart Load Control Function will assist in reducing energy by lower-
ing compressor lift during off-peak hours and shoulder seasons. The
function adjusts compressor lift by reading outdoor ambient tempera- 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
ture, humidity (if FN16 is set to on), and current heating or cooling SW02C backward
demand in real time (rolling twenty [20] minute log). ŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
MULTI V 5 with LGRED Outdoor Unit Installation Manual
All three (3) options only run for twenty (20) minutes of operation Press the SW01D Reset Button one (1) time to reset PCB. The
after a compressor start. Following the twenty (20) minute morning Smart Load Control function is set.
warm-up (or cool-down period), Smart Load Control will then use the
same algorithm irrelevant of which Smart Load Control option selected. If the outdoor unit is operating in cooling, Smart Load Control adjusts
the target low pressure; if the outdoor unit is operating in heating, Smart Load Control adjusts the target high pressure.
Smart Load Control can be used in almost every application except those where the outdoor unit is supporting a Dedicated Outdoor Air
System (contact an LG representative for information). Smart Load Control will not have an impact on operation if the system is running in
simultaneous cooling / heating (heat recovery systems only).
Due to our policy of continuous product innovation, some specifications may change without notification.
142
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Humidity Reference (Fn16) Figure 140: Setting the Humidity Reference Function.
When humidity reference is selected (on), the Main outdoor unit Turn No. 5 on the Main outdoor unit PCB
microprocessor considers the outdoor ambient humidity condition DIP switch bank SW01 to ON.
when making adjustments to the control values of the refrigeration
cycle. Records humidity every minute, and uses the last twenty (20)
minutes of data to calculate current humidity and dewpoint. 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUP
The Humidity Reference function is used by Smart Load Control ƔEXWWRQ
(FN14), Comfort Cooling (ID10), and core logic Intelligent Defrost –
Smart Heating algorithms to prepare the system for changes in the
building load. 6HOHFWWKH³)Q´IXQFWLRQE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQG
WKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&
For use on both heat pump and heat recovery systems. FRQILUPƔEXWWRQ
Table 60: Setting the Humidity Reference.
Settings Function Select from “oFF” or “on” options (see table) by using the SW03C
oFF (Default) Mode Not Set; Disabled IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQDQGWKHQ
on Humidity Reference On SUHVVWKH6:&FRQILUPƔEXWWRQ
Pre-Setup
because the evaporation temperature decreases.
• If high humidity conditions exist when the system is operating in heating mode, defrost mode will be delayed because target high / low
pressure will be changed (Intelligent Defrost - Smart Heating).
• If Comfort Cooling is selected for one (1) or more indoor units, then the superheat reset will be delayed or will not reset at all under humid
outdoor conditions. See the Multi V 5 Service Manual.
Power Consumption Display (Fn21) Figure 139: Setting the Power Consumption Display Function.
The function tells the outdoor unit (Main outdoor unit if a multi-frame Turn No. 5 on the Main outdoor unit PCB
system) that power consumption must be monitored. The function DIP switch bank SW01 to ON.
also communicates to the outdoor unit if it will be responsible for re-
porting the data to the central control device(s), or if an (optional) LG 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
Power Distribution Integrator (PDI) will be responsible for reporting. 6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUP
When the optional PDI is installed, the PDI will monitor outdoor unit ƔEXWWRQ
power consumption. PDI allocates outdoor unit power consumed to
indoor units based on the volume of refrigerant flow through each 6HOHFWWKH³)Q´IXQFWLRQE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQG
indoor unit during the billing period. WKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&
Power consumption data can then be viewed using an LG ACP or FRQILUPƔEXWWRQ
AC Smart central controller, LG MultiSite Communications Manager,
and LG zone controllers. For installations where a third-party BMS Select from oFF, “Pd10,” or “Pd11” options (see table) by using the
system is present, consumption data is also made available for 6:&IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQ
through LG’s BACnet Gateway. DQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
For use on both heat pump and heat recovery systems.
The Power Consumption Display function is set.
Table 59: Setting the Power Consumption Function. PCB does not need reset.
Due to our policy of continuous product innovation, some specifications may change without notification. 143
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Overall Defrost Operating in Low Figure 141: Setting the Low Temperatures Defrost Function (Heating).
Temperatures (Heating) (Fn22) Turn No. 5 on the Main outdoor unit PCB
DIP switch bank SW01 to ON.
The Overall Defrost Operating in Low Temperatures function
overrides LG’s Intelligent Defrost algorithm, and first defrosts the
lower half of the coil, and then defrosts the full coil. On multi-frame 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH
systems, all frames are in defrost simultaneously. Defrost operation 6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUP
occurs every three (3) hours, irrespective of need, whenever the ƔEXWWRQ
RXWGRRUDLUWHPSHUDWXUHLV)
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Drain Pan Heater (Optional) Figure 142: Setting the Base Pan Heater Function.
Function (Fn23) Turn No. 5 on the Main outdoor unit PCB DIP switch bank SW01 to ON.
Informs the Main outdoor unit microprocessor that
an optional field-installed drain pan heater (sold 6HOHFWWKH³)XQF´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH6:&
separately) is installed. The optional drain pan EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
heater maintains the bottom of the outdoor unit
>32ºF to keep condensate from freezing.
Selecting to engage this option must only be done 6HOHFWWKH³)Q´IXQFWLRQE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH6:&
if a properly sized pan heater is in place to keep EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
the bottom surface of the outdoor unit >32°F. The
microprocessor will power outdoor unit PCB termi-
6HOHFWIURP³R))´RU³RQ´RSWLRQVE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH6:&
nal CN25 when at least one (1) compressor in the EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
frame is operating, the outdoor air temperature is
<39ºF, and either the following conditions occur:
The Drain Pan Heater Operation Function is set.
1. Outdoor unit is operating in heating. PCB does not need reset.
2. Outdoor unit is in defrost.
Table 62: Setting the Drain Pan Heater Function.
The controller will shut off the drain pan heating Settings Drain Pan Heater Kit Installed
operation when the outdoor air temperature rises oFF (Default) No
>39ºF, or when all compressors stop operating.
on Yes
On multi-frame systems, it is possible for one (1) or more frame(s) to be operating in heating, and have another frame operating in cooling. Setting
value must be set on a per frame basis on multi-frame systems.
Due to our policy of continuous product innovation, some specifications may change without notification.
144
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting the Optional Modes
Turn OFF all indoor units where Comfort Cooling will be applied. Comfort Cooling cannot be applied to any indoor unit that is ON.
Turn No. 5 on the Main outdoor unit PCB DIP switch bank SW01 to ON.
6HOHFWWKH³,GX´PRGHE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
Pre-Setup
6HOHFWWKH³,G´IXQFWLRQE\XVLQJWKH6:&IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQDQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQ
Select which indoor units will operate in Comfort Cooling. Select “ALL” if Comfort Cooling is to be applied to all indoor units. Select “EACH”
if Comfort Cooling is to be applied to some indoor units. After the selection is made, SUHVVWKH6:&FRQILUPƔEXWWRQ
If “EACH” was selected, the indoor units that are to be operating in Comfort Cooling must be identified. Use WKH6:&IRUZDUGŹEXWWRQ
DQGWKH6:&EDFNZDUGŻEXWWRQWRVFUROOWKURXJKWKHOLVWRILQGRRUXQLWVRQWKHV\VWHPDQGWKHQSUHVVWKH6:&FRQILUPƔEXWWRQWRFKRRVH
Use LGMV to identify the addresses of the indoor units on the system.
The maximum amount of superheat reset that Comfort Cooling allows must be selected. Range is displayed in °C, and the higher the value
chosen, the higher the leaving air temperature will be allowed in Comfort Cooling.
7KH¿UVWRQHWZRGLJLWVRQWKHRXWGRRUXQLW3&%66'LGHQWLI\WKHDGGUHVVRIWKHLQGRRUXQLWEHLQJVHWIRU&RPIRUW&RROLQJWKHODVWWZRGLJLWVUHS-
resent the current Comfort Cooling range assigned to that indoor unit. (See the “Setting Comfort Cooling Operation” table for the available options.)
Use WKH6:&IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQWR¿QGWKHDSSURSULDWH&RPIRUW&RROLQJVHWWLQJ$IWHUWKHVHOHFWLRQLVPDGH
SUHVVWKH6:&FRQILUPƔEXWWRQ
Repeat previous three (3) steps for all indoor units chosen for Comfort Cooling operation. Use WKH6:&EDFNZDUGŻEXWWRQWRDFFHVVWKHLQGRRU
units on the system. Use WKH6:&IRUZDUGŹEXWWRQDQGWKH6:&EDFNZDUGŻEXWWRQWR¿QGWKHDSSURSULDWH&RPIRUW&RROLQJVHWWLQJ$IWHUWKH
selection is made, SUHVVWKH6:&FRQILUPƔEXWWRQ
$IWHUDOOLQGRRUXQLWVKDYHEHHQVHWSUHVVWKH6:&EDFNZDUGŻEXWWRQPXOWLSOHWLPHVWRUHWXUQRUWRH[LWWKHVHWWLQJPHQX
Turn No. 5 on the Main outdoor unit PCB DIP switch bank SW01 to OFF.
The Comfort Cooling Operation mode is set. No outdoor unit PCB reset or power cycle required.
Due to our policy of continuous product innovation, some specifications may change without notification. 145
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Self Diagnostics Check
If the indoor units have already been successfully assigned a system address, skip this step and
go to “Assign Addresses to the Heat Recovery Units.”
1. Power all indoor units.
2. Power all heat recovery units in conjunction with powering indoor units (heat recovery
systems only).
3. Verify the outdoor units to indoor units / heat recovery units communications cable is
installed and terminated correctly.
4. Verify the communications cable between outdoor unit frames is installed and terminated SW01D SW02C SW04D
correctly. Inspect terminals (SODU [B] and SODU [A]) at each outdoor unit. (Reset Button) (ŻBackward (x Cancel
Button) Button)
5. Verify that DIP Switches 6 and / or 7 on the Sub outdoor unit(s) were properly adjusted
for the job site configuration. SW03C
SW01C (ŹForward
6. Power all outdoor units. Order does not matter on multi-frame installation. (Confirm / Automatic Button)
7. As the power is provided to the main printed circuit board (PCB) on the Main outdoor Address Setting Button)
unit, observe the SSD.
• Wait. The perimeter segments will flash in sequence for 45 Figure 145: DIP Switch Bank SW01 Settings.
seconds. ON ON
• Verify the microprocessor’s outdoor unit configuration agrees
with the submittal information approved the design engineer OFF OFF
1 2 3 4 5 6 7 1 2 3 4 5 6 7
(see Tables below). 1 2 3 4 5 6 7 1 2 3 4 5 6 7
• Confirm that this step has been completed by checking the box
provided on the Record following the information as it is provided. The date is provided
in sequence, and segment of the sequence will remain lit for two (2) seconds.
• Supply power to the indoor units. If power is not supplied, an operation error will occur.
• During the pre-setup process for systems with Gen 4 indoor units, do not change any DIP switch settings except for No. 3 on SW01B,
which must be ON to enable Gen. 4 features. All other combinations of switches (one [1] through seven [7]) must be left in the OFF position
on the outdoor unit DIP switch bank SW01B. Refer to System Combinations and Outdoor Unit Operation Settings for proper setting of No. 3
on SW01B.
• If the Auto Address Procedure has never been successfully completed for the system, the compressor(s) will not start when power is applied
to the unit.
• Auto addressing is only possible on the main PCB of the outdoor unit (Main unit if dual / triple frame system).
• If an indoor unit PCB has been replaced, the auto addressing procedure must be performed again.
1. Verify all that all indoor units connected to the system have power to the PCB board AND all wired controller system start buttons are OFF.
2. Remove the maintenance access panel and unit control box cover from the outdoor unit. Place panels and screws in a secure area.
Pre-Setup
3. Verify that the communications cable between the indoor units and the outdoor unit is terminated at the outdoor unit terminals IDU(A) and
IDU (B). Connect the central control cable to the outdoor unit central control terminals.
4. Verify the shield on the communications cable is grounded at the outdoor unit.
5. If installing a dual- or triple-frame system, verify which outdoor unit will be the “Main” unit, the Sub1 unit, and the Sub2 unit; check if the
DIP switches on DIP-SW01 are set properly. (See “Setting Outdoor Units in Dual / Triple Frame Systems” under “Pre-setup / Outdoor Unit
DIP Switch Settings” earlier in this section.)
6. Cycle power on the outdoor units, indoor units, etc., and wait three (3) minutes while the outdoor unit sequences through the self-diagnos-
tics check, and to improve indoor unit communication when initial power is supplied. Leave disconnect in the "ON" position.
7. Check the outdoor unit(s) current configuration code(s). Observe the unit setup codes using the SSD display found on the outdoor units
PCB.
After the self-diagnostics check is complete, the SSD must be clear and nothing displayed. Diagnostic process could take from three (3) to seven (7)
minutes.
8. Know how many indoor units are connected to the system.
9. Press and hold the red SW01C button for about five (5) seconds. Release when “88” appears on the SSD of the Main outdoor unit PCB.
After three (3) to seven (7) minutes, the display will flash a number for about thirty (30) seconds, indicating how many total indoor units
the system successfully communicated with.
10. This number must match the known installed number of indoor units if the auto addressing procedure was successful. If using LGMV,
read the address of each indoor unit. The address of each indoor unit is also indicated on wired remote control displays.
11.Upon completion of the auto addressing routine, the display will be blank and the system will be in standby waiting for another command.
12. Upon successful completion of the auto address procedure, record the system address assigned to each indoor unit by the auto address
procedure in the column provided on the Pre-setup Device Configuration Worksheet.
Due to our policy of continuous product innovation, some specifications may change without notification. 147
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Indoor Unit Auto Addressing
Indoor Unit Auto Addressing Procedure, continued. Figure 146: Auto Addressing Button Location on
Outdoor Unit PCB.
13. After recording the system addresses assigned to each device, open the outdoor
unit disconnect. Remove the outdoor unit to indoor unit communications cable from DIP-SW01 SSD
terminals IDU(A) and IDU(B). Disconnect the central control cable from the outdoor unit
central control terminals. conductors by placing electrical tape over the bare ends.
14. Close the disconnect to reapply power to the outdoor unit and energize the compres-
sor crankcase heater. Once again, verify that the outdoor unit to indoor unit(s) commu-
MULTI V 5 with LGRED Outdoor Unit Installation Manual
nications cable is not connected to terminals IDU(A) and IDU(B) of the outdoor unit.,
and that the central control cable has been disconnected from the outdoor unit central
control terminals.
WARNING
Upon successful completion of the auto addressing function, an unintentional compressor
start can occur unless the communications cable to the indoor units is removed from the
outdoor unit terminals IDU(A) and IDU(B). Do NOT open the service valves or attempt
to start outdoor unit compressors or until directed by the LG trained setup contractor. Major
damage to the unit piping and compressors will occur, and there is a risk of explosion, SW01D SW02C SW04D
suffocation, physical injury, and / or death. (Reset Button) (ŻBackward (x Cancel
Button) Button)
Figure 147: Auto Addressing Flowchart. SW03C
SW01C (ŹForward
Turn Power On (Confirm / Automatic Button)
Address Setting Button)
YES
The address number of each indoor unit is shown on the wired controller display
or on the indoor unit display (this is not an error message). The address number
will disappear after pressing the ON / OFF button on the wired remote controller.
If 01, 02, ... 15 is displayed, then it means that 15 indoor units are recognized as
Auto Addressing Procedure Ends. connected and have been successfully auto addressed.
Due to our policy of continuous product innovation, some specifications may change without notification.
148
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Indoor Unit Auto Addressing / Group Controlling Indoor Units
Pre-Setup
7. Record the system address the outdoor unit assigned to each indoor unit by the auto address procedure in the column provided on the
Pre-setup Device Configuration Worksheet (See the Multi V 5 Installation Manual).
8. After recording the system addresses assigned to each device, open the outdoor unit disconnect. Remove the outdoor unit to indoor unit
communications cable from terminals IDU(A) and IDU(B). Disconnect the central control cable from the outdoor unit central control termi-
nals. Protect conductors by placing electrical tape over the bare ends to prevent an accidental compressor start from occurring before the
LG trained setup contractor arrives.
9. Close the disconnect to reapply power to the outdoor unit and energize the compressor crankcase heater. Once again, verify the outdoor
unit to indoor unit(s) communications cable is not connected to terminals IDU(A) and IDU(B) of the outdoor unit, and that the central con-
trol cable has been disconnected from the outdoor unit central control terminals.
10. Replace the control panel cover.
Central Control
Central Control Addresses Assignments
Gather any preferences the project has; if there are no preferences:
• Hex assignments do not have to be assigned in any particular order, or an order defined by the routing of the communications cable
between the indoor units. In most cases, Hex addresses can be skipped.
• All members of a Hex Group are not required to be on the same Multi V system.
• Addresses can be assigned at random, not in any particular order, and can be skipped.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Indoor Unit Central Control Address Assignments Figure 148: Central Control Address Nomenclature.
A central control address is made up of two hexadecimal characters.
• The first character in the central control address is the Hex Group 1 D
Identifier.
Possible Hex Group Identifiers (in order of lowest to highest) are
0-9 followed by A-F. See complete list in table at right.
• The second character in the address is the Hex Member Identifier Second character is the
in a Hex Group. First character is the
Hex Member (Indoor Unit)
Hex Member Identifiers (in order from lowest to highest) are 0-9 (Hex) Group Identifier 0-F
Identifier 0-F (Example:
followed by A-F. See complete list in table at right. (Example: Group 1)
Unit 14)
B(D) A(C)
Central Controller Connection
Due to our policy of continuous product innovation, some specifications may change without notification.
150
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Central Control
The heat recovery unit valve address and the central control address of its corresponding indoor unit must be set using the same number (in manual
addressing).
Controller Communications Limitations Table 68: Central Controller Indoor Unit Connection Limitations.
Each type of Controller device is designed to communicate with a Central Control Device Maximum Indoor Unit Quantity
limited quantity of indoor units. The quantity of indoor units that can ACP 256
be connected to a single control communications cable, therefore,
AC SMART 128
Pre-Setup
will be defined by the control device on that cable with the smallest
Maximum Indoor Unit Quantity as shown in the tables at right.
Table 69: Integration Solutions Indoor Unit Connection Limitations.
Integration Solutions Maximum Indoor Unit Quantity
MultiSITE™ Communications
128
Manager
AC Smart BACnet® Gateway 128
ACP BACnet Gateway 256
ACP LonWorks Gateway ®
64
BACnet is a trademark of ASHRAE; LonWorks is a trademark of Echlelon Corporation.
® ®
Group Number
If the building operator wants to know which indoor units are on each outdoor unit, and multiple systems serve a building:
• Assign a Group Number to each system. If there are more than 16 indoor units on a system, multiple Group Numbers will be necessary.
If the building owner wants to know which indoor units are on each floor:
• Assign a different group number for each floor. If there are more than 16 indoor units on a floor, multiple Group Numbers will be
necessary.
Member Number
Can be assigned at will or for example, can follow the room layout on each floor.
For each LG Central Controller product provided on the project, devise a central control address schedule and assign a central control
address to each indoor unit(s) Hydro Kit(s), and ERV(s) units. Record this central control address for each component in the column provided
on the Pre-setup Device Configuration Worksheet.
During the following procedure, NEVER PUSH the ON / OFF (Enable operation) Button on the zone controller.
information.)
3. Type in the Hex Central Control address that has been designated to the unit.
4. Repeat Steps 1 through 3 for each indoor unit in the building.
Due to our policy of continuous product innovation, some specifications may change without notification.
152
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
LGRED°, HRU Compatibility, and Gen 4 DIP Switch Settings
/*5('7HFKQRORJ\
LGRED technology is included in Multi V 5 air-source units produced after February 2019. The feature allows heat pump or heat recovery
systems to operate in heating only mode (i.e., all indoor units in heating mode) down to -22°F outdoor ambient wet bulb by updating the main
PCB software (v1.26) and replacing an air temperature sensor. Multi V 5 air-source units without these changes can only operate down to
-13°F. For more information, contact your local LG sales representative.
Table 70: PRHR*3 Heat Recovery Unit to Air / Water Source Unit Compatibility.
Model Starting Production Date Production Starting Serial No. Upgrade Software Service
Multi V 5 with LGRED* ARUM****TE5 February 1, 2019 1902xxx N/A
Pre-Setup
Multi V 5 ARUM****TE5 February 1, 2018 1802xxx September 28, 2018
Multi V S ARUB060GSS4 October 1, 2018 1810xxx September 28, 2018
Multi V Water IV ARWB****AS4 October 1, 2018 1810xxx September 28, 2018
Multi V IV ARUB****TE4 N/A N/A October 31, 2018
ARUB****TE2,
Multi V II and III N/A N/A N/A
ARUB****TE3
Multi V Water II ARWB****A2 N/A N/A N/A
*Low ambient performance with LGRED° heat technology is included in Multi V 5 air source units produced after February 2019.
Generation 4 Indoor Units Figure 150: Location and Setting of Outdoor Unit DIP Switch 3.
LG’s indoor units are designated Generation 4 (Gen 4). For Gen Air/Water Source Unit DIP Switch No. 3
4 indoor units to operate with Gen 4 indoor unit features, the air con-
ditioning system must meet the following requirements:
• All indoor units, heat recovery units, and air / water source units
must be Gen 4 or higher.
• All air / water source units must have Gen 4 or higher software
factory or field installed.
• Air / water source units DIP switch 3 must be set to ON
(factory default setting is OFF).
• All controllers must support Gen 4 indoor unit features.
The figure at right shows the outdoor unit DIP switch. All air and
water source units, indoor units, heat recovery units, and controllers
in a system must be Gen 4 compatible or the system will not operate
with Gen 4 indoor unit features. ON ON
OFF OFF
1 2 3 4 5 6 7 1 2 3 4 5 6 7
1 2 3 4 5 6 7 1 2 3 4 5 6 7
Due to our policy of continuous product innovation, some specifications may change without notification. 153
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Addressing with 3A Series Heat Recovery Figure 151: Heat Recovery Unit PCB Locations.
Units (For Heat Recovery Systems Only) Main Sub Circuit Board
General Circuit (6 and 8 Port
Each heat recovery unit will have a unique address assign so the outdoor unit will Board Units Only)
be able distinguish it from other heat recovery units.
Upon completion of the heat recovery unit address, set the heat recovery unit
operating parameters by adjusting the positions of the DIP switches on SW02E and
SW01E of the Main PCB. The Main and Sub PCBs are identical. The Sub PCB is
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Procedure
Before beginning the physical process of assigning heat recovery addresses, map
out the address assignments using a copy of the LATS tree mode diagram. Set the
heat recovery unit switches as required for the system.
Figure 152: Heat Recovery Unit PCB Locations, Top View.
Guidelines
Branch Nos.
1. Addresses must be sequential and cannot be skipped.
2. Assign the lowest address to the heat recovery unit that has the
largest capacity indoor unit connected to port number 1. If the
capacity of all indoor units connected to port number 1 of each
heat recovery unit is the same, assign address “0” to the heat
recovery unit farthest away from the outdoor unit. Assign the
next address to the next farthest away and so on until all heat Main PCB
One in PRHR023A~PRHR043A
recovery units have an address. The heat recovery unit with the Two with Same Part No. (Main and Sub)
in PRHR063A and PRHR083A
highest address must be the one closest to the outdoor unit. Up Display PCB Main Main PCB Main Sub PCB
to 16 heat recovery units can be on a single system. Possible
settings in order of lowest to highest are: 0,1,2,3,4,5,6,7,8,9,A,B
,C,D,E,F.
3. Record the address assigned to each heat recovery unit in the appropriate column on the Pre-setup Device Configuration
Worksheet.
Addressing must be performed following the detailed steps above because port number 1 on the heat recovery unit addressed “0” will remain open
during the auto pipe detect procedure. If the indoor unit capacity connected to the port is relatively small compared with other units on the system,
the outdoor unit high head pressure safety will trip and shut down the unit during the procedure.
Due to our policy of continuous product innovation, some specifications may change without notification.
154
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Figure 153: Heat Recovery Unit Main Main PCB (All Models). Figure 154: Heat Recovery Unit Main Sub PCB (PRHR063A and
Branch #1~4 Bypass PRHR083A Only).
7-Segment Display (from left) SC EEV Branch Nos. 5~8 Bypass
SSD (From Left)
Branch #3, 4
High/Low Branch Nos. 7,8
(from top) High/Low
(From Top)
Branch #1, 2
High/Low Branch Nos. 5,6
(from top) High/Low
(From Top)
Pre-Setup
Liquid - SW01D/SW01C/SW02B/SW01B/SW02E
Bypass Valve - SW01E : Branch #1~4 (from SW No.1)
- SW01E : Branch Nos. 5~8
(From SW No.1)
- SW01C
Figure 155: Heat Recovery Unit Main Main PCB Switches and Rotary Dials.
SW01B
Due to our policy of continuous product innovation, some specifications may change without notification. 155
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Table 71: DIP Switch, Rotary Dial, and Tact Switch Descriptions.
PRHR*2A HRU PRHR*3A HRU
Switches / Dials Function
Series (Old) Series (New)
For Both PRHR*3A (New) and PRHR*2A (Old) HRU Series:
ON • Auto or Manual Pipe (Valve) Detection Method Selection
• Number of Connected Branches / Ports Selection
OFF
1 2 3 4 5 6 7 8 • Zone Control Settings
1 2 3 4 5 6 7 8
MULTI V 5 with LGRED Outdoor Unit Installation Manual
ON
Valve (Port) Selection
OFF SW01M SW01E • Selects which valve (port) to address during Manual Valve
1 2 3 4
1 2 3 4 (Port) Detection and Zone Control
Due to our policy of continuous product innovation, some specifications may change without notification.
156
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
OFF OFF
1 2 3 4 5 6 7 8 1 2 3 4 5 6 7 8
1 2 3 4 5 6 7 8
1 2 3 4 5 6 7 8
Pre-Setup
Table 73: DIP Switch SW02E Number of Connected Branches / Ports Selection.
1 branch 5 branches
Connected Connected
2 branches 6 branches
Connected Connected
3 branches 7 branches
Connected Connected
4 branches 8 branches
Connected Connected
The factory setting of switches 2, 3, and 4 corresponds to the number of ports on the unit.
Due to our policy of continuous product innovation, some specifications may change without notification. 157
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
ON ON
OFF OFF
1 2 3 4 5 6 7 8 1 2 3 4 5 6 7 8
1 2 3 4 5 6 7 8 1 2 3 4 5 6 7 8
SW 0 2 E s e t t in g SW 0 1 E s e t t in g
Main*
Normal
control
SW01E
Main* Main
Turn the DIP switch of the
Zoning zoning branch on.
control EX) Branch 1,2 are zoning
control.
SW01E
* Main Only
Table 77: DIP Switch SW01E Description.
PCB Component DIP Switch No. Settings
SW01E No. 1 Valve No. 1 (Main Main PCB) / Valve No. 5 (Main Sub PCB)
ON No. 2 Valve No. 2 (Main Main PCB) / Valve No. 6 (Main Sub PCB)
OFF No. 3 Valve No. 3 (Main Main PCB) / Valve No. 7 (Main Sub PCB)
1 2 3 4
1 2 3 4 No. 4 Valve No. 4 (Main Main PCB) / Valve No. 8 (Main Sub PCB)
Due to our policy of continuous product innovation, some specifications may change without notification.
158
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Pre-Setup
Table 78: Main Main PCB SW01D Branch / Port Group Control Settings for PRHR*3A Heat Recovery Units.
Main (Main) PCB Main (Main) PCB
Branch / Port Group Control Branch / Port Group
SW01D Setting SW01D Setting
No Grouping 0 Group Control Branches / Ports 5,6 and 7,8 8
Group Control Branches / Ports 1 and 2 1 Group Control Branches / Ports 1,2 and 5,6 9
Group Control Branches / Ports 2 and 3 2 Group Control Branches / Ports 1,2 and 7,8 A
Group Control Branches / Ports 3 and 4 3 Group Control Branches / Ports 3,4 and 5,6 B
Group Control Branches / Ports 5 and 6 4 Group Control Branches / Ports 3,4 and 7,8 C
Group Control Branches / Ports 6 and 7 5 Group Control Branches / Ports 1,2 and 3,4 and 5,6 D
Group Control Branches / Ports 7 and 8 6 Group Control Branches / Ports 1,2 and 3,4 and 6,7 E
Group Control Branches / Ports 1,2 and 3,4 7 Group Control Branches / Ports 1,2 and 3,4 and 7,8 F
Due to our policy of continuous product innovation, some specifications may change without notification. 159
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
In the old PRHR*2A Heat Recovery Unit series, DIP Switch bank SW02M DIP Switch Nos. 4, 5, and 6 were used to set the branch / port control.
The SW01D rotary dial is new for PRHR*3A Heat Recovery Units, and was introduced because there are more models with ports varying from 2
to 8 ports (more branch / port combinations than the three SW02M DIP Switches on the old PRHR*2A can control). See below for PRHR*2A Heat
Recovery Unit Branch / Port Group Control Settings for comparison.
Figure 157: Example of Grouping Heat Recovery Unit Branches / Ports for the old PRHR*2A Heat Recovery Unit Series.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
ON 4 Indoor unit
3 Indoor unit
No Grouping OFF
2
1 Indoor unit
1 2 3 4 5 6 7 8 Indoor unit
ON 4 Indoor unit
3 Indoor unit
Grouping Valves 1, 2 OFF 2
1 2 3 4 5 6 7 8 1 Large capacity indoor unit
ON 4 Indoor unit
3
Grouping Valves 2, 3 OFF 2 Large capacity indoor unit
1 2 3 4 5 6 7 8 1 Indoor unit
ON
Grouping Valves 1, 2 4
3 Large capacity indoor unit
2
and Valves 3, 4 OFF
1 2 3 4 5 6 7 8 1 Large capacity indoor unit
Due to our policy of continuous product innovation, some specifications may change without notification.
160
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
A B A B A B
Pre-Setup
0 1 2
Due to our policy of continuous product innovation, some specifications may change without notification. 161
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
6:(6:%6:%6:& ',36ZLWFK7DFW6ZLWFK5RWDU\'LDO
Settings
The DIP switch, tact switches, and rotary dial listed are used in the Manual Valve (Port) Detection procedure, which sets the heat recovery
unit valves / ports to the central control address(es) of the connected indoor unit(s).
Before performing manual pipe detection, input a different central control address to every indoor unit through either a wired or a wireless controller
(depending on indoor unit type).
MULTI V 5 with LGRED Outdoor Unit Installation Manual
• SW01E DIP Switch: Selects the heat recovery unit valve / port that is to be addressed. Use SW01E on the Main Main PCB for Valves 1
through 4; on six (6) and eight (8) port heat recovery units, use SW01E on the Main Sub PCB for Valve 5 through 8.
• SW02B Tact Switch: Inputs the central control addresses of the indoor units connected to the heat recovery unit valve / port. Increases
the address by ten (10). Use SW02B on the Main Main PCB for Valves 1 through 4; on six (6) and eight (8) port heat recovery units, use
SW02B on the Main Sub PCB for Valves 5 through 8.
• SW01B Tact Switch: Inputs the central control addresses of the indoor units connected to the heat recovery unit valve / port. Increases the
address by one (1). Use SW01B on the Main Main PCB for Valves 1 through 4; on six (6) and eight (8) port heat recovery units, use SW01B
on the Main Sub PCB for Valves 5 through 8.
• SW01C Rotary Dial: Sets Zone Control during the Manual Valve (Port) Detection procedure when two (2) or more indoor units are connect-
ed to one (1) valve / port of the heat recovery unit. Indoor units set for Zone Control collectively operate in cooling or heating mode.
Table 79: DIP Switch SW01E, Tact Switches SW02B and SW01B, and Rotary Dial SW01C Descriptions.
PCB Component DIP Switch No. Settings
SW01E No. 1 For Valve No. 1 (Main Main PCB) / Valve No. 5 (Main Sub PCB)
ON No. 2 For Valve No. 2 (Main Main PCB) / Valve No. 6 (Main Sub PCB)
OFF No. 3 For Valve No. 3 (Main Main PCB) / Valve No. 7 (Main Sub PCB)
1 2 3 4
1 2 3 4 No. 4 For Valve No. 4 (Main Main PCB) / Valve No. 8 (Main Sub PCB)
SW02B
Increases the Valve Address by Ten (10) when Central Control Addressing Indoor
SW02B
Units
SW01B
Increases the Valve Address by One (1) when Central Control Addressing Indoor
SW01B
Units
SW01C
Due to our policy of continuous product innovation, some specifications may change without notification.
162
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
1. Verify No.1 of SW02E on the heat recovery unit Main Main PCB is set to OFF.
2. Confirm that the settings of Nos. 2, 3, and 4 of SW02E correspond with the number ports (valves) used.
5. 6HOHFWWKH³,GX´PRGHXVLQJŹDQGŻWKHQSXVKWKHƔEXWWRQ
6. 6HOHFWWKH³,G´³$WK´RU³$WF´IXQFWLRQXVLQJŹDQGŻWKHQSXVKWKHƔEXWWRQ,IRXWGRRUWHPSHUDWXUHLV!)XVH³$WK´,IWKDWGRHV
not work, use “Atc.”If outdoor temperature is <59°F, use “Atc”. If that does not work, use “Ath.”
Pre-Setup
7. 6HOHFWWKH³,GX´PRGHXVLQJŹDQGŻWKHQSXVKWKHƔEXWWRQ
8. 6HOHFWWKH³,G6W$´IXQFWLRQXVLQJŹDQGŻWKHQSXVKWKHƔEXWWRQ
9. The number “88” displays on the SSD of the outdoor unit main PCB.
11.The procedure could run from five (5) to sixty (60) minutes, depending on the number of connected indoor units, and the ambient outdoor
temperature.
12. The number of indoor units detected is displayed for thirty (30) seconds to one (1) minute on the outdoor unit PCB after the outdoor unit
stops.
• The number of indoor units connected to each heat recovery unit will be displayed.
• If there is an auto pipe detection error, “200” will be displayed.
• If there are no auto pipe detection errors, the number “88” displays on the SSD of the outdoor unit main PCB. After “88” disappears, the
auto detection error is complete.
• Run the auto addressing and auto pipe detection procedures again whenever an indoor unit PCB and / or and heat recovery unit PCB are
replaced. Apply power to the indoor units and heat recovery units after the repair is complete, otherwise operation error will occur.
• Error No. 200 occurs if the number of actual connected indoor units and the number of detected indoor units are different.
• If the auto pipe detection procedure fails, perform the manual pipe detection procedure. (If the auto pipe detection procedure is successful,
the manual pipe detection procedure is not required.)
• The auto pipe detection procedure can be run again after a failed auto pipe detection procedure attempt; just reset the outdoor unit first.
• Do not turn off the main unit PCB for at least five (5) minutes after the auto pipe detection procedure is complete; allow time for the
outdoor unit to automatically save auto pipe detection results.
Due to our policy of continuous product innovation, some specifications may change without notification. 163
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Outdoor unit operates for five (5) to sixty Check the pipe installation of the
(60) minutes. Auto pipe detection is complete. outdoor, indoor, and heat recovery
units.
An operation sound will be heard when the Retry the auto pipe detection
system changes modes from cooling to heat- procedure after troubleshooting.
ing and vice versa. This is normal.
Due to our policy of continuous product innovation, some specifications may change without notification.
164
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Before performing manual valve (port) detection, input a different central control address to every indoor unit through either a wired or a wireless
controller (depending on indoor unit type).
Pre-Setup
8. On the Main PCB (Main or Sub, depending on the valve / port being addressed), turn the DIP Switch to OFF to save the address, and
complete the manual valve (port) detection procedure for that valve / port.
9. Reset the power to the outdoor unit PCB.
10. Repeat Steps 4 to 9 until all valves / ports are addressed. If zone control indoor units are NOT to be included in the system, skip Steps 5
and 7.
11.The number of the indoor unit installed will appear after about five (5) minutes. (Example: Heat Recovery Unit to the Number of the Indoor
Unit.)
12. Reset the power of the outdoor unit PCB and the heat recovery unit(s).
13. Manual valve / port detection is complete. Turn No. 1 of DIP switch bank SW02E on the heat recovery unit Main PCB to OFF to finish the
Manual Valve (Port) Detection procedure.
1. If a central controller is not installed yet, leave the address data alone until the installer adds the central controller and sets the central
control address as desired.
2. If a central controller is already installed, use the wired remote controller of the indoor units to set the central control addresses. (In this
case, manually set the heat recovery unit pipe address following the central control address of the indoor unit.)
3. Central controller addresses must be set manually at each individual controller.
4. Do not set a central control address of 0xFF to any indoor unit. If an address is 0xFF, manual valve / port detection will not be com-
pleted properly.
5. The heat recovery unit valve address and the central control address of its corresponding indoor unit must be set using the same number
(in manual addressing).
6. A heat recovery unit valve / port that does not have an indoor unit connected to it must be set with a different address than one that does
have an indoor unit connected to it. (If addresses are the same, the valves will not operate.)
7. Change the manual pipe settings using the heat recovery unit PCB.
8. An error indicates that the manual pipe detection procedure was not completed properly.
9. To save the pipe detection procedure results automatically, do not turn off the main outdoor unit PCB for five (5) minutes after the
procedure has finished.
Due to our policy of continuous product innovation, some specifications may change without notification. 165
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Enter the central control address into each Wait for five (5) minutes.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Due to our policy of continuous product innovation, some specifications may change without notification.
166
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Before performing manual pipe detection, input a different central control address to every indoor unit through either a wired or a wireless controller
(depending on indoor unit type).
Example: Manual Valve (Port) Detection (Normal, Non-Zone Setting) of Valve Nos. 1 and 6 (Six [6] or Eight [8] Port Heat
Recovery Unit).
1. Enter the central control address into each indoor unit.
2. Turn No. 1 of DIP switch bank SW02E on the heat recovery unit Main Main PCB to ON.
3. Reset the power of the heat recovery unit PCB.
4. On Main Main PCB DIP Switch SW01E, turn No. 1 to ON. This selects Valve / Port No. 1. (Any existing value saved in EEPROM is dis-
played on the SSD.)
5. On the Main Main PCB, use Tact Switches SW02B (Left) and SW01B (Right) to input the central control address of the indoor unit con-
nected to heat recovery unit Valve / Port No. 1.
• SW02B (Left) increases the valve / port address by ten (10). Digit increases with the number of times the tact switch is pressed, shown
on the SSD.
• SW01B (Right) increases the valve / port address by one (1). Digit increases with the number of times the tact switch is pressed, shown
on the SSD.
6. On Main Main PCB DIP Switch SW01E, turn No. 1 to OFF to save the address for Valve No. 1, and complete the manual pipe detection
Pre-Setup
procedure for that valve.
7. On Main Sub PCB DIP Switch SW01E, turn No. 2 to ON. This selects Valve / Port No. 6. (Any existing value saved in EEPROM is dis-
played on the SSD.)
8. On the Main Sub PCB, use Tact Switches SW02B (Left) and SW01B (Right) to input the central control address of the indoor unit connect-
ed to heat recovery unit Valve / Port No. 6.
9. On Main Sub PCB DIP Switch SW01E, turn No. 2 to OFF to save the address for Valve No. 6, and complete the manual pipe detection
procedure for that valve.
10. Reset the power to the outdoor unit PCB.
11.The number of the indoor unit installed will appear after about five (5) minutes. (Example: Heat Recovery Unit to the Number of the Indoor
Unit.)
12. Reset the power of the outdoor unit PCB and heat recovery unit. Manual valve / port detection is complete. Turn No. 1 of DIP switch bank
SW02E on the heat recovery unit Main Main PCB to OFF to finish the Manual Valve (Port) Detection procedure.
Main Main PCB Main Main PCB Main Main PCB Main Sub PCB Main Sub PCB
Main Main PCB
SW01E SW01E SW01E SW01E
ON ON ON ON
• The procedure described above must be performed for all heat recovery unit valves / ports.
• Valves that do not have indoor units connected to them must be addressed with a number that has not been used. (Valves will not work if
the address numbers are the same.)
Due to our policy of continuous product innovation, some specifications may change without notification. 167
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Example: Manual Valve (Port) Detection (Zone Control Setting) of Valve No. 5 (with Three [3] Zone Controlled Indoor
Units) and 6 (one [1] Indoor Unit without Zone Control) (Six [6] or Eight [8] Port Heat Recovery Unit).
1. Enter the central control address into each indoor unit.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
2. Turn No. 1 of DIP switch bank SW02E on the heat recovery unit Main Main PCB to ON.
3. Reset the power of the heat recovery unit PCB.
4. On Main Sub PCB DIP Switch SW01E, turn No. 1 to ON. This selects Valve / Port No. 5. (Any existing value saved in EEPROM is dis-
played on the SSD.)
5. On the Main Sub PCB, use Rotary Dial SW01C to choose the address of the first zone controlled indoor unit (From 0 to F; this example:
0).
6. On the Main Sub PCB, use Tact Switches SW02B (Left) and SW01B (Right) to input the central control address of the first indoor unit
connected to heat recovery unit Valve / Port No. 5.
• SW02B (Left) increases the valve / port address by ten (10). Digit increases with the number of times the tact switch is pressed, shown
on the SSD.
• SW01B (Right) increases the valve / port address by one (1). Digit increases with the number of times the tack switch is pressed, shown
on the SSD.
7. On the Main Sub PCB, use Rotary Dial SW01C to choose the manual address of the second zone controlled indoor unit (From 0 to F; this
example: 1).
8. On the Main Sub PCB, use Tact Switches SW02B (Left) and SW01B (Right) to input the central control address of the second indoor unit
connected to heat recovery unit Valve / Port No. 5.
9. On the Main Sub PCB, use Rotary Dial SW01C to choose the manual address of the third zone controlled indoor unit (From 0 to F; this
example: 2).
10. On the Main Sub PCB, use Tact Switches SW02B (Left) and SW01B (Right) to input the central control address of the third indoor unit
connected to heat recovery unit Valve / Port No. 5.
11.After all zoned indoor units are manually addressed, change Rotary Dial SW01C setting to 0.
12. On Main Sub PCB DIP Switch SW01E, turn No. 1 to OFF to save the addresses for Valve No. 5, and complete the manual pipe detection
procedure for that valve / port.
13. On Main Sub PCB DIP Switch SW01E, turn No. 2 to ON. This selects Valve / Port No. 6. (Any existing value saved in EEPROM is dis-
played on the SSD.)
14. On the Main Sub PCB, use Tact Switches SW02B (Left) and SW01B (Right) to input the central control address of the indoor unit con-
nected to heat recovery unit Valve / Port No. 6.
15. On Main Sub PCB DIP Switch SW01E, turn No. 2 to OFF to save the address for Valve No. 6, and complete the manual pipe detection
procedure for that valve / port.
16. Reset the power to the outdoor unit PCB.
17. The number of installed indoor units displays after about five (5) minutes.
18. Reset the power of the outdoor unit PCB and heat recovery unit. Manual valve / port detection is complete. Turn No. 1 of DIP switch bank
SW02E on the heat recovery unit Main Main PCB to OFF to finish the Manual Valve (Port) Detection procedure.
Due to our policy of continuous product innovation, some specifications may change without notification.
168
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Figure 162: Manual Valve (Port) Detection (Zone Control Setting) Example.
Main Sub PCB Main Sub PCB Main Sub PCB Main Sub PCB
SW01E 0 1 2
ON
SW01C OFF
1 2 3 4
Pre-Setup
1 2 3 4
Main Sub PCB Main Sub PCB
Main Main PCB
SW01E SW01E
ON ON
OFF OFF
1 2 3 4 SW02B SW01B 1 2 3 4
1 2 3 4 1 2 3 4
• The procedure described above must be performed for all heat recovery unit valves / ports
• Valves / ports that do not have connected indoor units must be addressed with a number that has not been used. (Valves / ports will not
work if the address numbers are the same.)
• One heat recovery unit valve / port can support up to eight (8) indoor units (rotary dial settings 0~7). An error will display if more than eight
(8) indoor units per heat recovery valve / ports are set with the rotary dial.
• Return the rotary dial SW01C to its original setting (0) after all settings are complete.
Due to our policy of continuous product innovation, some specifications may change without notification. 169
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Using the Display PCB Figure 163: Display PCB DIP Switch SW01 and SSD Locations.
DIP switch bank SW01 on the Display PCB can be set to display
valve status and the heat recovery unit address.
No. 1 Displays the Valve Status for the Main Main PCB
No. 2 Displays the Valve Status for the Main Sub PCB
DIP Switch SW01 DP1 SSD
Figure 164: Display PCB DIP Switch SW01.
No. 3 Displays the Degree of Subcooling
No. 4 Displays the Heat Recovery Unit Address
ON
Displays the Number of Connected
No. 5
Heat Recovery Units
Displays the Version of the OFF
No. 6
Heat Recovery Unit Software 1 2 3 4 5 6 7
No. 7 Not Used 1 2 3 4 5 6 7
Displaying the Valve Status (For Main / Sub Main PCBs) Table 81: SW01 DIP Switch No. Valve Status Settings.
When the high pressure, low pressure, and balancing valves are SW01 DIP Switch No. Settings
open, the SSD shows: Main Main PCB Valves Main Main PCB Valves
(Valve Nos. 1 through 4) (Valve Nos. 5 through 8)
ON ON
OFF OFF
1 2 3 4 5 6 7 1 2 3 4 5 6 7
1 2 3 4 5 6 7 1 2 3 4 5 6 7
Where:
Main 1 2 3 4
Sub 5 6 7 8
Displaying the Heat Recovery Unit Address Figure 165: SW01 DIP Switch Setting for Displaying the Heat Recovery
When DIP switch No. 3 on SW01 is ON, the heat recovery unit Unit Address.
ON
address appears on the SSD as:
OFF
Displayed No. = 1 + No. of the Value of SW01C on the Main Main 1 2 3 4 5 6 7
PCB 1 2 3 4 5 6 7
Due to our policy of continuous product innovation, some specifications may change without notification.
170
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Pre-Setup
3. If the green communication LED of the heat recovery unit is still consistently blinking, check the rotary switch and DIP switch settings.
5HVHWSRZHUWRWKHRXWGRRUXQLWDQGKHDWUHFRYHU\XQLWZDLWIRUWKLUW\ PLQXWHVVRWKHSLSLQJWHPSHUDWXUHZLOOFRROGRZQDQGWKHQ
perform the auto addressing procedure.
4. If the number of indoor units is different than what is actually installed and what number is displayed after the auto addressing procedure
LVILQLVKHGFKHFNWKHSLSLQJLQVWDOODWLRQ2XWGRRUXQLWļ+HDW5HFRYHU\XQLWļ,QGRRUXQLW
5. If an indoor unit has not been connected to the first port (No. 1 Valve) of the heat recovery unit, set the heat recovery unit piping
manually.
Due to our policy of continuous product innovation, some specifications may change without notification. 171
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
1. If Error No. 59 is displayed on the heat recovery unit, and Error No. 204 is displayed on the outdoor unit, these indicate that the outdoor
unit software has NOT been upgraded to support heat recovery unit 3A models. Contact your LG representative for information.
2. Check power wiring and communication cable connections. Check if the green communication LED on the heat recovery unit PCB is blinking.
3. If the green communication LED is blinking normally, check the rotary and DIP switch settings on the heat recovery unit (See Error No.
200). Reset the power to the outdoor and heat recovery units. (If there is a heat recovery unit communication error, it can’t be released
until the power to the outdoor unit is reset.)
4. If the green communication LED of the heat recovery unit PCB is not blinking (on continuously), check if the communication of the total
indoor units is normal (See Error No. 05). If the green communication LED of the heat recovery unit PCB is not blinking (on continuously),
and even if communication to the indoor unit is functioning, replace the heat recovery unit PCB.
DANGER
• High voltage electricity is required to operate this system. Adhere to the NEC code and these instructions when wiring. Improper connec-
tions and inadequate grounding can cause accidental injury or death.
• Turn the power off before servicing the equipment. Electrical shock can cause physical injury or death.
• Do not operate the disconnect switch with wet hands. There is risk of fire, electric shock, physical injury or death.
WARNING
• Disconnects must only be performed by a properly licensed electrician. Incorrect wiring could cause the disconnect to explode, leading to
physical injury or death.
• Do not operate the unit with the panel(s) or protective cover(s) removed. The hot, cold, and high-voltage parts of the unit can cause
physical injury or death.
• Do not touch the refrigerant piping during or after operation. It can cause burns or frostbite.
NOTE
• If the power wiring and communication cables on the heat recovery unit(s) and indoor unit(s) are not properly connected (connections
switched), the communication components will burn out.
• Do not supply power to the unit until all electrical wiring and controls wiring are completed.
Due to our policy of continuous product innovation, some specifications may change without notification.
172
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Addressing with 3A Series Heat Recovery Units
Pre-Setup
3. Defective heat recovery unit main PCB.
1. Check if the wiring between the heat recovery unit EEPROM and main PCB is connected properly. Reconnect or replace connections if
necessary.
2. Replace main PCB of heat recovery unit.
DANGER
• High voltage electricity is required to operate this system. Adhere to the NEC code and these instructions when wiring. Improper connec-
tions and inadequate grounding can cause accidental injury or death.
• Turn the power off before servicing the equipment. Electrical shock can cause physical injury or death.
• Do not operate the disconnect switch with wet hands. There is risk of fire, electric shock, physical injury or death.
WARNING
• Disconnects must only be performed by a properly licensed electrician. Incorrect wiring could cause the disconnect to explode, leading to
physical injury or death.
• Do not operate the unit with the panel(s) or protective cover(s) removed. The hot, cold, and high-voltage parts of the unit can cause
physical injury or death.
• Do not touch the refrigerant piping during or after operation. It can cause burns or frostbite.
NOTE
• If the power wiring and communication cables on the heat recovery unit(s) and indoor unit(s) are not properly connected (connections
switched), the communication components will burn out.
• Do not supply power to the unit until all electrical wiring and controls wiring are completed.
Due to our policy of continuous product innovation, some specifications may change without notification. 173
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Temperature Sensing Location
1. Return air temperature sensor at the indoor unit. Sensing at the return air is the default method. LG indoor units are factory-built with a
return air temperature sensor and do not require a remote controller. For more information, visit www.lghvac.com, and refer to the Engi-
neering and Installation manuals for each particular indoor unit.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
2. Use the sensor embedded in the remote controller. (Remote controllers are separate purchases.)
3. Remote temperature button sensor. (Not compatible with wall-mounted indoor units. Temperature button sensor is a separate pur-
chase.)
4. Combination of remote controller with embedded sensor and remote temperature button sensor. When a remote controller is used in
combination with the return air temperature sensor or a remote temperature button sensor, the indoor unit uses the sensed value farthest
from the set point.
If it is not possible to locate the remote controller in an area that is both accessible and representative of the desired zone temperature, using a
remote controller for control, and a remote temperature button sensor for the sensing location is also an option.
Temperature Sensing Options in a Single Zone—Single Zone, Multiple Units, Group Control
• Using the return air temperature sensor of each individual unit will allow the indoor unit to adjust to the load in its portion of the space.
• Using a remote temperature button sensor with each indoor unit will also allow the indoor unit to adjust to the load in its portion of the
space, and will also better reflect the temperature at the occupant level.
Due to our policy of continuous product innovation, some specifications may change without notification.
174
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Temperature Sensing Location / Setting External Static Pressure
If outside air is introduced into the indoor unit or an open plenum is used, do not use this option for sensing temperature.
2. Use a remote controller in the most often occupied area along with a remote temperature button sensor in another area. When the combi-
nation sensing method is used, the indoor unit uses the sensed value farthest from the set point. (Function Code 4 must be set to 003.)
Pre-Setup
3. Use multiple remote temperature button sensors in a series-parallel configuration to average the space temperature across multiple
spaces.
For more information, see the “Temperature Sensing Applications Guide” on www.lghvac.com.
It is always best if the air balance is completed prior to a request for an LG trained setup contractor. If the air balancing contractor has not completed
WKHZRUNEHIRUHVHWXSWKH/*WUDLQHGVHWXSFRQWUDFWRULVQRWUHVSRQVLEOHIRUVHWWLQJWKHLQGRRUXQLWDLUÀRZUDWHVIDQVSHHGVRUHQVXULQJWKHDLU
YROXPHGHOLYHUHGDWHDFKLQGRRUXQLWLVSHUSURMHFWVSHFL¿FDWLRQV([FHVVLYHRUUHVWULFWHGDLUÀRZZLOOLPSDFWWKHDELOLW\RIWKH/*WUDLQHGVHWXSFRQ-
WUDFWRUWRVXFFHVVIXOO\FRPSOHWHV\VWHPVHWXS,IDQ\SUREOHPVH[LVWUHTXHVWYHUL¿FDWLRQIURPWKH7HVWDQG%DODQFHFRQWUDFWRU,IQHFHVVDU\SURYLGH
instruction to the air balance technician on how to adjust the indoor unit fan setting value.
Due to our policy of continuous product innovation, some specifications may change without notification. 175
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Setting External Static Pressure
The indoor unit fan(s) cannot be allowed to operate outside manufacturer’s parameters. Extended operation in these conditions will result in:
• Fan surge (noisy & slow pulsating airflow), and / or
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Table 83: Example of Ducted Unit External Static Pressure and Air Flow Table from an Engineering Manual.
Static Pressure (in. wg)
Set Value
0.19 0.23 0.31 0.39 0.47 0.55 0.59 0.62 0.66 0.70 0.78
91 1,642 1,543 1,349 1,105 819 494 317 130 - - -
96 1,762 1,628 1,518 1,183 1,098 649 483 317 91 - -
101 1,839 1,772 1,691 1,395 1,320 964 889 628 314 215 -
106 1,815 1,808 1,779 1,568 1,522 1,176 1,133 1,020 741 632 293
111 1,892 1,896 1,868 1,762 1,705 1,433 1,419 1,158 1,112 960 618
116 - - - 1,967 1,794 1,582 1,504 1,416 1,327 1,147 974
121 - - - - 1,843 1,794 1,776 1,613 1,575 1,370 1,137
126 - - - - - - 1,921 1,808 1,779 1,624 1,536
2. The table below presents the ESP settings that the unit comes with from the factory, plus an additional “standard” setting.
Table 82: Example of Ducted Unit External Static Pressure and Air Flow (with Settings) from an Engineering Manual.
Capacity Standard ESP (in. Min. ESP (in. Max. ESP (in.
Model Mode Setting Value CFM
(MBh) wg) wg) wg)
High 116 1,582
High
Mid 111 0.55 1,434 0.39 0.78
(Factory Set)
Low 106 1,176
ARNU483**** 48.1
High 106 1,568
Standard Mid 102 0.39 1,395 0.27 0.55
Low 95 1,183
3. Once the available system static pressure requirements and the desired airflow rate are known, select the required ESP (fan) setting
value(s). A separate ESP (fan) setting value must be selected for each available indoor unit fan speed.
4. Record the values on the Pre-setup Device Configuration Worksheet. If the fan setting value was left at the factory default, insert “000” in
the blank.
Due to our policy of continuous product innovation, some specifications may change without notification.
176
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP
WITH
Package Pre-setup Documents / Initiate a Request
The contractor must ONLY request setup when everything is completed and all components tested / addressed (if a component is not oper-
ating within the usual parameters at the time of setup, then adjustments must be made that will prevent the Setup contractor from signing off
and approving the system). Before setup, the Setup contractor will contact you to discuss specific job points, scheduled day(s) and expected
duration. It is the contractor’s responsibility to provide all of the necessary start-up labor, refrigerant, tools and test equipment needed to
Pre-Setup
complete the process in the expected time frame.
Do not attempt to start the outdoor unit(s), charge refrigerant, or open service valves until directed by your Setup contractor. After setup,
the contractor will be notified if there are any corrections needed to allow warranty activation. The Distributor or LG Rep / Controls Contractor
will provide assistance with controls setup, final device programming, BMS integration, air balance adjustments, etc.; and proceed with any
owner training (if included).
Using LGMV monitoring software is encouraged for ease of future diagnostic and maintenance related checks.
Initiate a Request for a System Setup
The system is now ready for setup procedures and additional trim charge. Send all Pre-Setup Package Documents to your LG Applied Repre-
sentative and request setup assistance.
System Setup
The Multi V System setup process and procedures are provided in a separate manual and/or in training materials provided by the LG Acade-
my Training Team. To obtain a copy, you must be a certified trained setup contractor.
Due to our policy of continuous product innovation, some specifications may change without notification. 177
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODES
WITH
WARNING Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
troubleshooting of the Multi V product.
General Information
LG VRF system’s core logic uses error codes to indicate that an abnormal operation occurred. Error codes help guide a trained service tech-
nician to identify why and what caused the error to display, and help track the frequency of malfunction occurrences.
There are four (4) levels of error code responses; the system responds accordingly, depending on the severity of the malfunction assigned to
the malfunction. The level of responses range from “notify and keep operating” (Level 4), to “immediate system shutdown” (Level 1).
All error codes can be viewed at the outdoor unit seven segment display (SSD) and with LGMV software. If an error codes shows on one
(1) or more indoor unit zone controllers, it will display on LGMV, central controllers, BMS, or any other LG device connected to Comm bus -
Internet A/B. Indoor unit error code notifications will display differently based on location of the problem.
MULTI V 5 with LGRED Outdoor Unit Installation Manual
Level 4 Responses
Level 4 responses display the error code, but the system continues to operate (operate indefinitely). When the malfunction is fixed, the error
code remains until the Main outdoor unit’s microprocessor is reset, and operation has resumed for 130 minutes without the malfunction
reoccurring.
Level 3 Responses
Level 3 responses display the error code on all zone controllers, central controllers, and on BMS systems. For Level 3 responses, the Multi V
system will shut down for three (3) minutes, and then the Main microprocessor in the outdoor unit will automatically restart the system.
If the malfunction reoccurs up to a total of nine (9) times within one (1) hour, the system will display the error code, shut down, and restart
again each time. If the malfunction occurs a tenth (10th) time within the same one (1) hour, the system shuts down permanently, assigning
the error to a Level 1 response that requires a manual restart. The error code displays on the zone controllers and central controllers until the
malfunction is fixed.
Level 2 Responses
Level 2 responses are communications related errors only. Level 2 responses activate after ten (10) attempts to communicate have occurred.
After communications have been re-established, the error codes display for one (1) minute. If the communications are restored, then the
error code disappears. If the communication is lost within one (1) minute, the error code remains.
Error codes for Level 2 responses stop appearing on the zone and central controllers as soon as communications are restored, without the
need to reset power at the Main outdoor unit or to restart the entire system.
Multi V 5 error codes for Level 2 responses appear where the problem occurs, and time limits differ depending on type:
1. Communications lost between outdoor unit PCBs – no time delay.
2. Communications lost between the indoor unit and the outdoor unit for three (3) minutes.
3. Communications lost between the indoor unit and heat recovery unit for ten (10) seconds.
4. Communications lost between outdoor unit external PCBs for ten (10) seconds.
Level 1 Responses
Many Level 1 responses call for an immediate system shutdown, and, in almost all abnormal operational situations, occur after the algorithm
monitoring system verifies that the malfunction is real (to avoid nuisance alarms and false positives). Level 1 responses are displayed at
zone controllers, central controllers, BMS, LGMV, and the outdoor unit SSD. They cannot be cleared until the problem that caused it is fixed.
Before a Level 1 response is assigned, the Multi V algorithm initially assigns a Level 3 response to any system malfunction that is not
communications related. The system follows Level 3 protocol until the tenth (10th) time a malfunction occurs, at which time the system shuts
down, the malfunction changes from Level 3 to Level 1, and a manual restart is required. The entire Level 3 auto restart to Level 1 shut down
sequence will repeat until the malfunction is fixed.
For detailed information on Multi V Levels and error codes, how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com, and
contact an LG trained technician.
Due to our policy of continuous product innovation, some specifications may change without notification.
178
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
WARNING Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
troubleshooting of the Multi V product.
Sub 1 unit; 213 = Error No. 21 on Sub2 unit, 1051 = Error No. 105
on Main unit. Compressor Error
Unit; 1 = Main, 2 = Sub1, 3 = Sub2
• If two or more errors occur simultaneously, the lower error code
Compressor Error
QXPEHULVGLVSOD\HG¿UVW
• After error is resolved, the error code disappears.
Nomenclature Definitions
• MICOM: Non-volatile memory chip where unit setup information is stored.
• ((35201RQYRODWLOHPHPRU\FKLSZKHUHGHYLFHLGHQWL¿FDWLRQVL]HDQGIDFWRU\GH¿QHGGHIDXOWFRPSRQHQWRSHUDWLQJSDUDPHWHUVDUH
stored.
The error code tables below and on the following pages list the error codes used for Multi V systems. For detailed information on how to
troubleshoot each error, see the Multi V 5 Service Manual on www.lghvac.com.
Error Codes
Table 84: Error Codes.
Error Code Description Details
Indoor unit air temperature sensor is disconnected or shorted. (Check
1 Indoor unit return air or optional remote wall tempera-
0 the wiring, connection on the indoor unit PCB, then check the thermis-
ture sensor communications error. tor.)
Indoor unit inlet pipe temperature sensor is disconnected or shorted.
2 Indoor unit inlet pipe temperature sensor communica-
0 (Check the connection on the indoor unit PCB, then check the therm-
tion error. istor.)
3 Communication error between zone controller and Indoor unit PCB is not receiving communications signal from zone
0 indoor unit. controller.
Drain pump and/or float switch could be malfunctioning. Also check
0 4 Indoor unit drain overflow error. drain line for obstructions.
Communication error between outdoor unit PCB and Indoor unit communications PCB is not receiving signal from outdoor
0 5 unit communications PCB for more than 5 minutes. Check indoor unit
indoor unit PCB. PCB for issues.
Indoor Unit
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification. 179
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification.
180
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
Error Codes
2 3 2 filter PCB.
er compressor DC link.
• There is a capacitor that is not working properly, or the voltage
at the capacitor is out of range.
Low DC voltage sensed at the Sub2 outdoor unit invert- • Disconnected DC link.
2 3 3
er compressor DC link. • Damaged electrical condenser component (serving capacitor)
Outdoor Unit
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification. 181
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
kPa for 1 minute; High side pressure is <2,200 kPa. Check for
refrigerant leaks (low refrigerant charge), or a defective indoor
2 Sub1 outdoor unit low side pressure below allowable
3 5 unit EEV.
limits.
• When operating in heating mode: Low side pressure <230
kPa for 1 minute; High side pressure is <1,800 kPa. Check
for refrigerant leaks (low refrigerant charge), or a defective
3 Sub1 outdoor unit low side pressure below allowable
3 5 outdoor unit EEV.
limits.
1 Main outdoor unit inverter 1 or inverter 2 low compres- • Outdoor unit is experiencing a problem developing compressor
3 6 lift. Error is calling out low compression ratio. System will shut
sion ratio.
down and display error code “CH36*”.
2 Sub1 outdoor unit inverter 1 or inverter 2 low compres-
3 6 • During ongoing operation, if the compression ratio is <1.6 for
sion ratio.
2 to 5 minutes following a change in position of the reversing
valve (either direction). If compression ratio is <1.6, delay 5
minutes for condition to correct itself before raising the error.
3 Sub2 outdoor unit inverter 1 or inverter 2 low compres-
3 6 • During low ambient cooling operation following an initial
sion ratio.
compressor start, if compression ratio is <1.1 for 2 minutes, if
compression ratio is <1.3 for 3 minutes.
1 Main outdoor unit inverter compressor current transduc- Main outdoor unit inverter compressor current transducer (CT)
4 0 detection sensor disconnected, shorted, or opened.
er (CT) sensor error.
2 Sub1 outdoor unit inverter compressor current transduc- Sub1 outdoor unit inverter compressor current transducer (CT)
4 0 detection sensor disconnected, shorted, or opened.
er (CT) sensor error.
3 Sub2 outdoor unit inverter compressor current transduc- Sub2 outdoor unit inverter compressor current transducer (CT)
4 0 detection sensor disconnected, shorted, or opened.
er (CT) sensor error.
1 Main outdoor unit inverter compressor1 discharge pipe • Error can also occur if the system is operating in cooling at
4 1 temperature sensor error. extremely low temperatures with no low ambient kit.
• Compressor discharge pipe temperature sensor (TH3) is not
2 Sub1 outdoor unit inverter compressor1 discharge pipe
4 1 installed or connected properly.
temperature sensor error.
• Defective compressor discharge pipe sensor (TH3) (opened or
3 Sub2 outdoor unit inverter compressor1 discharge pipe shorted);
4 1 temperature sensor error. • Defective outdoor unit PCB.
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification.
182
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
Error Codes
located near the heat exchanger in heating mode.
1 Main outdoor unit inverter compressor2 discharge • Error can also occur if the system is operating in cooling at
4 7 temperature sensor error. extremely low temperatures with no low ambient kit.
2 Sub1 outdoor unit inverter compressor2 discharge • Check the connection on the outdoor unit PCB.
4 7 temperature sensor error.
Outdoor Unit
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification. 183
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
6 0 3 Sub2 outdoor unit inverter PCB EEPROM error. • Check if notch in the chip lines up with the arrow on the
socket.
High temperature at the Main outdoor unit inverter System shut off because of high temperatures at the Main
6 2 1
heatsink. outdoor unit inverter heatsink.
High temperature at the Sub1 outdoor unit inverter System shut off because of high temperatures at the Sub1
6 2 2
heatsink. outdoor unit inverter heatsink.
High temperature at the Sub2 outdoor unit inverter System shut off because of high temperatures at the Sub2
6 2 3
heatsink. outdoor unit inverter heatsink.
Main outdoor unit inverter heatsink temperature • Check the connection on the outdoor unit PCB.
6 5 1
sensor error. • Thermistor shorted or opened.
Sub1 outdoor unit inverter heatsink temperature • Check for 12 V DC between 12 V and GND (red to black) for
6 5 2
sensor error. 5 V DC.
Sub2 outdoor unit inverter heatsink temperature • Check the Signal to GND (white to black) and use correct chart
6 5 3 from Troubleshooting section to compare with actual system
sensor error.
temperature.
6 7 1 Main outdoor unit fan has locked up.
6 7 2 Sub1 outdoor unit fan has locked up. No airflow.
6 7 3 Sub2 outdoor unit fan has locked up
7 1 1 Main outdoor unit inverter CT sensor error. Main outdoor unit is restricted.
7 1 2 Sub1 outdoor unit inverter CT sensor error. Sub1 outdoor unit is restricted.
7 1 3 Sub2 outdoor unit inverter CT sensor error. Sub2 outdoor unit is restricted.
Main outdoor unit fan current detection (CT) sensor disconnect-
7 5 1 Main outdoor unit fan CT sensor error. ed or shorted.
Sub1 outdoor unit fan current detection (CT) sensor disconnect-
7 5 2 Sub1 outdoor unit fan CT sensor error. ed or shorted.
Sub2 outdoor unit fan current detection (CT) sensor disconnect-
7 5 3 Sub2 outdoor unit fan CT sensor error. ed or shorted.
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification.
184
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
Error Codes
8 7 2 Sub1 outdoor unit fan PCB EEPROM error.
• Verify EEPROM is present and in the socket correctly.
• Communication error between Sub2 outdoor unit fan MICOM
8 7 3 Sub2 outdoor unit fan PCB EEPROM error. and EEPROM.
Outdoor Unit
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification. 185
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
1 4 5 1 Communication error between Main outdoor unit main Main outdoor unit main board to external board communication
board and external board. failure.
1 4 5 2 Communication error between Sub1 outdoor unit main Sub1 outdoor unit main board to external board communication
board and external board. failure.
1 4 5 3 Communication error between Sub2 outdoor unit main Sub2 outdoor unit main board to external board communication
board and external board. failure.
Code indicates that based on current superheat measurements,
Main outdoor unit compressor discharge superheat not there is a high possibility of liquid refrigerant flooding back and
1 5 0 1 damaging the compressor.
satisfied.
• Outdoor unit compressor discharge superheat not satisfied for
PLQXWHV
• Code can only occur when the outdoor is operating in cooling
mode (all indoor units must be in cooling mode; error cannot
Sub1 outdoor unit compressor discharge superheat not occur during simultaneous operation).
1 5 0 2 • After at least 10 minutes of compressor operation, the Main
satisfied.
outdoor unit microprocessor will calculate the system’s com-
pressor superheat. If at any time during compressor operation
where all indoor units in thermal on are in cooling mode and
WKHFRPSUHVVRUVXSHUKHDWIDOOV) & IRUPLQXWHV
there is a high probability that liquid could flood back to the in-
Sub2 outdoor unit compressor discharge superheat not let of the compressor scroll, resulting in compressor damage.
1 5 0 3
satisfied. • If error occurs 3 times within any 1 hour period of compressor
operation, the system will shut down and remain off. A manual
restart will be necessary.
1 5 1 1 Main outdoor unit difference between high and low
pressure is too low. Not enough pressure difference between high and low. Function
1 5 1 2 Sub1 outdoor unit difference between high and low
pressure is too low. error of outdoor unit four-way reversing valve (defective, discon-
QHFWHGUHVLVWDQFHLVQRWȍ
1 5 1 3 Sub2 outdoor unit difference between high and low
pressure is too low.
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification.
186
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
1 5 3 2 Sub1 outdoor unit upper heat exchanger temperature • Check the connection on the outdoor unit PCB.
sensor error.
• Thermistor shorted or opened.
1 5 3 3 Sub2 outdoor unit upper heat exchanger temperature
sensor error. • Check for 12 V DC between 12 V and GND (red to black) for
5 V DC.
1 5 4 1 Main outdoor unit lower heat exchanger temperature
sensor error. • Check the Signal to GND (white to black) and use correct chart
from Troubleshooting section to compare with actual system
1 5 4 2 Sub1 outdoor unit lower heat exchanger temperature
sensor error. temperature.
1 5 4 3 Sub2 outdoor unit lower heat exchanger temperature
sensor error.
Communication error between Main outdoor unit exter- Main outdoor unit external board main to sub MICOMs
1 8 2 1 nal board main and sub MICOMs. communication failure.
1 8 2 2 Communication error between Sub1 outdoor unit exter- Sub1 outdoor unit external board main to sub MICOMs
nal board main and sub MICOMs. communication failure.
1 8 2 3 Communication error between Sub2 outdoor unit exter- Sub2 outdoor unit external board main to sub MICOMs
nal board main and sub MICOMs. communication failure.
• Inlet water temperature is <5°C (41°F). Raise error code –
Level 3 response.
Error Codes
1 8 7 1
• Water outlet temperature sensor is disconnected or shorted.
Values read less than -43°C or greater than +96°C (less than
-45.4°F or greater than +204.8°F).
Outdoor Unit
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification. 187
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
ERROR CODE TABLES
WITH
Please refer to the Safety Precautions on pages 4-7 for more detail to prevent injury or death regarding the operation and service
WARNING troubleshooting of the Multi V product.
• If 2 heat recovery unit port addresses are the same and the
- 5 1 of Capacity of indoor units connected to the heat
recovery unit exceeds allowable limits. ports are twinned; >108 Mbh total of multiple indoor units are
HR connected.
Unit • If 3 heat recovery unit port addresses are the same and the
ports are all connected, >162 Mbh total of multiple indoor
units connected.
• If the total connected indoor unit nominal capacity exceeds
192 Mbh for a single heat recovery unit.
• Error code displays on the outdoor unit SSD, the heat recov-
ery unit SSD, or in LGMV.
2 0 0 1 Auto pipe search failure. Auto piping procedure did not complete properly.
2 0 1 Heat recovery unit liquid sensor error. (C = Heat Disconnection or short circuit of heat recovery unit liquid pipe
recovery unit + Heat recovery unit number). sensor.
Heat recovery unit subcooling pipe inlet sensor Disconnection or short circuit of heat recovery unit subcooling
2 0 2 error. (C = Heat recovery unit + Heat recovery unit
Heat Recovery Unit
2 4 2 * Network error of central controller. Inability of the central controller to receive information from the
outdoor unit.
For detailed information on how to troubleshoot each error, see the Multi V Service Manual on www.lghvac.com.
Due to our policy of continuous product innovation, some specifications may change without notification.
188
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
LG MONITORING VIEW (LGMV)
WITH
DIAGNOSTIC SOFTWARE
Images on these pages are examples of LGMV screenshots. Actual images may differ depending on the version of the software and the units
installed.
Error Codes
LGMV Display
LGMV displays the following real-time data:
• Actual inverter compressor speed • Four-way reversing valve operation
• Target inverter compressor speed indicator light
• Actual outdoor fan speed • Pressure graph showing actual low pressure and actual high pres-
• Target outdoor unit fan speed sure levels
• Actual superheat • Error code display
• Target superheat • Operating mode indicator
• Actual subcooler circuit superheat • Target high pressure
• Target subcooler circuit superheat • Target low pressure
• Main EEV position • PCB (printed circuit board) version
• Subcooling EEV position • Software version
• Inverter compressor current transducer value • Installer name
• Outdoor air temperature • Model no. of outdoor units
• Actual high pressure/saturation temperature • Site name
• Actual low pressure/saturation temperature • Total number of connected indoor units
• Suction temperature • Communication indicator lights
• Inverter compressor discharge temperature • Indoor unit capacity
• Constant speed compressor discharge temperature • Indoor unit operating mode
• Front outdoor coil pipe temperature • Indoor unit fan speed
• Back outdoor coil pipe temperature • Indoor unit EEV position
• Liquid line pipe temperature • Indoor unit room temperature
• Subcooler inlet temperature • Indoor unit inlet pipe temperature
• Subcooler outlet temperature • Indoor unit outlet pipe temperature
• Average indoor unit (IDU) pipe temperature • Indoor unit error code
• Inverter compressor operation indicator light
Due to our policy of continuous product innovation, some specifications may change without notification. 189
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
LG MONITORING VIEW (LGMV)
WITH
DIAGNOSTIC SOFTWARE
Additional screens can be accessed by tabs on the main screen. LGMV Cycleview Screen.
Additional screens include:
1. Cycleview: Graphic of internal components including:
• Compressors showing actual speeds
• EEVs
• Indoor units
• Liquid injection valves
• Temperature and pressure sensors
MULTI V 5 with LGRED Outdoor Unit Installation Manual
2. Graph: Full screen graph of actual high and low pressures and
high and low pressure limits. A sliding bar allows viewing of
previously recorded data. LGMV Graph Screen.
Images on these pages are examples of LGMV screenshots. Actual images may differ depending on the version of the software and the units
installed.
Due to our policy of continuous product innovation, some specifications may change without notification.
190
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
MAINTENANCE RECOMMENDATIONS
WITH
It is also recommended to monitor system operation using LGMV Software at least once a year.
Error Codes
Due to our policy of continuous product innovation, some specifications may change without notification. 191
©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
INSTALLATION CHECKLIST
WITH PAGE 1
Brazing Practices
Description Check
Use medical grade dry nitrogen for purging during brazing (constant 3 psig while brazing).
15% silver brazing material only.
Minimum 3/4 inch, maximum 1 inch condensate piping installed on indoor units – material used is acceptable under local code.
Insulated to prevent condensation.
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
INSTALLATION CHECKLIST
WITH PAGE 2
Example:
Measured Values: 242, 241, 246
Sum of Measured Values: 729
Average of Measured Values: 729 / 3 = 243
Maximum Deviation from Average: 246 - 243 = 3
% Imbalance: 3 / 243 x 100 = 1.23%
Ground wire was installed and properly terminated at the outdoor unit(s).
The power supplied was clean with voltage fluctuations within specifications (±10% of nameplate for 208-230V units, 414-528V for
460V units).
Power wiring to the outdoor unit(s) was installed per all local, state, and NEC requirements.
Power wiring to each indoor unit was installed per all local, state, and NEC requirements.
Communications cable between the outdoor unit(s) and indoor units was connected in a daisy chain configuration (i.e., single paral-
lel chain). No “star” or multiple parallel circuits. No cable splices or wire nuts were used to connect communications cables.
Record Communication Voltage Range
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
INSTALLATION CHECKLIST
WITH PAGE 3
Brazing Practices
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
INSTALLATION CHECKLIST
WITH PAGE 4
Installation—Refrigerant Piping
,QVWDOODWLRQ²&RQGHQVDWH3XPS'UDLQ,QVWDOODWLRQ
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP CHECKLIST
WITH Page 1
Date: ____________________________________________________________________________________
Address: _________________________________________________________________________________
_________________________________________________________________________________
A triple system evacuation has been performed. Micron gauge reading held at a maximum of 500 for one (1) hour with all isolation
valves open and without the vacuum pump connected.
Evacuation
Initial Micron Level _____________________________ End Micron Level ______________________________
Start Date ____________________________________ End Date ____________________________________
Start Time ____________________________________ End Time ____________________________________
Rise ________________________________________
Power was energized to the outdoor unit(s) at ______________(time) on __________day to power the compressor crankcase
heater(s). (Must be at least 6 hours before setup.)
The communications cable to the indoor units has been disconnected from the IDU (B) and IDU (A) terminals at the outdoor
unit(s).
None of the outdoor unit(s) service valves have been opened during the installation and preparation of the system for
setup. (If the valves were opened, the factory refrigerant charge has been released.)
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP CHECKLIST
WITH Page 2
____________________________________________
7KLVIRUPPXVWEHFRPSOHWHGDQGVXEPLWWHGWR/*DPLQLPXPRIWKUHH ZHHNVSULRUWR¿QDOVFKHGXOLQJRIDQ\VWDUWXS
Note: If any of the above items are not complete at time of start-up, back charges will be assessed for additional costs.
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP CHECKLIST
WITH Page 3
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
PRE-SETUP CHECKLIST
WITH Page 4
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SETUP NOTES
WITH
Date: ____________________________________________________________________________________
Address: _________________________________________________________________________________
_________________________________________________________________________________
Due to our policy of continuous product innovation, some specifications may change without notification. ©LG Electronics U.S.A., Inc., Englewood Cliffs, NJ. All rights reserved. “LG” is a registered trademark of LG Corp.
SETUP CHECKLIST
WITH
EXCEPTION REPORT
Job Name / Location ________________________________________________________________________ Tag # _________________
Date: ____________________________________________________________________________________
Address: _________________________________________________________________________________
_________________________________________________________________________________
IDU's
Adjusted Group Group
Central Sensor
Building Fan Seƫng Value System member ID FuncƟon
Unit Tag Room ID Type Model Serial # Control Strategy
Floor . Address or N/A if not M=Master
Address (RA/ZC/Both)
Low | Medium | High in a group S=Slave
rev 20130619.3
To access additional technical documentation such as submittals, indoor
unit engineering manuals, installation, service, product data performance,
general best practice, and building ventilation manuals, as well as white
papers, catalogs, LATS software programs, and more, log in to
www.lghvac.com.
20001747 ISO 9001: 2008
LG ELECTRONICS INC.