Challenges: Why Agri-Food Systems Need to Be Transformed
Opportunities: What Science Can Offer to Address these Challenges
The CGIAR partnership: Our Contribution to achieving the UN’s Sustainable Development Targets
Where our Food Crops Come from: A new estimation of countries’ interdependenc...CWR Project
Presentation given by CIAT/Colin K. Khoury at the side event "Where our Food Crops Come from: A new estimation of countries’ interdependence in plant genetic resources" at GB6, International Treaty on Plant Genetic Resources for Food and Agriculture, Rome, 7 October 2015
The contribution of smallholder farmers to the Agenda 2030ExternalEvents
http://www.fao.org/globalsoilpartnership/en/
This presentation was presentaed during the seminar Soils & Pulses: symbiosis for life that took place at FAO HQ on 19 Apr 2016. it was made by Wafaa El Khoury and it presents The contribution of smallholder farmers to the Agenda 2030.
Presentation at the Dupont Forum. The panel will look at how investing in technologies is insufficient on its own to enact effective agricultural water management, and will explore the importance of accompanying context appropriate policies and institutions.
Biodiversity for Food Security, alleviation of Micronutrients Malnutrition an...Francois Stepman
Presentation by: Eltayb Abdellatef Scientist, Commission for Biotechnology and Genetic Engineering, National Center For Research, Khartoum, Sudan
14-18 June 2021. AERAP Science organised the Africa-Europe Science and Innovation Summit, which aimed to enhance science and innovation cooperation between Africa and Europe.
GRiSP - Presentation for Discussion with Donors and Partners - June 2013CGIAR
- GRiSP is a global partnership led by IRRI that coordinates rice research and development among international organizations to address challenges facing global rice production.
- Its goals are to increase rice production sustainably and profitably for farmers, improve food security and nutrition, and reduce the environmental footprint of rice.
- Key targets for its first phase included lifting 72 million people out of poverty and reducing hunger for 40 million people in Asia through increased rice yields and incomes for farmers.
- It has over 900 research and development partners worldwide working across six themes, from genetic diversity to capacity building. Indicators will track progress toward outcomes like increased yields, water productivity, and farmer incomes.
The document discusses the need for international collaboration in wheat research and improvement to address global challenges of increasing food production. It outlines several existing international networks and partnerships for wheat research, including the International Wheat Improvement Network (IWIN), International Wheat Yield Partnership (IWYP), Wheat Initiative, and Heat and Drought Wheat Improvement Consortium (HeDWIC). These networks aim to increase wheat yields, address issues like climate change, and disseminate new varieties and technologies through a collaborative approach involving multiple countries and organizations.
Evidence-based policy-making: The role of impact assessment studies and thei...ExternalEvents
Evidence-based policy-making: The role of impact assessment studies and their implications for agricultural biotechnologies presentation by David Spielman, International Food Policy Research Institute, Washington D.C., United States of America
Jimmy Smith, Director General of ILRI, outlines the importance of livestock to developing economies and proposes ways to double livestock production through better feeds. Livestock represents five of the six most valuable global commodities and production is increasing faster in developing countries. Livestock plays a key role in livelihoods, nutrition, health and ecosystems. The CGIAR could harness new science on feeds, genetics, and management to boost productivity and sustainability, improving food security and reducing poverty and emissions.
Biofortified Sweetpotato as a Key Contributor to Sustainable Agri-Food System...Francois Stepman
Presentation by Jan Low Principal Scientist, International Potato Center (CIP) Nairobi, Kenya.
14-18 June 2021. AERAP Science organised the Africa-Europe Science and Innovation Summit, which aimed to enhance science and innovation cooperation between Africa and Europe.
This document discusses challenges facing global agriculture and nutrition, including poor diets being a leading health risk worldwide, and farmers facing novel climates by 2050 due to climate change. It notes that three crops - wheat, rice, and maize - provide over half the world's plant-based calories, and highlights millets as nutritious and resilient but neglected crops. The remainder of the document outlines efforts in India to mainstream the production and consumption of millets, including improving cultivation practices with farmers, establishing community seed banks, developing millet products, including millets in school meals and the Public Distribution Scheme.
Masiga - Enhanced Utilization of Biotechnology Research and Development Innov...CIALCA
Presentation delivered at the CIALCA international conference 'Challenges and Opportunities to the agricultural intensification of the humid highland systems of sub-Saharan Africa'. Kigali, Rwanda, October 24-27 2011.
This document outlines crop diversity in Ethiopia and strategies for conservation. It discusses that Ethiopia has significant crop diversity as a center of origin for many plants. It notes major crops like coffee, tef, and minor crops. It then explains the importance of conserving crop diversity for food security, environment, and economy. The document outlines in-situ and ex-situ conservation strategies and their benefits and challenges. It emphasizes that crop diversity provides genes for improving crops and meeting human needs.
The Conservation and Use of Crop Genetic Resources for Food SecurityColin Khoury
Presentation of PhD thesis, Wageningen University, Wageningen, The Netherlands, for the Hugo de Vries award by the Royal Botanical Society of the Netherlands (KNBV) for the best botany related thesis in the Netherlands in 2015, 11 April 2016, Lunteren, The Netherlands.
Developing and Delivering Zinc Wheat: The Role of Wheat in Reducing Hidden Hu...CIMMYT
Presentation delivered by Dr. Wolfgang Pfeiffer (HarvestPlus, Colombia) at Borlaug Summit on Wheat for Food Security. March 25 - 28, 2014, Ciudad Obregon, Mexico.
http://www.borlaug100.org
Ann Tutwiler, Director General, Bioversity International presentation on NOT finding the world's next superfood. This presentation was delivered at Kew Gardens on May 12th 2016 at the State of the World's Plants Symposium.
Abstract: In the last few years, superfoods such as quinoa, amaranth and goji berries have been celebrated in the international media in recognition of their rich nutrient content.
But it is not just Western consumers that can benefit from rediscovering these forgotten foods.
M. Ann Tutwiler, Director General, Bioversity International, will explain how many nutritious traditional foods, which have largely fallen off menus and research-for-development agendas in favour of a handful of staple grains, are starting to make a comeback on the plates of the world’s poorest and most malnourished populations.
Bioversity International carries out research on a diverse range of underutilized crops, and advocates for their wider use in healthy diets from sustainable food systems. This overview will include examples of how research-for-development efforts on quinoa in the High Andes and minor millets in India have helped bring diverse varieties back to the farm, the market and the plate. She will highlight how these crops are often not just nutrient-rich but also have a high potential to contribute to livelihoods. They are often also highly resilient to today’s production challenges, such as climate change.
In conclusion, M. Ann Tutwiler will outline the urgent need to identify, promote and protect these useful plants which all have the potential to be placed into a diverse basket of Super Foods when it comes to delivering food and nutrition security.
World agriculture is facing its biggest challenge due to population growth and climate change. Crop diversity is critical for adapting to these challenges but many varieties have been lost. The Crop Trust works to conserve crop diversity globally to ensure food security. A new initiative called DivSeek aims to facilitate open access to genomic and phenotypic data associated with genebank collections through common data standards. This will help breeders develop climate-resilient crops and address food insecurity.
Camila Oliveira is an environmental analyst at the Ministry of the Environment in Brazil and national manager of the Bioversity International 4-country project 'Biodiversity for Food and Nutrition'. In her presentation for Italian Development Cooperation's Expo 2015 event she brought attention to Brazil's precious agricultural biodiversity and how it can be used for food and nutrition security. Learn more about Bioversity International's participation at Expo 2015: http://bit.ly/1GOimdm
ABSTRACT
Brazil suffers from high rates of malnutrition, with one in three children aged between five and nine overweight. Brazil is also home to a significant amount of the world’s biodiversity much of it edible and nutritious. As part of the Biodiversity for Food and Nutrition (BFN) initiative funded by the United Nations, Brazil believes that biodiversity for food and nutrition can help fight its current diet-related problems. As such, the government is adopting three approaches to effectively embed biodiversity into the national food and nutritional security policy framework.
The first approach is to increase knowledge of how diverse underutilized native species can contribute to food security by carrying out a nutritional analysis of 70 edible plant species. Three national programmes are exploiting the nutrition potential of some of these species. These include targeting the national school feeding programme to promote healthy eating habits in schools, a scheme which also ensures that 30% of procurement is from local family farmers.
The second approach has been the revision of the National Biodiversity Strategy and Action Plan to comply with the Aichi Biodiversity Targets of the Convention on Biological Diversity and to halt biodiversity loss. One of the reasons for biodiversity loss in Brazil is the limited appreciation of the use of biodiversity for food and nutrition to date.
The third approach is to increase awareness on how biodiversity can contribute to food and nutrition. A weekly farmers’ market has been launched at the Brasilia Botanical Garden and several cultural gastronomic events organized in different cities, with cooking demonstrations and opportunities to taste native and nutritious biodiverse foods.
Innovation in the Irish Agrifood Sector: Farm Level FocusAll_about_business
This document summarizes research on innovation at the farm level in Ireland's agri-food sector. An innovation index was designed using data from the Teagasc National Farm Survey to assess innovative performance across different farm systems and regions. Dairy farms generally showed above average innovation scores compared to cattle and sheep farms. There was also regional variation, with farms in the Southeast region and East region tending to be most innovative. Characteristics of high-innovating farms included higher incomes, investments, and lower reliance on subsidies compared to less innovative farms. Factors found to positively influence innovation included farm size, land intensity, access to loans and education, while age and off-farm employment acted as barriers. The researchers recommend policies to facilitate
The document discusses how the Future Internet can drive innovation in the smart agri-food sector. It describes the agri-food cluster as an important European economic pillar and outlines global food challenges. The document then discusses how more data and the Future Internet can help address issues like sustainability, food safety, and consumer concerns. It proposes using the Future Internet to enable seamless cross-organizational collaboration, transparency, and new applications across the agri-food supply chain from farms to logistics to retail. Finally, it outlines the objectives and approach of the SmartAgriFood project to boost Future Internet use in agriculture and food.
The document discusses the increasing role of information and communication technologies (ICT) in agriculture and food systems. It describes how technologies like mobile/cloud computing, location-based monitoring, the Internet of Things, and big data can help address challenges in transportation, input supply, farming, food processing, retail, and consumer demands. Examples are provided of ICT solutions that offer benefits like early detection of animal health issues, optimized crop spraying advice, and food traceability. Concerns are raised about issues like data ownership and the potential for industry consolidation or lock-in under different business models enabled by big data in agriculture.
Governance of Data Sharing in Agri-Food - towards common guidelinesSjaak Wolfert
Big Data is becoming a new asset in the agri-food sector including enterprise data from operational systems, sensor data, farm equipment data, etc. Recently, Big Data applications are being implemented, aiming at improving farm and chain performance. Many companies are refraining from sharing data because of the fear of governance issues such as data security, privacy and liability. Moreover, they are often in a deadlock or afraid to take the first step even though they expect to develop new business with data. To accelerate the development of Big Data applications, this paper analyses governance issues and introduces a set of guidelines for governance of data sharing in agri-food networks. A framework for analysis was derived from literature and used to identify lessons learned from recent projects or initiatives. From these results, a set of draft guidelines was developed. The framework and guidelines were evaluated in a workshop. The framework consists of factors that are related to governance on data sharing in networks. Internal factors are: efficiency, effectiveness, inclusiveness, legitimacy & accountability, credibility and transparency. External factors are: political, economic, social, technological, legal and environmental factors. For each of these factors, guidelines are provided in terms of: issues to be addressed, best practices and lessons learned from other projects and initiatives. It is concluded that the framework is complete in covering all relevant issues on governance in data sharing but the guidelines must be considered as a first set, which can be further improved and extended in the future. A wiki-type-of-website could help to upscale the guidelines at a global level. The guidelines could also be further refined accounting for different maturity levels of agri-food networks. The guidelines in this paper are considered to be a valuable step into the direction of solving governance issues in data sharing, which is expected to accelerate Big Data applications in the agri-food domain.
How IoT is changing the agribusiness landscapeSjaak Wolfert
Smart Farming involves many sensing and monitoring devices, intelligent software for analysis & planning and mechatronics/robots closing the cyber-physical farm management cycle. Big Data on prices, markets, consumer behavior, etc. increasingly affect the whole agribusiness providing predictive insights in farming operations, drive real-time operational decisions and redesign business processes for game-changing business models. Major shifts in roles and power relations among different players in food supply chain networks can be expected. This presentation will briefly describe the IoT developments in agri-food business and present the changing business landscape with special attention to the role of software ecosystems in this development.
Internet of Things based approach to Agriculture MonitoringCiby Punnamparambil
The document discusses using an IP-based wireless sensor network for agricultural monitoring. It begins with background on Internet of Things technologies like 6LoWPAN and CoAP. It then describes an agriculture use case with soil sensors modeled as CoAP resources. The proposed deployment architecture involves wireless sensors, a 6LoWPAN border router, and remote CoAP client. Implementation details and screenshots of a web-based monitoring system are provided. Finally, plans for an IoT testbed hosted by ERNET India are outlined to support research on heterogeneous devices and standards.
This document discusses applications of IoT in smart cities and agriculture. It introduces DunavNET, a company focused on IoT solutions including smart city applications like ekoNET for air quality monitoring and mTicketing, and smart agriculture applications like irrigNET for optimized irrigation. It describes DunavNET's IoT product portfolio and provides examples of IoT pilot projects and solutions for issues in agriculture and cities.
The KG2 Database contains 135,000 farm records from over 25 years of experience in agribusiness in Australia. It maintains purchase decisions, operating details, and opinions of farmers. KG2 works with organizations involved in crop production and provides data solutions for extensive animal production such as beef and sheep as well as intensive industries like dairy, pigs, and poultry. KG2 also has databases of agricultural service providers that support farmers.
IOT based smart security and monitoring devices for agriculture sneha daise paulson
Agriculture sector being the backbone of the Indian economy deserves security. Security not in terms of resources only but also agricultural products needs security and protection at very initial stage, like protection from attacks of rodents or insects, in fields or grain stores. Such challenges should also be taken into consideration. Security systems which are being used now a days are not smart enough to provide real time notification after sensing the problem. The integration of traditional methodology with latest technology as Internet of Things can lead to agricultural modernization. Keeping this scenario in mind an ‘Internet of Things’ based device have been designed, tested and analyzed which is capable of analyzing the sensed information and then transmitting it to the user. This device can be controlled and monitored from remote location and it can be implemented in agricultural fields, grain stores and cold stores for security purpose. This paper is oriented to accentuate the methods to solve such problems like identification of rodents, threats to crops and delivering real time notification based on information analysis and processing without human intervention. In this device, mentioned sensors and electronic devices are integrated using Python scripts. Based on attempted test cases, we were able to achieve success in 84.8% test cases.
Connected Agricultural services and internet of things..Atul Khiste
This document discusses connected agriculture and the Internet of Things. It begins with an overview of global challenges in food production such as the need to increase food output 50% by 2025 to feed a growing population. It then discusses opportunities for connected solutions in agriculture to address issues like increasing productivity while using fewer resources. The document proposes a connected agriculture solution that would provide farmers technology and expert advice to better manage irrigation, seeds, pesticides, and make decisions. It outlines a functional architecture and implementation challenges for the solution.
Food planet health Fabrice DeClerck CLUES 2020Alain Vidal
The document discusses a report from the EAT-Lancet Commission on healthy diets from sustainable food systems. It outlines the commission's goal of achieving healthy diets for nearly 10 billion people by 2050 through 1 goal, 2 targets, and 5 strategies. The targets are defined as healthy reference diets and planetary boundaries for environmental systems. Modeling was used to analyze measures to stay within boundaries while delivering healthy diets.
Dr. Marty D. Matlock - Impacts of GMO Products on Food Security and TradeJohn Blue
Impacts of GMO Products on Food Security and Trade - Marty D. Matlock, PhD PE BCEE, Executive Director, Office for Sustainability, Area Director, Center for Agricultural and Rural Sustainability, Professor, Biological and Agricultural Engineering, University of Arkansas, from the 2014 NIAA Annual Conference titled 'The Precautionary Principle: How Agriculture Will Thrive', March 31 - April 2, 2014, Omaha, NE, USA.
More presentations at http://www.trufflemedia.com/agmedia/conference/2014_niaa_how_animal_agriculture_will_thrive
One Health approaches to different problems: Work at the International Livest...ILRI
The document discusses One Health approaches used by the International Livestock Research Institute (ILRI). ILRI takes a One Health approach to address problems at the human-animal-environment interface. It works on projects related to zoonotic diseases, food safety issues like aflatoxins, and increasing sustainable livestock production to meet the growing global demand for animal proteins. ILRI aims to find solutions that improve food security and public health while minimizing environmental impacts.
CIMMYT's mission is to increase the productivity of maize and wheat systems to ensure global food security and reduce poverty. It has worked towards this mission for over 70 years through agricultural research and partnerships. Maize, wheat and rice remain critically important staple crops, providing over 40% of the world's food and a major source of calories and protein for billions in developing countries. CIMMYT's research on improving yields, nutrition, and climate resilience of these cereals through partnerships has been integral to global food security and poverty reduction.
Climate-smart, sustainable and nutritious food for allCGIAR
How can public agricultural research engage with agri-business to tackle sustainability challenges?
Presented by Alain Vidal, Director of Strategic Partnerships, CGIAR System Organization, at the World Business Council For Sustainable Development (WBCSD) Climate-Smart Agriculture Strategy Meeting, Montreux, Switzerland on 29 March, 2017.
CIAT is a CGIAR research center focused on reducing hunger and poverty in the tropics through agricultural research. It faces the challenges of feeding a growing population with less land and water and a changing climate. CIAT conducts research to increase crop productivity, improve natural resource management, and inform policies, with a focus on beans, cassava, rice and forages. It works across Africa, Asia, and Latin America to deliver impacts at scale through partnerships.
Role of beneficial microbes in next green revolutionMehjebinRahman2
The document summarizes the keynote speech given by Miss Mehjebin Rahman on probing beneficial microbes for the next green revolution. It discusses how the green revolution significantly increased food production but led to various negative environmental consequences. It argues that the next green revolution needs a more sustainable approach, and that microbes have great potential to promote plant growth and stress resistance while maintaining sustainability. Several companies are developing microbial treatments to boost yields without synthetic fertilizers. The document outlines various plant growth promoting microbes and their mechanisms, such as nitrogen fixation, phosphate solubilization, and phytohormone production.
Research Outputs and Approaches to Enhance Food Security and Improve Livelih...ICARDA
The document summarizes research outputs and approaches from the International Center for Agricultural Research in the Dry Areas (ICARDA) to enhance food security and improve livelihoods. It discusses constraints like drought, desertification, and climate change leading to food insecurity. ICARDA's strategic plan focuses on risk management, integrated water and land management, and diversification to improve nutrition and incomes. Technologies developed include improved crop varieties tolerant to abiotic stresses and diseases, as well as seed production approaches to cope with drought.
The document summarizes constraints to food security and poverty in dry areas, and discusses ICARDA's research approaches and outputs to enhance food security and livelihoods. It outlines challenges including climate change, water scarcity, and population growth. ICARDA's strategic plan focuses on risk management, integrated water and land management, diversification, and capacity building. The organization develops improved crop varieties and management practices to intensify sustainable production and increase resilience to stresses.
Crop failures can result from adverse weather conditions, pests, diseases, or poor farming practices and negatively impact food prices, nutrition, and local economies. Climate change exacerbates these risks by increasing extreme weather events and reducing crop yields. It also threatens food access by raising food prices when supply is low and decreases nutritional value by reducing protein and micronutrient content in crops. Food waste is another issue, with about a third of global food production lost between farm and market or market and table. International cooperation on sustainable agriculture, nutrition, and food systems is needed to ensure global food security.
Enhancing Global Food Resources: CGIAR Strategy and its future Portfolio of P...CGIAR
Presented to the Second International Forum on Global Food Resources, 5-6 October 2016, Hokkaido University.
By Peter Gardiner, CGIAR System Management Office, France
WHEAT - Presentation for Discussion with Donors and Partners - June 2013cgxchange
This document summarizes the agenda and presentations for a CRP Engagement with Donors meeting on wheat. It includes:
- An overview of WHEAT's Impact Pathways, Theories of Change, and impact on the ground through improved wheat varieties.
- Examples of impact through genetic discoveries to combat wheat rust in Africa and make countries epidemic-proof.
- Charts showing the large number of poor people dependent on wheat-based farming systems in South Asia.
- Details of WHEAT's regional collaborations and flagship projects focused on sustainably growing more wheat with less inputs and improved livelihoods.
- Information on refining WHEAT's Intermediate Development Outcomes with research partners.
WHEAT - Presentation for Discussion with Donors and Partners - June 2013CGIAR
The document summarizes discussions from a CRP Engagement with Donors meeting on wheat. It provides an agenda for the meeting covering topics like WHEAT impact pathways, theories of change, gender and impact, intermediate development outcomes, flagship projects, partnerships, and conclusions. Examples are given of WHEAT's impact in reducing threats from wheat stem rust Ug99 in Africa and increasing wheat yields and varieties in countries like Ethiopia. Priority areas and impact pathways to achieve improved wheat-based livelihoods through more sustainable systems and increased productivity are presented.
I sette principi per un’agricoltura sostenibile descritti nel rapporto di Greenpeace sono:
1. restituire il controllo sulla filiera alimentare a chi produce e chi consuma, strappandolo alle multinazionali dell’agrochimica;
2. sovranità alimentare. L'agricoltura sostenibile contribuisce allo sviluppo rurale e alla lotta contro la fame e la povertà, garantendo alle comunità rurali la disponibilità di alimenti sani, sicuri ed economicamente sostenibili;
3. produrre e consumare meglio: è possibile già oggi, senza impattare sull’ambiente e la salute, garantire sicurezza alimentare e, contemporaneamente, lottare contro gli sprechi alimentari. Occorre diminuire il nostro consumo di carne e minimizzare il consumo di suolo
per la produzione di agro-energia. Dobbiamo anche riuscire ad aumentare le rese dove è necessario, ma con pratiche sostenibili;
4. incoraggiare la (bio)diversità lungo tutta la filiera, dal seme al piatto con interventi a tutto campo, dalla produzione sementiera all’educazione al consumo;
5. proteggere e aumentare la fertilità del suolo, promuovendo le pratiche colturali idonee ed eliminando quelle che invece consumano o avvelenano il suolo stesso;
6. consentire agli agricoltori di tenere sotto controllo parassiti e piante infestanti, affermando e promuovendo quelle pratiche (già esistenti) che garantiscono protezione e rese senza l'impiego di costosi pesticidi chimici che possono danneggiare il suolo, l'acqua,
gli ecosistemi e la salute di agricoltori e consumatori;
7. rafforzare la nostra agricoltura, perché si adatti in maniera efficace il sistema di produzione del cibo in un contesto di cambiamenti climatici e di instabilità economica.
Per contribuire alla crescita dell’agricoltura sostenibile, Greenpeace collabora con agricoltori e comunità rurali.
The document provides an overview of the CGIAR Consortium's work and priorities. It discusses:
1) New priorities for CGIAR including strengthening partnerships in Africa through agreements like the MoU with the African Union and developing an African Science Agenda.
2) The Dublin Process to enhance alignment between CAADP and CGIAR through joint planning and priority setting.
3) CGIAR's research agenda organized around themes like genes and varieties, policies and institutions, livestock, and climate change agriculture.
4) Progress made through CGIAR reforms including united funding, research programs, and a shared research agenda to deliver greater development outcomes and impact.
Creating a sustainable food future - World Resources InstituteHanifXiaomi
This document presents a menu of 22 solutions across 5 courses of action to close the food, land, and greenhouse gas emission gaps projected for 2050. The food gap is estimated at 7,400 trillion calories, the land gap at 593 million hectares, and the GHG mitigation gap at 11 gigatons of CO2 equivalent. The menu includes options to reduce food demand growth, increase food production without expanding agricultural land, protect ecosystems while limiting land-shifting, increase fish supply, and reduce agricultural GHG emissions. Ambitious coordinated action across all areas, including technological innovation, will be needed to achieve a sustainable food future.
The document summarizes the major challenges facing the global agricultural system by 2050:
1) A 70% "food gap" must be closed to feed a projected population of 9.6 billion people while reducing environmental impacts;
2) Agricultural production must increase to close this gap while also providing economic opportunities for the world's 2 billion smallholder farmers and reducing poverty;
3) Land and water constraints mean crop and pasture yields must increase substantially faster than in the past to avoid further ecosystem degradation from agricultural expansion.
The document summarizes the major challenges facing the global agricultural system by 2050:
1) A 70% "food gap" must be closed to feed a projected population of 9.6 billion people while reducing environmental impacts;
2) Agricultural production must increase to close this gap while also providing economic opportunities for the world's 2 billion smallholder farmers and reducing poverty;
3) Land and water constraints mean crop and pasture yields must increase substantially faster than in the past to avoid further ecosystem degradation from agricultural expansion.
Similar to Transforming Agri-food Systems to Achieve Healthy Diets for All (20)
Gendered youth transitions to adulthood in the Drylands: Implications for tar...CGIAR
This presentation was given on 19 December 2019 by Esther Njuguna-Mungai (CGIAR Research Program on Grain Legumes and Dryland Cereals), Ms. Katindi Sivi-Njonjo (GLDC Affiliated PhD student) and Dr. Eileen Bogweh Nchanji (International Center for Tropical Agriculture / CIAT) as part of the webinar ‘Gendered youth transitions to adulthood in the Drylands: Implications for targeting'. The webinar was co-organized by the CGIAR Collaborative Platform for Gender Research and the CGIAR Research Program on Grain Legumes and Dryland Cereals.
Read more about this webinar at: https://gender.cgiar.org/webinar-youth-dryland/
Find out about other webinars hosted by the CGIAR Collaborative Platform for Gender Research: http://gender.cgiar.org/gender_events/webinars/
Power through: A new concept in the empowerment discourseCGIAR
This presentation was given by Alessandra Galiè (ILRI) and Cathy Farnworth (independent) on 27 November 2019, as part of the webinar ‘Power through: A new concept in the empowerment discourse'. The webinar was co-organized by the CGIAR Collaborative Platform for Gender Research and the International Livestock Research Institute (ILRI).
Read more about this webinar at: https://gender.cgiar.org/webinar-power-through/
Find out about other webinars hosted by the CGIAR Collaborative Platform for Gender Research: http://gender.cgiar.org/gender_events/webinars/
Friends, neighbours and village cereal stockists: hope for non-hybrid seed ac...CGIAR
This presentation was given by Esther Njuguna-Mungai (CGIAR Research Program on Grain Legumes and Dryland Cereals) on 21 November 2019, as part of the webinar ‘Gender dynamics in formal seed systems in Sub-Saharan Africa and worldwide lessons'. The webinar was co-organized by the CGIAR Collaborative Platform for Gender Research and CGIAR Research Program on Maize.
Read more about this webinar at: https://gender.cgiar.org/webinar-seed-system-ssa/
Find out about other webinars hosted by the CGIAR Collaborative Platform for Gender Research: http://gender.cgiar.org/gender_events/webinars/
Seed security and resilience: Gender perspectivesCGIAR
This presentation was given by Shawn McGuire (Food and Agriculture Organization / FAO) on 21 November 2019, as part of the webinar ‘Gender dynamics in formal seed systems in Sub-Saharan Africa and worldwide lessons'. The webinar was co-organized by the CGIAR Collaborative Platform for Gender Research and CGIAR Research Program on Maize.
Read more about this webinar at: https://gender.cgiar.org/webinar-seed-system-ssa/
Find out about other webinars hosted by the CGIAR Collaborative Platform for Gender Research: http://gender.cgiar.org/gender_events/webinars/
Gender dynamics in formal seed systems in Sub-Saharan Africa and worldwide le...CGIAR
This presentation was given by Rahma Adams (International Maize and Wheat Improvement Center / CIMMYT) on 21 November 2019, as part of the webinar ‘Gender dynamics in formal seed systems in Sub-Saharan Africa and worldwide lessons'. The webinar was co-organized by the CGIAR Collaborative Platform for Gender Research and CGIAR Research Program on Maize.
Read more about this webinar at: https://gender.cgiar.org/webinar-seed-system-ssa/
Find out about other webinars hosted by the CGIAR Collaborative Platform for Gender Research: http://gender.cgiar.org/gender_events/webinars/
Reflections on gender transformative approaches in agriculture – The promise ...CGIAR
This presentation was given by Franz Wong (KIT Royal Tropical Institute) and Rhiannon Pyburn (CGIAR Collaborative Platform for Gender Research) on 20 June 2019, as part of the webinar ‘Reflections on gender transformative approaches in agriculture – The promise and cautionary tales'.
The webinar was co-organized by the CGIAR Collaborative Platform for Gender Research and KIT Royal Tropical Institute.
Read more about this webinar at: https://gender.cgiar.org/webinar-gta-2019/
Find out about other webinars hosted by the CGIAR Collaborative Platform for Gender Research: http://gender.cgiar.org/gender_events/webinars/
Culture, choice and action in legume seeds systems in East and North UgandaCGIAR
This presentation was given by Dr. Esther Njuguna-Mungai (ICRISAT) and Catherine Mesianto Lengewa (CBCC-Africa) on May 10, 2019, as part of the webinar ‘Culture, choice and action in legume seeds systems in East and North Uganda'. The webinar was co-organized by the CGIAR Collaborative Platform for Gender Research and the CGIAR Research Program on Grain Legumes and Dryland Cereals.
Read more about this webinar at: https://gender.cgiar.org/webinar-nonhybrid-seeds-uganda/
Find out about other webinars hosted by the CGIAR Collaborative Platform for Gender Research: http://gender.cgiar.org/gender_events/webinars/
Gender differentiation of farmers' knowledge, trait preferences and its impac...CGIAR
This poster was presented by Hellen Opie (National Agricultural Research Organization), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
Commodity corridor approach: Facilitating gender integration in development r...CGIAR
This poster was presented by Eileen Nchanji (International Center for Tropical Agriculture/CIAT), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
Gender and food systems research: Key lessons from the Canadian International...CGIAR
The document summarizes key lessons from analyzing gender integration strategies and outcomes in projects funded by the Canadian International Food Security Research Fund (CIFSRF) between 2009-2018. It finds that projects taking targeted approaches to involve women tended to have narrow outcomes, while those addressing underlying gender barriers and women's empowerment had more impact. The relationship between strategies and outcomes is complex, as higher-level outcomes like empowerment involve mutually reinforcing changes over time. Ensuring gender is central to project design and using common metrics can strengthen integration and outcomes.
Revisiting women's empowerment through a cultural lensCGIAR
This presentation was given by Sarah de Smet (SNV), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
Integrating gender in aquaculture and small scale fisheries agri-food systems...CGIAR
This document summarizes a presentation on integrating gender in aquaculture and small-scale fisheries research. It discusses two key approaches - using a theory of change to make gender assumptions and concerns explicit, and applying a gender lens to each stage of the research project cycle. Common pitfalls in gender integration like focusing only on women or overlooking intersectionality are also outlined. The presentation provides tips for practitioners on how to operationalize gender integration in their work.
Learning to work as a farming family team: Farmer responses to a gender-inclu...CGIAR
This document summarizes research on a gender-inclusive farming family team (FFT) approach used in Papua New Guinea. The research aimed to understand barriers and enablers for women's participation and the model's influence. It found that women learn more when their families are included and communicating roles clearly is important. Practicing concepts concretely on farms aids learning. Key barriers were limited land and climate challenges. Recommendations included continuing the structured FFT approach and using participatory adult learning methods.
Building gender equity from the bottom up in agricultural communitiesCGIAR
This keynote presentation was given by Katherine Gibson (Western Sydney University), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
The role of paid and unpaid labour on sorghum and finger millet production in...CGIAR
This presentation was given by Rachel Gitundu (International Crops Research Institute for the Semi-Arid Tropics / ICRISAT), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
Scrutinizing the 'feminization of agriculture' hypothesis: trajectories of la...CGIAR
This presentation was given by Kartika Juniwaty (Center for International Forestry Research), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
Rural transformation, empowerment, and agricultural linkages in NepalCGIAR
This presentation was given by Kalyani Raghunathan (International Food Policy Research Institute), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
Intra-household decision-making processes: What the qualitative and quantitat...CGIAR
This presentation was given by Juliana Muriel (International Center for Tropical Agriculture / CIAT), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
Developing measures of freedom of movement for gender studies of agricultural...CGIAR
This presentation was given by Jessica Heckert (International Food Policy Research Institute), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
Building intellectual bridges and shared agendas / Strategy and example: gend...CGIAR
This double presentation was given by Jayne Curnow (Australian Centre for International Agricultural Research) and Vicki Wilde (Bill & Melinda Gates Foundation), as part of the Annual Scientific Conference hosted by the University of Canberra and co-sponsored by the University of Canberra, the Australian Centre for International Agricultural Research (ACIAR) and CGIAR Collaborative Platform for Gender Research. The event took place on April 2-4, 2019 in Canberra, Australia.
Read more: https://www.canberra.edu.au/research/faculty-research-centres/aisc/seeds-of-change and https://gender.cgiar.org/annual-conference-2019/
This presentation by Ivan Sergejev from the Estonian Ministry of Finance was part of the Expert Exchange "Youth Empowerment for a Just Energy Transition" held on June 18, 2024.
The FY2025 Proposed Budget Report provides a comprehensive overview of the financial plan for the upcoming fiscal year for the City of Winter Springs. It outlines the city's revenue sources, expenditure plans, and fiscal policies, emphasizing transparency and fiscal responsibility. Key highlights include:
A total proposed budget of approximately $68.3 million, representing a 6% decrease from the prior fiscal year.
A focus on balancing economic growth with environmental conservation, reflecting the city's commitment to maintaining high-quality government services and public infrastructure.
Detailed breakdowns of budget allocations across various departments, including General Fund, Enterprise Funds, and other governmental funds.
An Executive Summary that reviews the financial outlook, funding sources, expenditure highlights, and personnel costs.
Specific budgetary considerations for major projects, capital outlay, debt service, and interfund transfers.
Projections of changes in fund balance and equity for governmental and enterprise funds, ensuring fiscal sustainability and sound financial management.
The report also discusses challenges faced by the city, such as inflation, infrastructure maintenance, and the need for strategic investments in public services and facilities. It includes detailed appendices with financial data, organizational charts, and a glossary of terms. This document serves as a crucial tool for city officials, stakeholders, and residents to understand and engage with the city's financial planning and priorities for FY2025.
INDUSTRY 5.0 STRATEGIC IMPLEMENTATION KEYNOTEMichael Rada
INDUSTRY 5.0 PRINCIPLES can be implemented in any environment, any location, without any limitation related to the size.
The first governments of the world named the importance of INDUSTRY 5.0 for national development already in 2023, but struggled with adoption.
This keynote reveal and help to understand what is needed and how to proceed, so as outline the benefits resulting from the implementation
If any questions, feel free to ask
The original presentation can be viewed on YouTube https://youtu.be/YZUfuw3VBnw
☎️Contact Now ↘️{{86075-75483}}↘️ Kolkata @Call #Girls by Full Service @Call @#Girl In Kolkata
A nutshell review for Hot "Call "Girls in Kolkata((West Bengal)) . MY experience was superb with them this is the only recommended "Call "Girls service in Kolkata"Call "Girls and again then Russian. so overall my practice was magnificent. The price is also moderate per hour. 0
SDG Stocktake Georgia 2024 - SDGs Through the Eyes of Georgia's Business SectorUNGlobalCompactNetwo1
SDGs Through the Eyes of Georgia's Business Sector. The research was carried out by the UN Global Compact Network Georgia in partnership with EY Georgia, funding was provided by Sweden.
In Umthatha (Umtata) [(+27633867063*)] 🏥 Abortion Pills For Sale in Umthatha ...ewvyyt
In Umthatha (Umtata) [(+27633867063*)] 🏥 Abortion Pills For Sale in Umthatha (Umtata) ● Women's Abortion Clinic in Umthatha (Umtata) ● Abortion Pill Prices in Umthatha (Umtata) 🏥🚑!! Abortion Doctors Near me, Abortion Services Near Me, Abortion Pills Over The Counter, Abortion Pill Doctors' Offices, Abortion Clinics, Abortion Places Near Me, Cheap Abortion Places Near Me, Medical Abortion & Surgical Abortion, approved cyctotec pills and womb cleaning pills too plus all the instructions needed This Discrete women’s Termination Clinic offers same day services that are safe and pain free, we use approved pills and we clean the womb so that no side effects are present. Our main goal is that of preventing unintended pregnancies and unwanted births every day to enable more women to have children by choice, not chance. We offer Terminations by Pill and The Morning After Pill.” Our Private VIP Abortion Service offers the ultimate in privacy, efficiency and discretion. we do safe and same day termination and we do also womb cleaning as well its done from 1 week up to 28 weeks. We do delivery of our services world wide SAFE ABORTION CLINICS/PILLS ON SALE WE DO DELIVERY OF PILLS ALSO Abortion clinic at very low costs, 100% Guaranteed and it’s safe, pain free and a same day service. It Is A 45 Minutes Procedure, we use tested abortion pills and we do womb cleaning as well. Alternatively the medical abortion pill and womb cleansing !!!
This presentation by Nadia Combariza, co-executive director of POL.EN Transiciones Justas, was part of the Expert Exchange "Youth Empowerment for a Just Energy Transition" held on June 18, 2024.
Donate to Girl Child Education by Supporting SERUDS CausesSERUDS INDIA
We all can see the increase in the literacy rate over the past few years. This is great because it showcases India has been growing at a rapid pace. Education is the key to entire nation growth. But the major concern is the education of the girl child education. Every other lower-middle-class family or people from rural areas families prefer to send their son to school and daughters are still not sent to school because of financial troubles.
Donate Us
https://serudsindia.org/donate-girl-child-education/
#sponsorforgirlchild, #donateforgirleducation, #girlchildeducation, #ngochildeducation, #donateforeducation, #donationforchildeducation, #sponsorforgirlchildeducation, #onlinegirlchildeducation, #educationforgirlchild, #seruds, #charitydonation, #kurnool, #educationkitforgirlchild
In Johannesburg ^%[+27633867063*Abortion Pills For Sale In Johannesburg Hazy...ivory3872
In Johannesburg ^%[+27633867063*Abortion Pills For Sale In Johannesburg Hazyview In Johannesburg ^%[+27633867063*Abortion Pills For Sale In Johannesburg Hazyview In Johannesburg ^%[+27633867063*Abortion Pills For Sale In Johannesburg Hazyview In Johannesburg ^%[+27633867063*Abortion Pills For Sale In Johannesburg Hazyview In Johannesburg ^%[+27633867063*Abortion Pills For Sale In Johannesburg Hazyview
Presentation by R. Derek Trunkey, an analyst in CBO’s National Security Division, at the 2024 Conference of the Western Economic Association International.
2. Outline:
• Challenges:
o Why Agri-Food Systems Need to Be Transformed
• Opportunities:
o What Science Can Offer to Address these Challenges
• The CGIAR partnership:
o Our Contribution to achieving the UN’s Sustainable
Development Targets
3. ◦ Poor diets are now the #1 cause of ill health globally, overtaking smoking,
with 800 million hungry people, 2 billion malnourished people, 159 million
stunted children and 2 billion people overweight or obese, causing rapid
increases in diabetes in India and heart disease in China. Three quarters of
all overweight children live in Africa and Asia.
◦ Planetary ill health. The food system is the primary driver, and responsible
for soil degradation on 25% of cropped land, deforestation and loss of
biodiversity, water scarcity, pollution of lakes and seas, and circa 25% of all
greenhouse gas emissions
◦ Massive un(der)employment for young people in rural areas, with
employment in the agri-food system, on farms or in the food value chain, as
the only realistic option for 60% of African next generation youth, requiring
over 200 million jobs
What are the challenges going forward?
4. Simply put:
The food we produce and eat is not healthy enough, and the
global food system is vulnerable
The planet is not healthy as a result of the food we produce
Agri-Food Systems need a radical overhaul to provide healthy
diets from sustainable food systems urgently
5. Traditional focus: Increased production calories from
staple foods to reduce hunger.
FAO: Produce 60% more food by 2050 to feed growing and
richer population
7. There are 2 Billion people malnourished and
2 Billion people overweight and obese
8. Brazil, from 2006 to 2012:
Ultra processed products in household diets:
from 20% to 28% (32% in urban areas)
Cooking ingredients: from 37% to 32%.
Prevalence of obesity among adult
increased from 12% to 17%.
Source: Monteiro et al. 2011; Martins et al. 2013
There has been a shift towards obesity and non
communicable diseases
10. Nourishing the world’s cities
Global food security will become primarily an urban challenge in the future.
However, the current international food security agenda is mostly rural-oriented
and still focuses more on food availability than on food access and nutrition.
Food deserts
Urban food security indicators
Informal economy
Rural-urban linkages
11. Meeting the needs of women farmers & generating
employment for youth
Youth and agriculture:
key challenges and
concrete solutions
Youth employment in
agriculture is especially
relevant in Africa, south of
the Sahara
15. Production trends for ‘winner’ and ‘loser’ crops
Khoury et al. 2014
Source of production data 1961 to 2013: FAOSTAT
Time series (annual, 1961 to 2013)
Relativevalue(to1961)
0
1
2
3
4
Rice (paddy)
>> C
>> P
0
1
2
3
4
Groundnuts (withshell)
< C
<< F
0
1
2
3
Coconut
<< C
<< F
0
2
4
6
8
10
12
14
16
18
20
Oil palm (fruit)
>> C
>> F
0
1
2
3
4
Wheat
>> C
>> P
< F
0
1
2
3
4
5
6
7
8
9
10
11
Soybean
>> C
> P
>> F
0
1
2
3
4
5
Cassava
<< C
< P
0
1
2
Millet
<< C
<< P
< F
0
1
2
Sorghum
<< C
<< P
< F
0
1
2
3
4
5
6
7
Sunflower(seed)
>> C
> P
>> F
0
1
2
3
4
5
6
1961
1963
1965
1967
1969
1971
1973
1975
1977
1979
1981
1983
1985
1987
1989
1991
1993
1995
1997
1999
2001
2003
2005
2007
2009
2011
2013
Banana
Production quantity Areaharvested Yield Baseline5 winners
5 losers
16. Maize: nearly X4
Sugar: more than X3
Soyabean: more than X8
Oilpalm fruit: more than X17
0.00
100000000.00
200000000.00
300000000.00
400000000.00
500000000.00
600000000.00
700000000.00
800000000.00
900000000.00
tonnes
World, production
Wheat
Maize
Rice
Other cereals
0.00
50000000.00
100000000.00
150000000.00
200000000.00
250000000.00
tonnes
World, production
Soyabeans
Rape and Mustardseed
Sunflowerseed
Other Oilcrops
Oilpalm fruit
0.00
500000000.00
1000000000.00
1500000000.00
2000000000.00
2500000000.00
tonnes
World, production sugar plants
and products
Source: Agrimonde-Terra
Evolution of agricultural production
17. Production systems for ‘winner’ and ‘loser’ crops
Khoury et al. 2014
Cassava
Coconut
Groundnuts(withshell)
Millet
Sorghum
Banana
Barley
Beans(dry)
Plantain
Sweetpotato
Coffee(green)
Maize(ex.green)
Maize(green)
Potato
Cocoa(beans)
Oilpalm(fruit)
Rice(paddy)
Soybean
Sunflower(seed)
Wheat
Productionsystemdiversity
(intercropping)
5 Losers
Large decrease
5 Winners
Large increase
Increase
Decrease Little change
Relative importance as food (trend, 1961 to 2009)
V. high
High
Medium
Low
Cassava
Coconut
Groundnuts(withshell)
Millet
Sorghum
Banana
Barley
Beans(dry)
Plantain
Sweetpotato
Coffee(green)
Maize(ex.green)
Maize(green)
Potato
Cocoa(beans)
Oilpalm(fruit)
Rice(paddy)
Soybean
Sunflower(seed)
Wheat
Dominant production systems
Other production systems
Winner crops are often grown in monoculture or close to monoculture systems
The implications of their increased success as foods are serious for biodiversity when based on
area expansion and when grown in biodiversity rich areas (e.g., soybean, oil palm)
19. (A) calories in national food supplies B) production quantity in national production systems.
Countries are highly interdependent in regard to the primary regions
of diversity of crops that are important in their food systems.
22. What if trade of agricultural products collapses
The last thirty years have been marked by increased
liberalisation and globalisation, yet a number of uncertainties
could profoundly stop or reverse this trend
• governance local/global
• international negotiations
• food quality and safety standards
• regulations
• climate change
• trade, value chains, food access
24. Food System Foresight challenges:
• Highlight the complexity of food systems
• Still strong focus on production and the main challenges for the
agricultural system
• Focus on defining key actions for sustainable intensification
• Everything is important – difficult to prioritize
• Shows need to increase focus on: (1) nutrition and health; (2)
food value chains; & (3) food loss and waste
25. The world risks exceeding planetary safe
boundaries
Stephen et al. (2015) Planetary boundaries: Guiding human development on a changing planet. sciencemag.org/content/early/recent / 15
January 2015 / Page 1 / 10.1126/science.125985
“Two core boundaries —
climate change & biosphere
integrity— have been
identified, each of which has
the potential on its own to
drive the Earth System into a
new state should they be
substantially and persistently
transgressed.”
26. Non-Ag
Energy
11
4 2
Source: IPCC WGIII
Agriculture as driver of climate change
Agriculture-related activities are 19-29% of global greenhouse gas emissions (2010)
28. In summary: Agri-Food System Challenges
1. Diets are not healthy – particularly for the urban poor
2. Total production is currently sufficient – but access / availability
is not – and up to a third of total food produced is lost / wasted
3. Global diets increasingly homogenized – and increasingly
processed
4. Agri-food systems are globally interdependent and vulnerable to
shocks – food safety, climate change (floods / droughts), food
price volatility
5. Agri-food systems are primary driver of planetary ill health:
climate, water, soils, bio-geo-chemical cycles
29. Daunting challenges - impressive opportunities:
• The life science revolution is changing our understanding of the fundamental biology
of plants, animals and people. It has already transformed medicine and is just now
reaching agriculture.
• Big data approaches are critically transforming the retail end of food value chains
• Open access to agriculture and nutrition related publications and data will increase
access and accelerate agri-food system innovation, and the potential for impact
• Renewed policy focus on the central role of the Bio-economy in the broader sense
31. What’s So Special About New Seed Varieties?
They are like vaccines
• Innovation captured in a small seed/propagule
package:
– Yield
– Land use efficiency
– Water use efficiency
– Nutrient use efficiency
– Resistance to pest and diseases
• Widest reach and impact of technologies:
Global Public Good at scale
• Represents long-term mission driven research
• Infrastructure & capability
• Delivers multiple benefits
• Products & knowledge
32. Cheap high-throughput sequencing is revolutionizing
biology – and only just hitting agri-food sciences
ABI 3730
• Roche 454
• Illumina
• SOLiD (Life
Technologies)
• Helicos
• Pacific
Biosciences
• Roche 454
• Illumina
• SOLiD (Life
Technologies)
• Helicos
• Pacific Biosciences
• Oxford Nanopore
(Illumina)
• Ion Torrent
.01 Corn genome
equivalents per year
0.2 - 0.4 Corn genome
equivalents per day
2001-2007 2007-2014 2014-2020
New
Opportunities
.01 Corn genome
equivalents per
year
.01 Corn genome
equivalents per
year
.01 Corn genome
equivalents per year
0.2 - 0.4 Corn genome
equivalents per day.01 Corn genome
equivalents per
year
.01 Corn genome
equivalents per
year
Hundreds of
thousands of genes
per year
Thousands of
genes per year
Rate of novel gene & allele discovery
Genome per
decade
Genome per
year
>100 genomes
per day
Genome per
day
Rate of genome sequence production
Millions of genes
per year
Tens of millions of
genes per year
Knowledge
33. Crop diversity in CGIAR collections
• 738,000 accessions
• 702,934 seed
• 31,681 tissue culture
• 27,763 whole plants
RESPONDING TO USERS
EVERY YEAR:
~ 2000 requests
~ 130,000 samples distributed
> 100 countries worldwide
6%
94%
35. It is now easy to edit the genomes of crops, animals and humans
Software for the Genome
37. New tools allow us to look in new places for sources of
variation – including wildlife
“Traditional” linkage mapping requires crosses – so initial
discovery is limited to variants within a species
Cow NDama KFITRRPSLKTLQEKGLIKDQIFGSPLHTLCEREKSTVPRFVKQCIEAVEK
Cow Boran KFITRRPSLKTLQEKGLIKDQIFGSHLHTLCEREKSTVPRFVKQCIEAVEK
Human KFISRRPSLKTLQEKGLIKDQIFGSHLHTVCEREHSTVPWFVKQCIEAVEK
Pig KFITRRPSLKTLQEKGLIKDQIFGSHLHTVCERENSTVPRFVKQCIEAVEK
Chicken KFISRRPSLKTLQEKGLIKDQIFGSHLHLVCEHENSTVPQFVRQCIKAVER
Salmon KFISRRPSMKTLQEKGIIKDRVFGCHLLALCEREGTTVPKFVRQCVEAVEK
Comparative gene network and sequence
analysis allows to ask new kinds of
questions about genomes:
eg “what is different about this (group of)
species compared to all other mammals”
38. Simultaneous editing of three homoeoalleles in hexaploid
bread wheat confers heritable resistance to
powdery mildew
42. In summary: Agri-Food Science Opportunities
1. Life science revolution is changing the way ag research does
business – speeding up innovation cycle
2. The exciting new science is bringing a new generation of young
scientists to agri-food science
3. Science is increasingly transdisciplinary, systems / value chain
focused – linking ag – food – health - environment
4. Big Data and ICT revolution is changing precision agriculture and
ability to study systems – natural resources as well as food
systems
5. Renewed “political” interest in bio-economy – with merging
agendas on agri-food, development, environment
43. CGIAR is the only worldwide research partnership addressing agricultural
research for development, whose work contributes to the global efforts to
tackle poverty, food and nutrition insecurity, and environmental degradation.
What is CGIAR?
44. A world free of poverty, hunger and environmental degradation.
Our Vision
To advance agri-food science and innovation to enable poor people,
especially poor women, to increase agricultural productivity and
resilience, share in economic growth, feed themselves and their families
better, and conserve natural resources in the face of climate change and
other threats.
Our Mission
45. o Annual turnover of US$1 billion in
public funding provided by broad
range of key development donors
o 15 non-profit research Centers with
some 10 thousand world class
scientists and support staff on the
ground in over 70 countries
o Unique in public sector to work from
discovery to translational research and
have a product development capacity;
reaching millions of farmers through
work with development partners
o CGIAR genebanks safeguard the world’s
largest germplasm collections for staple
food crops, that provide over 90% of all
recorded transfers under the
International Treaty on Plant Genetic
Resources
CGIAR key facts:
47. Where do we work?
CGIAR has a dedicated staff of 10,000 people in 71 countries with a major presence in
20-odd countries beyond the HQ countries of centers
(Map courtesy of IFPRI)
48. The “second generation” CGIAR Strategy 2016–2030:
• Guides the development and implementation of an ambitious portfolio of
“second-generation” CGIAR Research Programs (CRPs)
• Focuses on selected grand challenges, and is articulated in 3 strategic goals,
or System Level Outcomes (SLOs), which by 2030 will contribute significantly
to the achievement of key Sustainable Development Goals (SDGs)
• Highlights a return on investment evaluated at US$17 for every US$1 put into
CGIAR over its lifetime
49. System Level Outcome (SLO) 1:
Reduced Poverty
2030 Targets
• 350 million more farm households
have adopted improved varieties,
breeds or trees, and/or improved
management practices
• 100 million people, of which 50% are
women, assisted to exit poverty
This outcome contributes directly to the achievement of the following United Nations Sustainable Development Goals
50. Improved Food & Nutrition Security for Health
2030 Targets
• Increase the yield increase rate of major food
staples from current <2.0 to 2.5%/yr.
• 150 million more people, of which 50% are
women, meeting minimum dietary energy
requirements
• 500 million more people, of which 50% are
women, without deficiencies of one or more of
the following essential micronutrients
• 33% reduction in women of reproductive age
who are consuming less than the adequate
number of food groups
This outcome contributes directly to the achievement of the following United Nations Sustainable Development Goals
System Level Outcome (SLO) 2
51. Improved Natural Resource Systems & Ecosystem Services
2030 Targets
• 20% increase in water and nutrient
(inorganic, biological) use efficiency in
agro-ecosystems, including through
recycling and reuse
• Reduce agriculturally-related greenhouse
gas emissions by 0.8 Gt CO2-e yr–1 (15%)
compared with a business as usual
scenario in 2030
• 190 million hectares (ha) degraded land
restored
• 7.5 million ha of forest saved from
deforestation
System Level Outcome (SLO) 3
This outcome contributes directly to the achievement of the following United Nations Sustainable Development Goals
52. Dryland Cereals and Legumes systems
4GlobalIntegratingprograms
3 Platforms
Genetic Gains Big data & ICTGenebanks
Fish agri-food systems
Forest and Agroforestry landscapes
Livestock agri-food systems
Maize agri-food systems
Rice agri-food systems
Roots, tubers and bananas agri-food systems
Wheat agri-food systems
N
U
T
R
I
T
I
O
N
&
H
E
A
L
T
H
P
I
M
W
L
E
C
L
I
M
A
T
E
C
H
A
N
G
E
Portfolio of 2nd generation CGIAR research programs
53. New CGIAR technologies already in the field:
• Scuba rice, which can survive under water for two weeks, is protecting the harvests, incomes,
and food security more than 5 million farmers in Asia.
• New high-yielding, and more nutritious – biofortified - varieties of foods such as maize, cassava,
beans, pearl millet, rice, beans and orange sweet potato are targeted to reach 50 million
consumers by 2018.
• AFLASAFE reduces aflatoxin contamination in African farmers fields by up to 90% - a product
that has 4 atoxigenic strains of the fungus developed by CGIAR with USDA.
• Index-based crop and livestock drought insurance and seasonal weather forecasts now benefit
millions of poor rural households in Africa and Asia.
• Wheat stem rust -Ug99- resistant varieties have been made available, preventing disaster at a
scale affecting many millions of people. Maize lethal necrosis resistant varieties have been
developed through rapid cycling (4 years).
• Agroforestry: unfertilized maize yields under Faidherbia trees average 4.1 tonnes per hectare,
compared to 1.3 tonnes; in Niger, more than 1.2 million households have regenerated 200
million fertilizer trees on their sorghum and millet fields across 5 million hectares.
• Brachhiaria forages with Biological Nitrification Inhibition capacity have reduced greenhouse gas
emissions and improved nitrogen efficiency on 500 thousand hectares.
54. CGIAR discovery research now in the lab:
C4 Rice: targets introduction of more efficient photosynthesis in rice that would yield up to
50% more grain than current varieties, and double water-use efficiency, and increase
nitrogen-use efficiency by 30%
Massive high-throughput sequencing of all 167 thousand accessions in CGIAR’s maize and
wheat genebanks targets breakthroughs in understanding genetic diversity at molecular level
for the whole collection, with over 60 thousand accessions already sequenced and in
genotyping analysis
Discovery of naturally transgenic sweet potatoes that contain genes of Agrobacterium
57. Global Stewardship of Plant Genetic Resources
International Treaty
on Plant Genetic Resources for Food
and Agriculture
CGIAR have committed to PGRFA
being made available in the
multilateral system of access and
benefit sharing
and managed according to
FAO Genebank Standards
59. 2011
Cassava
Provitamin A
DR Congo, Nigeria
2012
Beans
Iron (Zinc)
DR Congo, Rwanda
2012
Maize
Provitamin A
Zambia
2012
Pearl Millet
Iron (Zinc)
India
2013
Rice
Zinc
Bangladesh,
India
2013
Wheat
Zinc
India,
Pakistan
2003
Discovery Development Delivery
2008 2013
2007
Sweet Potato
Provitamin A
Uganda
Mozambique
Nutrient dense food through “bio-fortification” – increasing
Micro-nutrient content of staple foods
Goal: delivery-at-scale to 50 million people by 2018
62. In March 2015, Stéphane Le
Foll announced the
establishment of an
international research
programme, the
“Quatre pour Mille", which
aims to develop agricultural
research to improve organic
matter stocks in soil by four
parts per 1000 (0.4%) per year
Climate Smart Agriculture, 4p1000:
A global research initiative led by France
63. Soil carbon sequestration:
scientific questions
• A steady yearly sequestration rate
only realistic in the first years
(probably below 0.4%)
• Mitigation effect limited in time
• More lasting impact is on resilience
and food security
• But gives a positive role for
agriculture in GHG reduction while
increasing adaptation and food
security
Sommer & Bossio, 2014
64. A sister development initiative on Climate-Smart
Agriculture led by CGIAR
• Design, test and implement
CSA solutions at scale
• Leading to enhanced soil
carbon sequestration
• 5-6 emerging and least
developed countries eligible
to GCF funding
• 200m$ in 5 years
65. Can Agri-Food Systems be Transformed to
Provide Healthy Diets for all?
1. Agri-food system perspective to address complex issues:
– Value chain approach from farm inputs to food safety
– Increased focus on food waste and loss
– Focus on role of women as well as employment for next generation
2. Break through silos of Agriculture, Health and Environment
3. Speeding up Genetic Gain: seize opportunities in Genomics revolution, linked
to genetic resources, modernized breeding programs, big data
4. Increase private sector collaboration and focus on comparative strength
5. Eco-system services approach to sustainability at landscape scale
6. Urgent food system transformation requires scaling up the pace of innovation
– which will need increased investments in research, the driver of innovation